Non-specific serine/threonine protein kinase

Overview
NameNon-specific serine/threonine protein kinase
Smed IDSMED30033568
Length (bp)3102
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Non-specific serine/threonine protein kinase (SMED30033568) t-SNE clustered cells

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30033568) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Non-specific serine/threonine protein kinase (SMED30033568) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Non-specific serine/threonine protein kinase (SMED30033568) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033568

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033568SMESG000032757.1 SMESG000017771.1 SMESG000010058.1 Contig667GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033568SMESG000022857.1 Contig667GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033568SMESG000022857.1 dd_Smed_v4_4198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:HGNC Symbol;Acc:HGNC:10812])

HSP 1 Score: 301.597 bits (771), Expect = 1.688e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 152.525 bits (384), Expect = 9.690e-39
Identity = 81/196 (41.33%), Postives = 103/196 (52.55%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPE                                PPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPE--------------------------------PPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 461          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:HGNC Symbol;Acc:HGNC:10812])

HSP 1 Score: 301.212 bits (770), Expect = 5.983e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 7.703e-64
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:HGNC Symbol;Acc:HGNC:10812])

HSP 1 Score: 301.212 bits (770), Expect = 5.983e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 7.703e-64
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:HGNC Symbol;Acc:HGNC:10812])

HSP 1 Score: 301.212 bits (770), Expect = 5.983e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 7.703e-64
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:HGNC Symbol;Acc:HGNC:10812])

HSP 1 Score: 301.212 bits (770), Expect = 5.983e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 7.703e-64
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: sgk-1 (Serine/threonine-protein kinase sgk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2PJ68])

HSP 1 Score: 215.312 bits (547), Expect = 1.133e-60
Identity = 120/285 (42.11%), Postives = 173/285 (60.70%), Query Frame = 3
Query:  852 KLIKFTEHNMNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLD 1706
            ++++  E   N  + D    DKK +VY + +        + + + E+       K   P      P K+ F   D KF ++R+  +      L+D+      ++VR FF ++  + D                E+N++LG SE K A   DFD++ TIGKGSFG+V+  R K    ++A+K+L KE+I+K+NEVKH+M+ERN+L+ N +HPFL  L+FSFQ K KLYF LD++NGGELF HLQ+E+ FS+ R++FYAAEI  +LGYLH KNIIYRDLKPEN+LLD
Sbjct:   10 RMVRKDEVTCNVIIGD----DKKTVVYALRI---GNGPIMQKTFEEYERFFTTEKDMIPATIFTAPKKK-FLQADSKFYEKRRVWILVISQHLVDNN--LRSEDVRRFFHLESPDDD----------------ENNVDLGPSERKTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKKNEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHEKNIIYRDLKPENLLLD 268          

HSP 2 Score: 209.534 bits (532), Expect = 1.200e-58
Identity = 95/191 (49.74%), Postives = 135/191 (70.68%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYV 2504
            G+++LTDFGLCKE ++   TTSTFCGTPEYLAPE+I K+PYD++VDWW  GSV+YEM+FGLPPFYS+D ++MY +I+N PL L+ N     S+++  L++K+  +RLG++NDF +I+ HPFF  +DW  L+N+++K PF+P+V +  D  NI  EF +  I  S    Q     QL+V   D  F  F++V
Sbjct:  271 GYLVLTDFGLCKEDMQGSKTTSTFCGTPEYLAPEIILKKPYDKTVDWWCLGSVLYEMIFGLPPFYSKDHNEMYDKIINQPLRLKHNISVPCSELITGLLQKDRSKRLGHRNDFRDIRDHPFFLPVDWDKLLNRELKAPFIPKVKNAMDTSNISKEFVEIQIDPSSLAPQ-----QLAVTHRDHDFENFTFV 456          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: sgk-1 (Serine/threonine-protein kinase sgk-1 [Source:UniProtKB/Swiss-Prot;Acc:Q2PJ68])

HSP 1 Score: 214.157 bits (544), Expect = 2.112e-60
Identity = 120/284 (42.25%), Postives = 172/284 (60.56%), Query Frame = 3
Query:  855 LIKFTEHNMNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLD 1706
            +++  E   N  + D    DKK +VY + +        + + + E+       K   P      P K+ F   D KF ++R+  +      L+D+      ++VR FF ++  + D                E+N++LG SE K A   DFD++ TIGKGSFG+V+  R K    ++A+K+L KE+I+K+NEVKH+M+ERN+L+ N +HPFL  L+FSFQ K KLYF LD++NGGELF HLQ+E+ FS+ R++FYAAEI  +LGYLH KNIIYRDLKPEN+LLD
Sbjct:    1 MVRKDEVTCNVIIGD----DKKTVVYALRI---GNGPIMQKTFEEYERFFTTEKDMIPATIFTAPKKK-FLQADSKFYEKRRVWILVISQHLVDNN--LRSEDVRRFFHLESPDDD----------------ENNVDLGPSERKTATANDFDYLTTIGKGSFGRVYQVRHKETKKIYAMKILSKEHIRKKNEVKHVMAERNVLINNFKHPFLVSLHFSFQNKEKLYFVLDHLNGGELFSHLQREKHFSESRSRFYAAEIACALGYLHEKNIIYRDLKPENLLLD 258          

HSP 2 Score: 209.149 bits (531), Expect = 1.136e-58
Identity = 95/191 (49.74%), Postives = 135/191 (70.68%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYV 2504
            G+++LTDFGLCKE ++   TTSTFCGTPEYLAPE+I K+PYD++VDWW  GSV+YEM+FGLPPFYS+D ++MY +I+N PL L+ N     S+++  L++K+  +RLG++NDF +I+ HPFF  +DW  L+N+++K PF+P+V +  D  NI  EF +  I  S    Q     QL+V   D  F  F++V
Sbjct:  261 GYLVLTDFGLCKEDMQGSKTTSTFCGTPEYLAPEIILKKPYDKTVDWWCLGSVLYEMIFGLPPFYSKDHNEMYDKIINQPLRLKHNISVPCSELITGLLQKDRSKRLGHRNDFRDIRDHPFFLPVDWDKLLNRELKAPFIPKVKNAMDTSNISKEFVEIQIDPSSLAPQ-----QLAVTHRDHDFENFTFV 446          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pkc-3 (Protein kinase C-like 3 [Source:UniProtKB/Swiss-Prot;Acc:Q19266])

HSP 1 Score: 184.882 bits (468), Expect = 4.576e-49
Identity = 127/418 (30.38%), Postives = 196/418 (46.89%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTPISRLMK*FRSRKVV-RKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPF---YSQDTHQ-----MYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDE----IKVHPFFSQ-IDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPI 2513
            DF  +  IG+GS+ KV  A   S   ++A+K++ KE   +  ++  + +E+++      +PFL  L+  FQT+ +L+F +++V GG+L FH+Q++R   ++ A+F                                       Y G++IL  +F+            SR ++ R LK                            LI   GHI LTD+G+CKE I+    TSTFCGTP Y+APE+++ + Y  SVDWW+ G +++EM+ G  PF     Q++ +     ++Q IL   + +  +     S IL   + K+P ERLG K D +E    +K H FF   IDW AL  K V PP+ P V S+ D+ + D +F  E    S  N  +  R   S       F GF YV P+
Sbjct:  252 DFRLLTVIGRGSYAKVVQAEHVSTRQIYAIKIIKKEMFNEDEDIDWVQTEKSVFEAASNYPFLVGLHSCFQTESRLFFVIEFVPGGDLMFHMQQQRKLPEEHARF---------------------------------------YSGEIILALHFL-----------HSRGIIYRDLKLDNV------------------------LIDAEGHIKLTDYGMCKENIKDGDLTSTFCGTPNYIAPEILRGDEYGFSVDWWALGVLMFEMMAGRSPFDIVGMQNSEENTEDYLFQIILERQIRIPRSLSVRASGILKGFLNKDPTERLGCKLDINEGLRDMKEHQFFRGFIDWEALEQKAVAPPYHPAVESDRDLTHFDHQFTDELPQLSPDNPDVIARIDQS------EFDGFEYVNPL 589          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 156.377 bits (394), Expect = 2.209e-39
Identity = 79/196 (40.31%), Postives = 114/196 (58.16%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGY---KNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GH  L DFG+CKEGI ++  TSTFCGTP+Y+APE++++  Y  SVDWW+ G ++YEM+ G PPF + +   +++ ILN  +           +IL   + KN  +RLG    +   D I+ HPFF +IDW AL ++QVKPPF P++ S  D  N D +F KE    +  +  + R          D F GFS++ P
Sbjct:  427 GHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAIN------QDEFRGFSFINP 616          

HSP 2 Score: 152.14 bits (383), Expect = 4.676e-38
Identity = 70/137 (51.09%), Postives = 99/137 (72.26%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ 1712
            DF F+K +GKGSFGKV LA RK    V+A+K+L K+ I + ++V+  M E+ IL    +HPFL  L+ SFQT  +L+F ++YVNGG+L F +Q+ R F + RA+FYAAE+  +L +LH  ++IYRDLK +NILLDA+
Sbjct:  290 DFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAE 426          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 155.992 bits (393), Expect = 5.228e-39
Identity = 79/196 (40.31%), Postives = 114/196 (58.16%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGY---KNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GH  L DFG+CKEGI ++  TSTFCGTP+Y+APE++++  Y  SVDWW+ G ++YEM+ G PPF + +   +++ ILN  +           +IL   + KN  +RLG    +   D I+ HPFF +IDW AL ++QVKPPF P++ S  D  N D +F KE    +  +  + R          D F GFS++ P
Sbjct:  514 GHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPKIKSKRDANNFDSDFTKEEPVLTPSDPAVVRAIN------QDEFRGFSFINP 703          

HSP 2 Score: 152.525 bits (384), Expect = 8.513e-38
Identity = 70/137 (51.09%), Postives = 99/137 (72.26%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ 1712
            DF F+K +GKGSFGKV LA RK    V+A+K+L K+ I + ++V+  M E+ IL    +HPFL  L+ SFQT  +L+F ++YVNGG+L F +Q+ R F + RA+FYAAE+  +L +LH  ++IYRDLK +NILLDA+
Sbjct:  377 DFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAE 513          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083226)

HSP 1 Score: 161.384 bits (407), Expect = 1.394e-41
Identity = 79/168 (47.02%), Postives = 106/168 (63.10%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPN 2432
            GHI + DFGLCKE I    TT TFCGTPEYLAPEV+    Y ++VDWW  G V+YEM+ G  PFY++D   ++  IL   +    N      ++L  L+ K+PK+RL G K+D  EI+ HPFF+ I+W  LV K++ PPF PQV+S+ D R  D EF  E +  + P+
Sbjct:  320 GHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPD 487          

HSP 2 Score: 159.844 bits (403), Expect = 5.061e-41
Identity = 87/217 (40.09%), Postives = 127/217 (58.53%), Query Frame = 3
Query: 1089 KQRKEGLNEFVTKLLDSPDIWEL-KEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q  E +    ++L+D  ++     E  D   +D      +E   Q +V     +   +     EN       F+F+K +GKG+FGKV L R K+   ++A+K+L KE I +++EV H ++E  +L ++  HPFL  L +SFQT  +L F + YVNGGELF+HL  ER F++ R +FY AEI S+LGYLHS+ IIYRDLK EN+LLD    I V  +
Sbjct:  119 QQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLEN-------FEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVL-KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADF 327          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0344470)

HSP 1 Score: 161.384 bits (407), Expect = 1.394e-41
Identity = 79/168 (47.02%), Postives = 106/168 (63.10%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPN 2432
            GHI + DFGLCKE I    TT TFCGTPEYLAPEV+    Y ++VDWW  G V+YEM+ G  PFY++D   ++  IL   +    N      ++L  L+ K+PK+RL G K+D  EI+ HPFF+ I+W  LV K++ PPF PQV+S+ D R  D EF  E +  + P+
Sbjct:  320 GHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPD 487          

HSP 2 Score: 159.844 bits (403), Expect = 5.061e-41
Identity = 87/217 (40.09%), Postives = 127/217 (58.53%), Query Frame = 3
Query: 1089 KQRKEGLNEFVTKLLDSPDIWEL-KEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q  E +    ++L+D  ++     E  D   +D      +E   Q +V     +   +     EN       F+F+K +GKG+FGKV L R K+   ++A+K+L KE I +++EV H ++E  +L ++  HPFL  L +SFQT  +L F + YVNGGELF+HL  ER F++ R +FY AEI S+LGYLHS+ IIYRDLK EN+LLD    I V  +
Sbjct:  119 QQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLEN-------FEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVL-KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADF 327          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0344717)

HSP 1 Score: 161.384 bits (407), Expect = 1.394e-41
Identity = 79/168 (47.02%), Postives = 106/168 (63.10%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPN 2432
            GHI + DFGLCKE I    TT TFCGTPEYLAPEV+    Y ++VDWW  G V+YEM+ G  PFY++D   ++  IL   +    N      ++L  L+ K+PK+RL G K+D  EI+ HPFF+ I+W  LV K++ PPF PQV+S+ D R  D EF  E +  + P+
Sbjct:  320 GHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPD 487          

HSP 2 Score: 159.844 bits (403), Expect = 5.061e-41
Identity = 87/217 (40.09%), Postives = 127/217 (58.53%), Query Frame = 3
Query: 1089 KQRKEGLNEFVTKLLDSPDIWEL-KEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q  E +    ++L+D  ++     E  D   +D      +E   Q +V     +   +     EN       F+F+K +GKG+FGKV L R K+   ++A+K+L KE I +++EV H ++E  +L ++  HPFL  L +SFQT  +L F + YVNGGELF+HL  ER F++ R +FY AEI S+LGYLHS+ IIYRDLK EN+LLD    I V  +
Sbjct:  119 QQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLEN-------FEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVL-KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADF 327          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Akt1 (gene:FBgn0010379 transcript:FBtr0083227)

HSP 1 Score: 161.384 bits (407), Expect = 1.394e-41
Identity = 79/168 (47.02%), Postives = 106/168 (63.10%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPN 2432
            GHI + DFGLCKE I    TT TFCGTPEYLAPEV+    Y ++VDWW  G V+YEM+ G  PFY++D   ++  IL   +    N      ++L  L+ K+PK+RL G K+D  EI+ HPFF+ I+W  LV K++ PPF PQV+S+ D R  D EF  E +  + P+
Sbjct:  320 GHIKVADFGLCKEDITYGRTTKTFCGTPEYLAPEVLDDNDYGQAVDWWGTGVVMYEMICGRLPFYNRDHDVLFTLILVEEVKFPRNITDEAKNLLAGLLAKDPKKRLGGGKDDVKEIQAHPFFASINWTDLVLKKIPPPFKPQVTSDTDTRYFDKEFTGESVELTPPD 487          

HSP 2 Score: 159.844 bits (403), Expect = 5.061e-41
Identity = 87/217 (40.09%), Postives = 127/217 (58.53%), Query Frame = 3
Query: 1089 KQRKEGLNEFVTKLLDSPDIWEL-KEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q  E +    ++L+D  ++     E  D   +D      +E   Q +V     +   +     EN       F+F+K +GKG+FGKV L R K+   ++A+K+L KE I +++EV H ++E  +L ++  HPFL  L +SFQT  +L F + YVNGGELF+HL  ER F++ R +FY AEI S+LGYLHS+ IIYRDLK EN+LLD    I V  +
Sbjct:  119 QQWTEAIRNVSSRLIDVGEVAMTPSEQTDMTDVDMATIAEDELSEQFSVQGTTCNSSGVKKVTLEN-------FEFLKVLGKGTFGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTLTESRVL-KSTNHPFLISLKYSFQTNDRLCFVMQYVNGGELFWHLSHERIFTEDRTRFYGAEIISALGYLHSQGIIYRDLKLENLLLDKDGHIKVADF 327          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Match: Pkc98E (gene:FBgn0003093 transcript:FBtr0301516)

HSP 1 Score: 160.999 bits (406), Expect = 3.400e-41
Identity = 81/198 (40.91%), Postives = 118/198 (59.60%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNS----PLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKE-PISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GH  L DFG+CKEGI     T+TFCGTP+Y+APE++K++ Y  SVDWW+ G ++YEM+ G PPF + +  +++  I++     P+ L     S++   L     KNP++RLG   D +EI+ HPFF+++DW  L  + +KPPF P++ +  D  N D EF KE P+   I N  +    Q       D F GFS+V P
Sbjct:  359 GHCKLADFGMCKEGIMNGMLTTTFCGTPDYIAPEILKEQEYGASVDWWALGVLMYEMMAGQPPFEADNEDELFDSIMHDDVLYPVWLSREAVSILKGFLT----KNPEQRLGCTGDENEIRKHPFFAKLDWKELEKRNIKPPFRPKMKNPRDANNFDAEFTKEDPVLTPIGNEVVRCINQ-------DEFAGFSFVNP 545          

HSP 2 Score: 148.288 bits (373), Expect = 5.905e-37
Identity = 69/137 (50.36%), Postives = 95/137 (69.34%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ 1712
            DF+FIK +GKGSFGKV LA +K    ++A+KVL K+ I + ++V   M+E+ IL     HPFL  L+  FQT  +L+F ++YVNGG+L F +QK R F   RA FYAAE+  +L +LH+  +IYRDLK +NILLD +
Sbjct:  222 DFNFIKVLGKGSFGKVMLAEKKGTDEIYAIKVLKKDAIIQDDDVDCTMTEKRILALAANHPFLTALHSCFQTPDRLFFVMEYVNGGDLMFQIQKARRFEASRAAFYAAEVTLALQFLHTHGVIYRDLKLDNILLDQE 358          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: sgk3 (serum/glucocorticoid regulated kinase family member 3 [Source:ZFIN;Acc:ZDB-GENE-070424-62])

HSP 1 Score: 301.212 bits (770), Expect = 2.978e-91
Identity = 153/282 (54.26%), Postives = 202/282 (71.63%), Query Frame = 3
Query:  897 DQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDR-QNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q    K+Y VYK+ V      WFV RRY EF  L + LKK  P LNLK+P KR+FG  FDP+FIKQR+ GL+EF+ +++    +    +V+ F  +D+ +N+    + S++  D++     NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +A+KVL K+ I  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQKER+F + RA+FY AE+ S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   17 EQRDKKKRYTVYKVMVSVGRHEWFVFRRYAEFDKLYNTLKKQFPALNLKIPAKRIFGDNFDPEFIKQRRAGLHEFIQRIVSHSQLCSHPDVKVFLQMDKAKNF---SDGSEDEDDKSNSTSRNINLGPSANPHAKPTDFDFLKVIGKGSFGKVLLAKRKRDGKCYAIKVLQKKVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFFHLQKERTFPEPRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDF 295          

HSP 2 Score: 238.424 bits (607), Expect = 2.177e-68
Identity = 107/197 (54.31%), Postives = 139/197 (70.56%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDEN 2522
            GHI+LTDFGLCKEGI +  TT+TFCGTPEYLAPEV++K+PYD +VDWW  GSV+YEML+GLPPFYS+DTH+MY  IL+  L +R    +    IL  L+ K+   RLGY++DF+E+K H FFS I+W  L  K++ PPF P V S  DI N DPEF +E +  S+  S        SV + DD+F+GFSY PP +++
Sbjct:  288 GHIVLTDFGLCKEGISQADTTTTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMYDNILHKELVMRPGASTAAWSILQTLLEKDHTRRLGYRDDFNEVKEHEFFSSINWYDLEQKKLSPPFNPSVESQYDISNFDPEFTEETVPNSVCFSSGPSIVNASVMEADDAFLGFSYAPPSEDS 484          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 235.728 bits (600), Expect = 9.920e-71
Identity = 121/218 (55.50%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQRK GLN+F+ KL  +    +  EV+    +       + E+   N          INLG S N  AKP+DFDF+K IGKGSFGKV LAR +SD   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   10 FMKQRKMGLNDFIQKLSANSYACKHPEVQSILNL---TPPQDVELMNSNPSPPPSPSQQINLGPSSNPTAKPSDFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 224          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 236.113 bits (601), Expect = 2.642e-70
Identity = 121/218 (55.50%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQRK GLN+F+ KL  +    +  EV+    +       + E+   N          INLG S N  AKP+DFDF+K IGKGSFGKV LAR +SD   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   11 FMKQRKMGLNDFIQKLSANSYACKHPEVQSILNLTP---PQDVELMNSNPSPPPSPSQQINLGPSSNPTAKPSDFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 225          

HSP 2 Score: 96.6709 bits (239), Expect = 1.341e-21
Identity = 40/47 (85.11%), Postives = 43/47 (91.49%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDW 2072
            GHIILTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDW
Sbjct:  218 GHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDW 264          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 236.498 bits (602), Expect = 2.379e-68
Identity = 121/218 (55.50%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQRK GLN+F+ KL  +    +  EV+    +       + E+   N          INLG S N  AKP+DFDF+K IGKGSFGKV LAR +SD   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   29 FMKQRKMGLNDFIQKLSANSYACKHPEVQSILNLTPP---QDVELMNSNPSPPPSPSQQINLGPSSNPTAKPSDFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 243          

HSP 2 Score: 234.572 bits (597), Expect = 1.210e-67
Identity = 107/196 (54.59%), Postives = 139/196 (70.92%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHIILTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +    +L  L++K+  +RLG+ +DF EIK H FFS I+W  L  K++ PPF P V+   D+R+ DPEF  EP+  SI  S  +     S+ +  ++F+GFSY P +D 
Sbjct:  236 GHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGFTDDFTEIKNHMFFSPINWDDLNAKKLTPPFNPNVTGPNDLRHFDPEFTDEPVPNSIGCSPDSALVTSSITEATEAFLGFSYAPAMDS 431          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 236.498 bits (602), Expect = 2.379e-68
Identity = 121/218 (55.50%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQRK GLN+F+ KL  +    +  EV+    +       + E+   N          INLG S N  AKP+DFDF+K IGKGSFGKV LAR +SD   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   29 FMKQRKMGLNDFIQKLSANSYACKHPEVQSILNLTPP---QDVELMNSNPSPPPSPSQQINLGPSSNPTAKPSDFDFLKVIGKGSFGKVLLARHRSDEKFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 243          

HSP 2 Score: 234.572 bits (597), Expect = 1.210e-67
Identity = 107/196 (54.59%), Postives = 139/196 (70.92%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHIILTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +    +L  L++K+  +RLG+ +DF EIK H FFS I+W  L  K++ PPF P V+   D+R+ DPEF  EP+  SI  S  +     S+ +  ++F+GFSY P +D 
Sbjct:  236 GHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNISNAARHLLEGLLQKDRTKRLGFTDDFTEIKNHMFFSPINWDDLNAKKLTPPFNPNVTGPNDLRHFDPEFTDEPVPNSIGCSPDSALVTSSITEATEAFLGFSYAPAMDS 431          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:100491891])

HSP 1 Score: 290.812 bits (743), Expect = 9.742e-89
Identity = 147/277 (53.07%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHE-EEVSQENVDE-NYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP FI+QR+ GLNEF+  LL   ++    +V+ F  +D   +  +  E   E VD+ N     ++NLG S N  AKP+DF+++K IGKGSFGKV L R K DG  +AVKVL K  I  + E +HIM+ERN+L++N++HPFL  L++SFQT  KL+F LD++NGGELFFHLQ+ER F++ RA FYAAEIGS+LGYLHS +IIYRDLKPENILLD+Q  I++  +
Sbjct:   23 KRFTVYKVIVSMGRNEWFVFRRYAEFDKLYNTLRKQYPHMNLKIPAKRIFGDNFDPDFIQQRRAGLNEFIQNLLRHSELCSHSDVQSFLQLDSPKHQSDPSEDEDERVDQKNGSASRDVNLGPSGNPHAKPSDFEYLKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYSFQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILLDSQGHIVLTDF 299          

HSP 2 Score: 57.3806 bits (137), Expect = 7.167e-8
Identity = 23/29 (79.31%), Postives = 24/29 (82.76%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPE 2018
            GHI+LTDFGLCKEGI    TT TFCGTPE
Sbjct:  292 GHIVLTDFGLCKEGISNSDTTLTFCGTPE 320          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:100491891])

HSP 1 Score: 290.812 bits (743), Expect = 3.729e-87
Identity = 147/277 (53.07%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHE-EEVSQENVDE-NYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP FI+QR+ GLNEF+  LL   ++    +V+ F  +D   +  +  E   E VD+ N     ++NLG S N  AKP+DF+++K IGKGSFGKV L R K DG  +AVKVL K  I  + E +HIM+ERN+L++N++HPFL  L++SFQT  KL+F LD++NGGELFFHLQ+ER F++ RA FYAAEIGS+LGYLHS +IIYRDLKPENILLD+Q  I++  +
Sbjct:   29 KRFTVYKVIVSMGRNEWFVFRRYAEFDKLYNTLRKQYPHMNLKIPAKRIFGDNFDPDFIQQRRAGLNEFIQNLLRHSELCSHSDVQSFLQLDSPKHQSDPSEDEDERVDQKNGSASRDVNLGPSGNPHAKPSDFEYLKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYSFQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILLDSQGHIVLTDF 305          

HSP 2 Score: 228.409 bits (581), Expect = 1.543e-64
Identity = 109/196 (55.61%), Postives = 133/196 (67.86%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHI+LTDFGLCKEGI    TT TFCGTPEYLAPEVI K+PYD +VDWW  GSV+YEML GLPPFY++DT  MY+ IL+ PL  R +       IL +L+ K+PK RLG  NDF  IK H FF+ I+W  LV K++ PP+ P V+   DI N D EF +E +  S+  S        SVE+ DD+FVGFSY PP D+
Sbjct:  298 GHIVLTDFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHGLPPFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLGVNNDFVHIKNHAFFASINWADLVEKKMTPPYDPHVNGPDDISNFDKEFTEEMVPYSVCVSSDYSIVNASVEEADDAFVGFSYAPPSDD 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:100491891])

HSP 1 Score: 290.812 bits (743), Expect = 3.768e-87
Identity = 147/277 (53.07%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHE-EEVSQENVDE-NYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP FI+QR+ GLNEF+  LL   ++    +V+ F  +D   +  +  E   E VD+ N     ++NLG S N  AKP+DF+++K IGKGSFGKV L R K DG  +AVKVL K  I  + E +HIM+ERN+L++N++HPFL  L++SFQT  KL+F LD++NGGELFFHLQ+ER F++ RA FYAAEIGS+LGYLHS +IIYRDLKPENILLD+Q  I++  +
Sbjct:   29 KRFTVYKVIVSMGRNEWFVFRRYAEFDKLYNTLRKQYPHMNLKIPAKRIFGDNFDPDFIQQRRAGLNEFIQNLLRHSELCSHSDVQSFLQLDSPKHQSDPSEDEDERVDQKNGSASRDVNLGPSGNPHAKPSDFEYLKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYSFQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILLDSQGHIVLTDF 305          

HSP 2 Score: 229.565 bits (584), Expect = 5.142e-65
Identity = 109/196 (55.61%), Postives = 134/196 (68.37%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHI+LTDFGLCKEGI    TT TFCGTPEYLAPEVI K+PYD +VDWW  GSV+YEML GLPPFY++DT  MY+ IL+ PL  R +       IL +L+ K+PK RLG  NDF +IK H FF+ I+W  LV K++ PP+ P V+   DI N D EF +E +  S+  S        SVE+ DD+FVGFSY PP D+
Sbjct:  298 GHIVLTDFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHGLPPFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLGVNNDFQDIKNHAFFASINWADLVEKKMTPPYDPHVNGPDDISNFDKEFTEEMVPYSVCVSSDYSIVNASVEEADDAFVGFSYAPPSDD 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:100491891])

HSP 1 Score: 280.796 bits (717), Expect = 1.083e-83
Identity = 142/275 (51.64%), Postives = 193/275 (70.18%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP FI+QR+ GLNEF+  LL   ++    +V+ F  +D     H+ + S+   DE+   +  +N  +     AKP+DF+++K IGKGSFGKV L R K DG  +AVKVL K  I  + E +HIM+ERN+L++N++HPFL  L++SFQT  KL+F LD++NGGELFFHLQ+ER F++ RA FYAAEIGS+LGYLHS +IIYRDLKPENILLD+Q  I++  +
Sbjct:   23 KRFTVYKVIVSMGRNEWFVFRRYAEFDKLYNTLRKQYPHMNLKIPAKRIFGDNFDPDFIQQRRAGLNEFIQNLLRHSELCSHSDVQSFLQLDSPK--HQSDPSE---DEDERVDQKVNYSILNLCSAKPSDFEYLKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYSFQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILLDSQGHIVLTDF 292          

HSP 2 Score: 230.335 bits (586), Expect = 2.312e-65
Identity = 109/196 (55.61%), Postives = 134/196 (68.37%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHI+LTDFGLCKEGI    TT TFCGTPEYLAPEVI K+PYD +VDWW  GSV+YEML GLPPFY++DT  MY+ IL+ PL  R +       IL +L+ K+PK RLG  NDF +IK H FF+ I+W  LV K++ PP+ P V+   DI N D EF +E +  S+  S        SVE+ DD+FVGFSY PP D+
Sbjct:  285 GHIVLTDFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHGLPPFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLGVNNDFQDIKNHAFFASINWADLVEKKMTPPYDPHVNGPDDISNFDKEFTEEMVPYSVCVSSDYSIVNASVEEADDAFVGFSYAPPSDD 480          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Match: SGK3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:100491891])

HSP 1 Score: 261.536 bits (667), Expect = 3.690e-77
Identity = 138/271 (50.92%), Postives = 178/271 (65.68%), Query Frame = 3
Query:  927 VYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP FI+QR+ GLNEF+  LL                       H E  S  ++         +NL       AKP+DF+++K IGKGSFGKV L R K DG  +AVKVL K  I  + E +HIM+ERN+L++N++HPFL  L++SFQT  KL+F LD++NGGELFFHLQ+ER F++ RA FYAAEIGS+LGYLHS +IIYRDLKPENILLD+Q  I++  +
Sbjct:   12 VYKVIVSMGRNEWFVFRRYAEFDKLYNTLRKQYPHMNLKIPAKRIFGDNFDPDFIQQRRAGLNEFIQNLLR----------------------HSELCSHYSI---------LNLCS-----AKPSDFEYLKLIGKGSFGKVVLTRGKRDGRYYAVKVLQKNVILNKKEQRHIMAERNVLLKNVKHPFLVTLHYSFQTSDKLFFVLDFINGGELFFHLQRERYFAEPRALFYAAEIGSALGYLHSIDIIYRDLKPENILLDSQGHIVLTDF 246          

HSP 2 Score: 222.246 bits (565), Expect = 4.617e-63
Identity = 109/196 (55.61%), Postives = 133/196 (67.86%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHI+LTDFGLCKEGI    TT TFCGTPEYLAPEVI K+PYD +VDWW  GSV+YEML GLPPFY++DT  MY+ IL+ PL  R +       IL +L+ K+PK RLG  NDF  IK H FF+ I+W  LV K++ PP+ P V+   DI N D EF +E +  S+  S        SVE+ DD+FVGFSY PP D+
Sbjct:  239 GHIVLTDFGLCKEGISNSDTTLTFCGTPEYLAPEVIVKQPYDNTVDWWCLGSVLYEMLHGLPPFYNRDTATMYENILHKPLTTRPDISLPAISILEELLEKDPKLRLGVNNDFVHIKNHAFFASINWADLVEKKMTPPYDPHVNGPDDISNFDKEFTEEMVPYSVCVSSDYSIVNASVEEADDAFVGFSYAPPSDD 434          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Sgk3 (serum/glucocorticoid regulated kinase 3 [Source:MGI Symbol;Acc:MGI:2182368])

HSP 1 Score: 304.294 bits (778), Expect = 1.743e-94
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 57.7658 bits (138), Expect = 3.804e-8
Identity = 22/29 (75.86%), Postives = 25/29 (86.21%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPE 2018
            GH++LTDFGLCKEGI    TT+TFCGTPE
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPE 326          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Sgk3 (serum/glucocorticoid regulated kinase 3 [Source:MGI Symbol;Acc:MGI:2182368])

HSP 1 Score: 303.908 bits (777), Expect = 4.078e-94
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 58.151 bits (139), Expect = 2.959e-8
Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYL 2024
            GH++LTDFGLCKEGI    TT+TFCGTPE L
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEIL 328          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Sgk3 (serum/glucocorticoid regulated kinase 3 [Source:MGI Symbol;Acc:MGI:2182368])

HSP 1 Score: 303.523 bits (776), Expect = 6.021e-92
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 226.098 bits (575), Expect = 6.560e-64
Identity = 105/196 (53.57%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ KN + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Sgk3 (serum/glucocorticoid regulated kinase 3 [Source:MGI Symbol;Acc:MGI:2182368])

HSP 1 Score: 303.523 bits (776), Expect = 6.021e-92
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 226.098 bits (575), Expect = 6.560e-64
Identity = 105/196 (53.57%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ KN + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Match: Sgk3 (serum/glucocorticoid regulated kinase 3 [Source:MGI Symbol;Acc:MGI:2182368])

HSP 1 Score: 303.523 bits (776), Expect = 6.021e-92
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 226.098 bits (575), Expect = 6.560e-64
Identity = 105/196 (53.57%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ KN + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q8R4V0|SGK3_RAT (Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus OX=10116 GN=Sgk3 PE=1 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 2.970e-91
Identity = 151/277 (54.51%), Postives = 197/277 (71.12%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP+DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTPKPHSTSRNINLGPTGNPHAKPSDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 228.409 bits (581), Expect = 7.634e-64
Identity = 106/196 (54.08%), Postives = 133/196 (67.86%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYDR+VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ KN + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDRTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q9ERE3|SGK3_MOUSE (Serine/threonine-protein kinase Sgk3 OS=Mus musculus OX=10090 GN=Sgk3 PE=1 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 4.211e-91
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNSLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTSKPHSTSRNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEPRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDF 305          

HSP 2 Score: 226.098 bits (575), Expect = 4.588e-63
Identity = 105/196 (53.57%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ KN + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLNLRPGVSLTAWSILEELLEKNRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDAVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q5R7A7|SGK3_PONAB (Serine/threonine-protein kinase Sgk3 OS=Pongo abelii OX=9601 GN=SGK3 PE=2 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.873e-90
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 3.699e-63
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q96BR1|SGK3_HUMAN (Serine/threonine-protein kinase Sgk3 OS=Homo sapiens OX=9606 GN=SGK3 PE=1 SV=1)

HSP 1 Score: 301.212 bits (770), Expect = 2.873e-90
Identity = 151/277 (54.51%), Postives = 196/277 (70.76%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  +   D  E+  + +  + +    NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +
Sbjct:   29 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFVNGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDF 305          

HSP 2 Score: 226.483 bits (576), Expect = 3.699e-63
Identity = 104/196 (53.06%), Postives = 132/196 (67.35%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:  298 GHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWADLVQKKIPPPFNPNVAGPDDIRNFDTAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 493          
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Match: sp|Q06226|SGK1_RAT (Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus OX=10116 GN=Sgk1 PE=1 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 5.641e-70
Identity = 111/195 (56.92%), Postives = 145/195 (74.36%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            GHI+LTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +    +L  L++K+  +RLG K+DF EIK H FFS I+W  L+NK++ PPF P VS  +D+R+ DPEF +EP+  SI  S  +     SV++  ++F+GFSY PP+D
Sbjct:  234 GHIVLTDFGLCKENIEHNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLK-NITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHIFFSLINWDDLINKKITPPFNPNVSGPSDLRHFDPEFTEEPVPSSIGRSPDSILVTASVKEAAEAFLGFSYAPPMD 427          

HSP 2 Score: 242.276 bits (617), Expect = 1.455e-69
Identity = 122/218 (55.96%), Postives = 157/218 (72.02%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQR+ GLN+F+ KL ++    +  EV+ +  I +     E E+   N          INLG S N  AKP+DF F+K IGKGSFGKV LAR K++ A +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L+FSFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   27 FMKQRRMGLNDFIQKLANNSYACKHPEVQSYLKISQ---PQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDF 241          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A5E4CKX9 (Non-specific serine/threonine protein kinase OS=Marmota monax OX=9995 GN=MONAX_5E023581 PE=4 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 1.914e-163
Identity = 263/544 (48.35%), Postives = 346/544 (63.60%), Query Frame = 3
Query:  915 KKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID--RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY----PGDMILRFYFVFTPISRLMK*FRSRKVV--RKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            K++ VYK+ V      WFV RRY EF  L + LKK  P + LK+P KR+FG  FDP FIKQR+ GLNEF+  L+  P+++   +VR F  +D  R   D  E+  + +  + +    NINLG + N  AKP DFDF+K IGKGSFGKV LA+RK DG  +AVKVL K+ +  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD++NGGELFFHLQ+ERSF + RA+FYAAEI S+LGYLHS  I+YRDLKPENILLD+   +++  +     G  I      F     L    +  +     + +F  A     +  + S  + +R       L+   GH++LTDFGLCKEGI    TT+TFCGTPEYLAPEVI+K+PYD +VDWW  G+V+YEML+GLPPFY +D  +MY  IL+ PL LR         IL +L+ K+ + RLG K DF EI+ HPFF  + W  LV K++ PPF P V+   DIRN D  F +E +  S+  S        SV + DD+FVGFSY PP ++
Sbjct:   23 KRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLKKQFPAMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERSTQKLHSTSQNINLGPTGNPHAKPTDFDFLKVIGKGSFGKVLLAKRKLDGKFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFINGGELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWTDLVQKKIPPPFNPNVAGPDDIRNFDTVFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFSYAPPSED 566          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A267FGH5 (Non-specific serine/threonine protein kinase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007623g1 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 4.790e-98
Identity = 167/287 (58.19%), Postives = 202/287 (70.38%), Query Frame = 3
Query:  885 ARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGK-RLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGID----------RQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ 1712
            A++ + ET  KK  VYKI V     SWF+LRRY EF+ L D LKK  P   LKLP K R FG  D ++++QR+E L+  V  L+  P I EL +V +F G+D               H   V           E+NI+LG  EN+ A P+DF F+K IGKGSFGKVFLA+RKSDG +FAVKVL KE IKKRNEVKHIMSERN+LV+N+ HPFLC L+ SF+T  KLYF LDYVNGGELFFHLQ+ERSFS+ RA+FYAAEI S++GYLHSK+IIYRDLKPENILLD++
Sbjct:    6 AQIVESETT-KKATVYKICVSSGGNSWFILRRYKEFSNLYDRLKKQYPEAGLKLPSKPRFFGGADAEYLRQRREALHSMVQILMTHPQISELPDVINFLGLDVNPSRLTSASTSTATHASAVEGAADTGGGKEEENIDLGAKENRKATPSDFAFLKVIGKGSFGKVFLAKRKSDGRIFAVKVLQKEQIKKRNEVKHIMSERNVLVRNIEHPFLCALHMSFRTPDKLYFVLDYVNGGELFFHLQRERSFSESRARFYAAEIASAIGYLHSKSIIYRDLKPENILLDSE 291          

HSP 2 Score: 229.565 bits (584), Expect = 7.435e-62
Identity = 102/193 (52.85%), Postives = 137/193 (70.98%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GH+ LTDFGLCKEG+  + TTSTFCGTPEYLAPEV++KEPYD +VDWW  GSV+YEMLFGLPPFYS++  +MY  IL+ PL L+ +  S   D+L KL++K+ + RLG   D  E++ HPFF+ IDW  L  ++++PPF P++ S      ID EF +EP+  S+  S    +   SV++ D+ F+GFSYVPP
Sbjct:  292 GHVRLTDFGLCKEGLNTKSTTSTFCGTPEYLAPEVLRKEPYDMAVDWWCLGSVLYEMLFGLPPFYSREKSEMYSNILHKPLQLKPSASSASQDVLNKLLQKSRQNRLGSNGDIQEVRKHPFFATIDWQLLEQRKIEPPFKPKLMSPLSTEYIDSEFTREPVPQSVGRSI---KISASVQEADNDFMGFSYVPP 481          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A1B6MNK0 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.5156 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.201e-96
Identity = 159/281 (56.58%), Postives = 204/281 (72.60%), Query Frame = 3
Query:  876 NMNARVADQET--IDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGT-FDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDA 1709
            ++ A V   ET  ++KK+ VYK+ V    + WFV RRY+EF  L D LKK   NL LKLPGK+LFG   DP+F+ QR+EGLN FV +L+  P +  ++EVR F  +D  +    EE S E+  E    ++N+NLG SE   AKP DF+F+  IGKGSFGKV LAR + D   +AVKVL K  I ++NE +HIMSERN+L++NL HPFL  L+FSFQT+ KL+F LDYVNGGELFFHLQ+ER+F++ RA+FYAAEI S+LGYLHS+ IIYRDLKPEN+LLD+
Sbjct:   14 DIEASVQKTETWQLNKKFTVYKVVVVSPTECWFVFRRYNEFYKLHDILKKQVSNLQLKLPGKKLFGNNLDPQFVAQRREGLNAFVQQLMQDPKLLNIEEVRTFLQLD-GHCQTTEEPSTEDTCEKAEEDENLNLGPSERTYAKPGDFEFLHVIGKGSFGKVLLARHRHDNVYYAVKVLSKRLIVRQNEAQHIMSERNVLMKNLHHPFLVGLHFSFQTRDKLFFVLDYVNGGELFFHLQRERTFTEPRARFYAAEIASALGYLHSQGIIYRDLKPENLLLDS 293          

HSP 2 Score: 129.413 bits (324), Expect = 1.565e-28
Identity = 52/75 (69.33%), Postives = 65/75 (86.67%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQR 2156
            GH++LTDFGL KEG+    TT+TFCGTPEYLAPEV++KE YDRSVDWW  G+V+YEML+GLPPFYS++T +MY +
Sbjct:  295 GHVVLTDFGLSKEGLLATDTTNTFCGTPEYLAPEVVRKEAYDRSVDWWCLGAVLYEMLYGLPPFYSRNTAEMYAQ 369          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: O73927 (Non-specific serine/threonine protein kinase OS=Squalus acanthias OX=7797 PE=2 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.554e-95
Identity = 197/493 (39.96%), Postives = 268/493 (54.36%), Query Frame = 3
Query: 1041 KLPGKRLFGT-FDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTPISRLMK*FRSRKVVRKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            K P  +LF +  +P F+KQ++ GLN+ + KL  S   +  K   +   +   +    E           P    INLG S N  AKP+DF+ +K IGKGSFGKV LA+ K+D   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L            +  +    +L+F                       L Y++   + Y  L+ E   L+ +              RFY     I+  +    S K+V    +R  + E I                   L+   GHI+LTDFGLCKE IE  GTT TFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +   D+L  L++K+  +RLG K DF +IK H FFS I+WV L  K++ PPF P VS  AD+++ DPEF +EP+  SI  S  N     SV+   D+F+GFSY PP+D
Sbjct:  173 KHPSAKLFTSNCNPAFMKQKRMGLNDLIQKLAASQS-YACKHSSEVPAMLHISPTETEMNGTGASPPPSPTTAQINLGPSSNPQAKPSDFNLLKVIGKGSFGKVLLAKHKADDQFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGL------------YYSFQTADKLYF----------------------VLDYINGGELFYH-LQRERCFLEPRA-------------RFYAA--EIASALGYLHSLKIV----YRDLKPENI-------------------LLDRQGHIVLTDFGLCKENIEPNGTTCTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLLLKPNISNSARDLLEGLLQKDRTKRLGAKEDFMDIKAHIFFSSINWVDLNAKKLTPPFNPNVSGPADLQHFDPEFTEEPVPNSIGRSPDNALITASVKAASDAFLGFSYAPPMD 591          
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Match: A0A267EWI9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030186g1 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 5.459e-94
Identity = 159/291 (54.64%), Postives = 194/291 (66.67%), Query Frame = 3
Query:  867 TEHNMNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNY------DHEEEVSQENVDE---------------NYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYR 1676
             E    A++ + ++  KK  VYKI V    +SWF+LRRY EF  L D LKK  P   LKLPGKR FG  DP+FI+QR+EGL+  V  L+  P I EL EV  F G D          D +++ +    DE                   E+ ++LG  EN+ A P+DF F+K IGKGSFGKVFLA+RKSDG +FAVKVL KE IKKRNEVKHIMSERN+LV+N+ HPFLC L+ SF+T  KLYF LDYVNGGELFFHLQ++R F + RA+FYAAEI S++GYLHSKNIIYR
Sbjct:    5 AEKESAAQIVEADST-KKATVYKICVTSGGQSWFILRRYKEFNNLYDRLKKQFPEAGLKLPGKRFFGNMDPEFIRQRQEGLDNMVQVLMTHPKISELPEVIQFLGFDINKSRLELTDDAKKDTASSGSDEPPIAAAAAAEGGTGSGAKEEEALDLGAKENRKATPSDFTFLKVIGKGSFGKVFLAKRKSDGGIFAVKVLQKEQIKKRNEVKHIMSERNVLVRNIEHPFLCALHMSFRTPDKLYFVLDYVNGGELFFHLQRDRCFPEPRARFYAAEIASAIGYLHSKNIIYR 294          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: sgk3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:103040639])

HSP 1 Score: 315.849 bits (808), Expect = 8.812e-97
Identity = 158/281 (56.23%), Postives = 202/281 (71.89%), Query Frame = 3
Query:  897 DQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q    K+Y VYK+ V      WFV RRY EF  L + LKK  P LNLK+P KR+FG  FDP+FIKQR+ GL+EF+ K++  P +    +VRDF  +++  Y  +   + E+ +EN P   NINLG S N  AKP DFDF+K IGKGSFGKV LA+RK DG  +A+KVL K+ I  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQKER+F + RA+FY AE+ S+LGYLHS NI+YRDLKPENILLD Q  I++  +
Sbjct:   17 EQRDKKKRYTVYKVMVSVGRHEWFVFRRYTEFDKLYNTLKKQYPALNLKIPAKRIFGDNFDPEFIKQRRTGLHEFIQKIVSHPQLSNHPDVRDFLQMNKSKYFSD---ASEDEEENSPTSGNINLGPSANPHAKPTDFDFLKVIGKGSFGKVLLAKRKRDGKCYAIKVLQKKVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFFHLQKERTFPESRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDFQGHIVLTDF 294          

HSP 2 Score: 248.054 bits (632), Expect = 5.717e-72
Identity = 111/202 (54.95%), Postives = 145/202 (71.78%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDEN 2522
            L+ F GHI+LTDFGLCKEGI +  TT+TFCGTPEYLAPEV++K+PYD +VDWW  GSV+YEML+GLPPFYS+DTH+MY+ IL+  LP+R    +    IL  L+ K+   RLGY++DF+E+K H FFS I+W  L  K++ PPF P V S  DI N DPEF +E +  S+  S  +     SV + DD+F+GFSY PP D++
Sbjct:  282 LLDFQGHIVLTDFGLCKEGISQADTTTTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMYENILHKELPMRPGASTTAWSILQGLLEKDNTRRLGYRDDFNEVKSHDFFSSINWDDLEQKKIPPPFNPSVDSQYDISNFDPEFTEETVPNSVCISTEHSIVNASVMEADDAFLGFSYAPPSDDS 483          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: sgk3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:103040639])

HSP 1 Score: 258.455 bits (659), Expect = 1.443e-76
Identity = 132/242 (54.55%), Postives = 172/242 (71.07%), Query Frame = 3
Query: 1032 LNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNY------DHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            LNLK+P KR+FG  FDP+FIKQR+ GL+EF+ K++  P +    +VRDF  +++  Y      D EE+V +              +G+     AKP DFDF+K IGKGSFGKV LA+RK DG  +A+KVL K+ I  R E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQKER+F + RA+FY AE+ S+LGYLHS NI+YRDLKPENILLD Q  I++  +
Sbjct:    1 LNLKIPAKRIFGDNFDPEFIKQRRTGLHEFIQKIVSHPQLSNHPDVRDFLQMNKSKYFSDASEDEEEKVCK-------------IIGLILVNSAKPTDFDFLKVIGKGSFGKVLLAKRKRDGKCYAIKVLQKKVILNRREQKHIMAERNVLLKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFFHLQKERTFPESRAKFYIAEMASALGYLHSLNIVYRDLKPENILLDFQGHIVLTDF 229          

HSP 2 Score: 241.506 bits (615), Expect = 2.142e-70
Identity = 110/202 (54.46%), Postives = 144/202 (71.29%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDEN 2522
            L+ F GHI+LTDFGLCKEGI +  TT+TFCGTPEYLAPEV++K+PYD +VDWW  GSV+YEML+GLPPFYS+DTH+MY+ IL+  LP+R    +    IL  L+ K+   RLGY++DF+E+K H FFS I+W  L  K++ PPF P V    DI N DPEF +E +  S+  S  +     SV + DD+F+GFSY PP D++
Sbjct:  217 LLDFQGHIVLTDFGLCKEGISQADTTTTFCGTPEYLAPEVLRKQPYDNTVDWWCLGSVLYEMLYGLPPFYSRDTHEMYENILHKELPMRPGASTTAWSILQGLLEKDNTRRLGYRDDFNEVKSHDFFSSINWDDLEQKKIPPPFNPSV---YDISNFDPEFTEETVPNSVCISTEHSIVNASVMEADDAFLGFSYAPPSDDS 415          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: si:ch211-195b13.1 (serine/threonine-protein kinase Sgk1-like [Source:NCBI gene;Acc:103036792])

HSP 1 Score: 230.72 bits (587), Expect = 1.366e-66
Identity = 105/195 (53.85%), Postives = 141/195 (72.31%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            GHI+LTDFGLCKEG+E  GTT+TFCGTPEYLAPEV++K+ YDR+VDWW  GSV+YEML+GLPPFYS++T +MY  IL+  L L+ N  +   ++L  L++K+  +RLG K+DF E+K H FFS I+W  L+ +++ PPFVP V+   D+R+ DPEF   P+S S+ N+  N     SV +   +F GFSY PP D
Sbjct:  213 GHIVLTDFGLCKEGLEPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAEMYNNILHKSLVLKPNVSNAGRELLEGLLQKDRTKRLGVKDDFLELKYHTFFSPINWDDLMARKISPPFVPSVTGPTDLRHFDPEFTHLPVSTSLFNTD-NLHVTSSVREAAGAFPGFSYGPPAD 406          

HSP 2 Score: 218.779 bits (556), Expect = 2.339e-62
Identity = 118/218 (54.13%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            FIK+RK GLN+F+ KL+ SP I +  +V  F  ID    +  EE+ +E      P        ++E    KP DFD++K IGKGSFGKV LAR K     +AVKVL K+ I K+ E KHIM+ER++L++N++HPFL  L++SFQT  KLYF LDYVNGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS +I+YRDLKPENILLD+Q  I++  +
Sbjct:   11 FIKERKMGLNDFIQKLVSSPHICQHSQVGSFLKIDE---NQNEELGREQFCLTNPRSS-----LAEETQIKPCDFDYLKIIGKGSFGKVLLARHKETEQYYAVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSQGHIVLTDF 220          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: si:ch211-195b13.1 (serine/threonine-protein kinase Sgk1-like [Source:NCBI gene;Acc:103036792])

HSP 1 Score: 231.106 bits (588), Expect = 1.610e-66
Identity = 105/195 (53.85%), Postives = 141/195 (72.31%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            GHI+LTDFGLCKEG+E  GTT+TFCGTPEYLAPEV++K+ YDR+VDWW  GSV+YEML+GLPPFYS++T +MY  IL+  L L+ N  +   ++L  L++K+  +RLG K+DF E+K H FFS I+W  L+ +++ PPFVP V+   D+R+ DPEF   P+S S+ N+  N     SV +   +F GFSY PP D
Sbjct:  229 GHIVLTDFGLCKEGLEPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAEMYNNILHKSLVLKPNVSNAGRELLEGLLQKDRTKRLGVKDDFLELKYHTFFSPINWDDLMARKISPPFVPSVTGPTDLRHFDPEFTHLPVSTSLFNTD-NLHVTSSVREAAGAFPGFSYGPPAD 422          

HSP 2 Score: 219.55 bits (558), Expect = 2.013e-62
Identity = 118/218 (54.13%), Postives = 154/218 (70.64%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            FIK+RK GLN+F+ KL+ SP I +  +V  F  ID    +  EE+ +E      P        ++E    KP DFD++K IGKGSFGKV LAR K     +AVKVL K+ I K+ E KHIM+ER++L++N++HPFL  L++SFQT  KLYF LDYVNGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS +I+YRDLKPENILLD+Q  I++  +
Sbjct:   27 FIKERKMGLNDFIQKLVSSPHICQHSQVGSFLKIDE---NQNEELGREQFCLTNPRSS-----LAEETQIKPCDFDYLKIIGKGSFGKVLLARHKETEQYYAVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSQGHIVLTDF 236          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Match: si:ch211-195b13.1 (serine/threonine-protein kinase Sgk1-like [Source:NCBI gene;Acc:103036792])

HSP 1 Score: 225.713 bits (574), Expect = 6.202e-65
Identity = 105/195 (53.85%), Postives = 141/195 (72.31%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            GHI+LTDFGLCKEG+E  GTT+TFCGTPEYLAPEV++K+ YDR+VDWW  GSV+YEML+GLPPFYS++T +MY  IL+  L L+ N  +   ++L  L++K+  +RLG K+DF E+K H FFS I+W  L+ +++ PPFVP V+   D+R+ DPEF   P+S S+ N+  N     SV +   +F GFSY PP D
Sbjct:  205 GHIVLTDFGLCKEGLEPNGTTTTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAEMYNNILHKSLVLKPNVSNAGRELLEGLLQKDRTKRLGVKDDFLELKYHTFFSPINWDDLMARKISPPFVPSVTGPTDLRHFDPEFTHLPVSTSLFNTD-NLHVTSSVREAAGAFPGFSYGPPAD 398          

HSP 2 Score: 189.889 bits (481), Expect = 2.694e-52
Identity = 107/218 (49.08%), Postives = 140/218 (64.22%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            FIK+RK GLN+F+ KL      ++L     +  +  +                                 KP DFD++K IGKGSFGKV LAR K     +AVKVL K+ I K+ E KHIM+ER++L++N++HPFL  L++SFQT  KLYF LDYVNGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS +I+YRDLKPENILLD+Q  I++  +
Sbjct:   27 FIKERKMGLNDFIQKLYIYVISFQLAYRLYYICLSNR--------------------------------IKPCDFDYLKIIGKGSFGKVLLARHKETEQYYAVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEIASALGYLHSLHIVYRDLKPENILLDSQGHIVLTDF 212          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005485.1 (pep scaffold:Pmarinus_7.0:GL480333:786:25860:1 gene:ENSPMAG00000004915.1 transcript:ENSPMAT00000005485.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.174 bits (705), Expect = 8.887e-86
Identity = 136/244 (55.74%), Postives = 178/244 (72.95%), Query Frame = 3
Query: 1011 LKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHE-DNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            LKK  P LN+KLP K +FG T D  FIKQR+ GLN F+ +++  P + +  +V+ F  +D +     +  +Q N + N  ++ D INLG S N  AK  DFDF+K IGKGSFGKV LA+ K+DG  +AVKVL K  I KR E KHIM+ERN+L++N++HPFL  L+FSFQT  KLYF LDYVNGGELF HLQ+ER FS++RA+FYAAEI S++G+LHS NI+YRDLKPENILLD++  I++  +
Sbjct:    1 LKKQFPELNVKLPSKSIFGNTLDGVFIKQRRNGLNSFIQRVVSDPHVCQHPDVQAFLQMDHRGKKRSQPAAQTNSNHNLNNDSDTINLGPSANPQAKTTDFDFLKVIGKGSFGKVLLAKHKTDGKFYAVKVLQKSAILKRREQKHIMAERNVLLKNVKHPFLVGLHFSFQTADKLYFILDYVNGGELFLHLQRERCFSEQRARFYAAEIASAIGHLHSLNIVYRDLKPENILLDSKGHIVLTDF 244          

HSP 2 Score: 61.6178 bits (148), Expect = 1.588e-10
Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPE 2018
            GHI+LTDFGLCKEGIE + TTSTFCGTPE
Sbjct:  237 GHIVLTDFGLCKEGIEPKDTTSTFCGTPE 265          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 247.669 bits (631), Expect = 3.382e-73
Identity = 124/227 (54.63%), Postives = 162/227 (71.37%), Query Frame = 3
Query: 1056 RLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            R   T    F+K RK GLN+F  K++ +P + +  +VR F  +D  N  ++ +   EN        D+INLG S N  AKP+DFDF+  +GKGSFGKV LA+ KSDG  +AVKV+ K  I ++ E KHIM+ERN+LV+N+RHPFL  L++SFQ+  KLYF +DYVNGGELFFHLQ++ SF + RAQFYAAEIGS++GYLHS NI+YRDLKPENILLD Q  I++  +
Sbjct:   17 RAVATVLVAFLKHRKTGLNDFTQKVVSNPGMCQNPDVRKFLQLD--NPRNQTQGPMEN------DADHINLGPSANLQAKPSDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDF 235          

HSP 2 Score: 227.254 bits (578), Expect = 6.839e-66
Identity = 103/201 (51.24%), Postives = 137/201 (68.16%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            L+ + GHI+LTDFGLCKEGI+   TT TFCGTPEYLAPEV+KK PYDR+VDWW  G V+YEML+GLPPFYS++  QMY+ IL+ PL LR    +    +L  L+ K+P +RLG  +D  EIK H FFS I+W  L  K++  P+ P VS   D+ N DP F  EP+S S+  S        +V++  D+FVGF+Y+P +++
Sbjct:  223 LLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLGATSDILEIKNHVFFSTINWNDLDAKRIPSPYNPGVSGPCDLHNFDPAFTAEPLSMSMAQSSDTSSVCANVDEAADAFVGFTYMPGLED 423          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003714.1 (pep scaffold:Pmarinus_7.0:GL480823:68:8916:1 gene:ENSPMAG00000003396.1 transcript:ENSPMAT00000003714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 1.673e-41
Identity = 69/138 (50.00%), Postives = 101/138 (73.19%), Query Frame = 3
Query: 1299 ADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ 1712
            ADF F+K +GKGSFGKV LA  +    VFAVKVL K++I + ++V+  M+E+ +L     HP+L +L+  FQT+ +L+F ++YVNGG+L F +Q+ R F + R++FYAAE+ S+L +LH   +IYRDLK +NILLDA+
Sbjct:    4 ADFSFMKVLGKGSFGKVMLAELRGSEEVFAVKVLKKDSIVQDDDVECTMTEKRVLALAKNHPYLTQLFCCFQTRDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHRHGVIYRDLKLDNILLDAE 141          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 3.076e-41
Identity = 75/168 (44.64%), Postives = 105/168 (62.50%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYK-NDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPN 2432
            GHI + DFGLCKEGI    T  TFCGTPEYLAPEV++   Y R+VDWW  G V+YEM+ G  PFY+QD  ++++ IL   +       +    +L  L++K+PK+RLG   +D  EI  H FF+ I W  + ++++ PPF PQV+S  D R  D EF  + I+ + P+
Sbjct:  286 GHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASETDTRYFDEEFTAQTITITPPD 453          

HSP 2 Score: 155.992 bits (393), Expect = 9.611e-41
Identity = 80/169 (47.34%), Postives = 113/169 (66.86%), Query Frame = 3
Query: 1251 EDNINLGVSENKLAKPA------DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHS-KNIIYRDLKPENILLDAQVSIMVKTY 1736
            ED  +    +  L+KP       +FD++K +GKG+FGKV L R K+ G  +A+K+L KE I  ++EV H ++E  +L Q  +HPFL  L +SFQT  +L F ++YVNGGELFFHL +ER FS+ R +FY AEI S+L YLH+ KN++YRDLK EN++LD    I +  +
Sbjct:  126 EDGSSTEQMDTILSKPKSKVTMNNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVL-QTTKHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADF 293          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Match: sgk1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:324140])

HSP 1 Score: 147.902 bits (372), Expect = 4.280e-39
Identity = 78/149 (52.35%), Postives = 100/149 (67.11%), Query Frame = 3
Query: 1290 AKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            AKP DFDF+K IGKGSFGKV LA+ K+D   +AVKVL K+ I K+ E KHIM+ERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGE+             + + Y  E    L  LH  N I RDLKPENILLD +  I++  +
Sbjct:    4 AKPTDFDFLKIIGKGSFGKVLLAKLKTDEKFYAVKVLQKKAILKKKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTADKLYFVLDYINGGEVRTSTCAPCIVVHHKWKGYREEPIDELNSLHFVNQISRDLKPENILLDFEGHIILTDF 152          

HSP 2 Score: 141.739 bits (356), Expect = 4.898e-37
Identity = 86/212 (40.57%), Postives = 115/212 (54.25%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPE---YLAPEVIKKEPYDRSVDW-----WSFGSV------IYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            L+ F GHIILTDFGLCKEGI+   TTSTFCGTPE       + I+ +   R+  W     W  G V      + E+ F   P +SQ + +    I NS             D+L  L+ K+  +RLG   DF EIK H FFS I+W  L++K++ PPF P V+  +D+R+ DPEF  EP+ GS+  S        S ++  D+F GFSY PP
Sbjct:  140 LLDFEGHIILTDFGLCKEGIQPNDTTSTFCGTPEESDLTNRKEIRSQRSSRTRGWDLRCAWRAGQVTTHRPSVSEVSFV--PSFSQ-SRRFKPNISNS-----------ARDLLEGLLHKDRTQRLGASGDFTEIKGHVFFSPINWEDLLSKKIVPPFNPNVNGPSDLRHFDPEFISEPVPGSVCRSPGEFAVSASFQEARDAFAGFSYAPP 337          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: FPK1 (Ser/Thr protein kinase; phosphorylates several aminophospholipid translocase family members, regulating phospholipid translocation and membrane asymmetry; phosphorylates and inhibits upstream inhibitory kinase, Ypk1p; localizes to the cytoplasm, early endosome/TGN compartments and thplasma membrane; localizes to the shmoo tip where it has a redundant role in the cellular response to mating pheromone; FPK1 has a paralog, KIN82, that arose from the whole genome duplication [Source:SGD;Acc:S000005330])

HSP 1 Score: 209.92 bits (533), Expect = 1.202e-56
Identity = 124/366 (33.88%), Postives = 189/366 (51.64%), Query Frame = 3
Query: 1287 LAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQ--KERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTPISRLMK*FRSRKVVRKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPL--PLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNA 2372
            +  P  F+ I+ +G+G  GKVFL R K    V+A+KVL K+ + KRN++K +++E+ IL  +  HPF+  LY SFQ++  LY  ++Y  GGE F  LQ  K +   +  A+FYA+E+ ++L YLH    IYRDLKPENILL     IM+  +  D+ ++                            A+D  +  +  S                      L D  +C +G      T++F GT EY+APEVI+   +  +VDWW+ G +IYEMLFG  PF   +T++ +  IL + +  P          D++ KL+ KN  +RLG K    ++K HPFF ++ W  L N++  PP +P +S + 
Sbjct:  490 MVGPQSFEKIRLLGQGDVGKVFLVREKKTNRVYALKVLSKDEMIKRNKIKRVLTEQEILATS-NHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDF--DLSIQ----------------------------AKDSKVPVVKGS------------------AQSTLVDTKICSDGFR----TNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFPNNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFFKKVQWSLLRNQE--PPLIPVLSEDG 800          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 172.17 bits (435), Expect = 4.411e-45
Identity = 86/196 (43.88%), Postives = 120/196 (61.22%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYV 2504
            L+ + GHI L DFGLCK  ++ +  T TFCGTPEYLAPE++    Y ++VDWW+ G ++YEML GLPP+Y +D  +MY++IL  PL           D+L+ L+ ++P  RLGY N  DEI+ HPFFSQ+ W  L+ K   PP+ P VS++ D  N D EF +E    S+ +  L+       E V   F G++YV
Sbjct:  477 LLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRLGY-NGADEIRNHPFFSQLSWKRLLMKGYIPPYKPAVSNSMDTSNFDEEFTREKPIDSVVDEYLS-------ESVQKQFGGWTYV 664          

HSP 2 Score: 150.214 bits (378), Expect = 7.007e-38
Identity = 76/151 (50.33%), Postives = 100/151 (66.23%), Query Frame = 3
Query: 1275 SENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMV 1727
            S NK     DFD +K IGKGSFGKV   R+K    V+A+K + K  I  ++EV H ++ER +L + +  PF+  L FSFQ+  KLYF L ++NGGELF+HLQKE  F   RA+FY AE+  +L  LH  +++YRDLKPENILLD Q  I +
Sbjct:  337 SRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLAR-VDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIAL 486          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 160.229 bits (404), Expect = 3.238e-41
Identity = 83/205 (40.49%), Postives = 117/205 (57.07%), Query Frame = 3
Query: 1917 LITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENMAN 2531
            L+ + GHI L DFGLCK  ++    T TFCGTPEYLAPE++  + Y ++VDWW+ G ++YEM+ GLPP+Y ++   MY++IL  PL           D+L+ L+ ++P  RLG  N  DEI+ HPFF  I W  L+ K   PP+ P V S  D  N D EF KE    S+ +  L+   Q         F G++Y+   DE + +
Sbjct:  474 LLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRLGV-NGTDEIRNHPFFKDISWKKLLLKGYIPPYKPIVKSEIDTANFDQEFTKEKPIDSVVDEYLSASIQ-------KQFGGWTYIG--DEQLGD 668          

HSP 2 Score: 145.206 bits (365), Expect = 2.541e-36
Identity = 75/151 (49.67%), Postives = 99/151 (65.56%), Query Frame = 3
Query: 1275 SENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMV 1727
            S+NK     DFD +K IGKGSFGKV   R+K    ++A+K L K  I  + EV H ++ER +L + +  PF+  L FSFQ+  KLY  L ++NGGELF+HLQ E  FS  R++FY AE+  +L  LH  ++IYRDLKPENILLD Q  I +
Sbjct:  334 SKNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLAR-VDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIAL 483          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 152.91 bits (385), Expect = 2.178e-38
Identity = 74/146 (50.68%), Postives = 103/146 (70.55%), Query Frame = 3
Query: 1296 PADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLR--HPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMV 1727
            P DF+ ++ +GKG+FG+V+  ++K    ++A+KVL K+ I K+NE+ H + ERNILV       PF+  L FSFQT   LY   DY++GGELF+HLQKE  FS+ RA+FY AE+  +L +LH  +I+YRDLKPENILLDA  +I +
Sbjct:  409 PQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLSKKVIVKKNEIAHTIGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIAL 554          

HSP 2 Score: 140.198 bits (352), Expect = 2.281e-34
Identity = 82/204 (40.20%), Postives = 116/204 (56.86%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEP-YDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVK-LIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYV--PPIDENMAN 2531
            G+I L DFGL K  ++    T+TFCGT EYLAPE++  E  Y + VD+WS G +I+EM  G  PF++++  +MYQ+I    +    +  S      VK L+ +NPK RLG  +D  E++ HPFF+ IDW AL  K++ PPF P + S  D  N DPEF     S    +  +   T LS   +   F GF++V    IDE++ N
Sbjct:  550 GNIALCDFGLSKADLKDR--TNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIAFGKVKFPRDVLSQEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFADIDWEALKQKKIPPPFKPHLVSETDTSNFDPEFTTASTSYMNKHQPMMTATPLSPA-MQAKFAGFTFVDESAIDEHVNN 750          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 137.117 bits (344), Expect = 2.175e-35
Identity = 66/135 (48.89%), Postives = 93/135 (68.89%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLD 1706
            DF  ++T+G GSFG+V L R   +G  +A+KVL K+ + K  +V+H   ER +L + + HPFL R++ +FQ  R ++  +DY+ GGELF  L+K + F    A+FYAAE+  +L YLH+ NIIYRDLKPENILLD
Sbjct:   69 DFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRML-KLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLD 202          

HSP 2 Score: 124.79 bits (312), Expect = 3.340e-31
Identity = 61/147 (41.50%), Postives = 89/147 (60.54%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLG-YKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSN 2369
            GHI +TDFG  KE    +  T T CGTP+Y+APEVI  +PY++SVDWWS G +IYEML G  PFY     + Y++IL   +         + D+L KLI  +   R+G  ++   +IK HP+FS++ W  L+ K ++ P+ P ++S 
Sbjct:  205 GHIKITDFGFAKE---VQTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITSG 348          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 245.358 bits (625), Expect = 2.633e-72
Identity = 123/222 (55.41%), Postives = 160/222 (72.07%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDR----QNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
             IK R+EGLN+F+ K+L  P   +  +VR+F  +D     Q  D +E+   ++ D      + I+LG S N  AKP+DF F+K IGKGSFGKVFL++ K +   +A+KVL K  I+KRNE KHIM+ERN+LVQN+ HPFL  L++SFQTK KLYF LDYVNGGELFFHLQ+ER F + RA+FYAAEI S++GYLH   IIYRDLKPENILLD++  I++  +
Sbjct:    1 MIKMRREGLNDFIVKILTHPGALDHPDVREFLSLDNPKNAQANDEDEQPGSDDADV-----EKIDLGESNNPKAKPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDF 217          

HSP 2 Score: 243.047 bits (619), Expect = 1.963e-71
Identity = 108/199 (54.27%), Postives = 146/199 (73.37%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGY-KNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENM 2525
            GHI+LTDFGLCKEGI+R GTTSTFCGTPEYLAPEV++K+ YD+SVDWW  G+V+YEM++GLPPFYS+DT +MY  IL+ PL LR N       IL  L++K+  +RLG  + DF++I+ H FF  I+W  LV + ++PP+ P VS   D+++ DPEF +EP+ GS+  S  +     SV+D DD+FVGF+YV P D+ +
Sbjct:  210 GHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNPNVSGQLDLKHFDPEFVREPVPGSVGKSADSNFVSASVDDPDDAFVGFTYVAPSDDTL 408          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO41166 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S521])

HSP 1 Score: 184.496 bits (467), Expect = 1.038e-50
Identity = 126/410 (30.73%), Postives = 195/410 (47.56%), Query Frame = 3
Query: 1296 PADFDFIKTIGKGSFGKVFLARRK---SDGAVFAVKVLYKENI-KKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTPISRLMK*FRSRKVVRKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERL-GYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            P  F+ +K +GKG +GKVFL ++    S   +FA+KVL K  I + + +  H  +ERNIL + ++HPF+  L ++FQT            GG+L+  L+                      YL S   ++  L+ E I L+                   F  + IS  ++    + +V    +R  + E I                   L+   GH+ LTDFGLCKE I     T TFCGT EY+APE++ +  + ++VDWWS G+++Y+ML G PPF + +  +   +IL   L +         D + KL++++P+ RL G   D + IK H FF  I W  L+ K+V+PPF P +S   D+   D +F ++    S  +S L+       E   + F GF+YV P
Sbjct:   62 PESFELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKAAIIRSQKDTAHTKAERNIL-ECVKHPFIVDLIYAFQT------------GGKLYLILE----------------------YL-SGGELFMQLEREGIFLEDTAC---------------FYLSEISMALEHLHKQGIV----YRDLKPENI-------------------LLDANGHVKLTDFGLCKESIFENSLTHTFCGTIEYMAPEILTRSGHGKAVDWWSLGALMYDMLTGTPPFCADNRKKTIDKILKGKLIIPPYLTPEAKDFIRKLLKRHPQARLGGMAGDANPIKAHSFFRHICWEDLLAKKVEPPFRPSISGEEDVSQFDSKFTRQTPVDSPDDSMLS-------ESASNIFQGFTYVAP 390          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 150.599 bits (379), Expect = 1.625e-37
Identity = 70/136 (51.47%), Postives = 98/136 (72.06%), Query Frame = 3
Query: 1302 DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDA 1709
            DF FIK +GKGSFGKV LA RK    V+A+K+L KE++ + ++V+  M ER +L  +  HPFL  L+ SFQT  +L+F ++YVNGG+L F +QK R F + R++FYAAE+  +L +LH   +IYRDLK +N+LLDA
Sbjct:  382 DFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDA 517          

HSP 2 Score: 136.732 bits (343), Expect = 4.659e-33
Identity = 76/200 (38.00%), Postives = 115/200 (57.50%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNS----PLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDE--IKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDD-SFVGFSYVPP 2510
            GHI L DFG+CKE +    TT+TFCGTP+Y+APE+++++PY  SVDWW+ G ++YEM+ G PPF +++   +++ IL+     P+ L     S    IL   + KN  +RLG      E  I+ H FF  I++  L  +Q+ PPF P++ S  D+ N D +F KE         +L    +  + ++D   F GFS+V P
Sbjct:  519 GHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVS----ILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRTDVGNFDTDFTKE-------EPKLTPTDRNVIVNIDQREFRGFSFVNP 707          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 139.043 bits (349), Expect = 2.921e-35
Identity = 65/148 (43.92%), Postives = 100/148 (67.57%), Query Frame = 3
Query: 1293 KPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +P DF F+K +GKGSFGKV LA RK    V+A+KVL K+ I + ++V+  M+E+ +L    + PFL +L+  F +  +LYF +++VNGG+L FH+Q+   F + +A FYAAEI   L +LH + I+YRDLK +N++LD+   I +  +
Sbjct:  212 RPEDFHFLKVLGKGSFGKVMLAERKGTDQVYAIKVLKKDVIVQDDDVECTMTEKRVLAVPGKPPFLTQLFCCFHSVDRLYFVMEFVNGGDLMFHIQQAGRFKEPQAVFYAAEIVIGLVFLHKRGIVYRDLKLDNVMLDSDGHIKIADF 359          

HSP 2 Score: 88.5817 bits (218), Expect = 2.035e-18
Identity = 35/60 (58.33%), Postives = 45/60 (75.00%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFG 2111
            GHI + DFG+CKE +    TT TFCGTP+Y+APE++  +PY  SVDWW+ G +IYEML G
Sbjct:  352 GHIKIADFGMCKESMFNNQTTRTFCGTPDYIAPEIVAYQPYGFSVDWWALGVLIYEMLAG 411          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 141.739 bits (356), Expect = 3.663e-35
Identity = 79/206 (38.35%), Postives = 113/206 (54.85%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFY--------SQDTHQ-MYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGY--KNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDS-FVGFSYVPPI 2513
            GHI LTD+G+CKEGI     TSTFCGTP Y+APE+++ E Y  SVDWW+ G ++YEML G  PF          Q+T   ++Q IL  P+ +  +     + IL   + KNP ERLG   +  F +I  H FF  + W  L  +QV PPF P+      + N DP+F  E +  +  + ++       +E +D + F GF Y+ P+
Sbjct:  358 GHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQEDPYGLENFDPQFTNEDVQFTPDDPKM-------LETIDQTEFEGFEYINPL 556          

HSP 2 Score: 134.42 bits (337), Expect = 7.999e-33
Identity = 64/172 (37.21%), Postives = 102/172 (59.30%), Query Frame = 3
Query: 1269 GVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY--------PGDMILRF 1760
            G     L    DF+ I+ IG+GS+ KV L   K    ++A+KV+ KE +    ++  + +E+++  Q   HPFL  L+  FQT  +L+F ++YV+GG+L +H+Q++R   +  A+FY+AEI  +L +LH K +IYRDLK +N+LLD+   I +  Y        PGD+   F
Sbjct:  210 GSGAGALISVNDFNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTF 381          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: sgk3 (serum/glucocorticoid regulated kinase family member 3 [Source:NCBI gene;Acc:101156366])

HSP 1 Score: 306.22 bits (783), Expect = 3.409e-93
Identity = 152/281 (54.09%), Postives = 202/281 (71.89%), Query Frame = 3
Query:  897 DQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFG-TFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            +Q    K+Y VYK+ V      WFV RRY EF  L + L+K  P++NLK+P KR+FG  FDP+FI+QR+ GL+EF+ +L+  P +    +V+ F  +D++   H  + S++  D+N     +INLG S N  AKP DFDF+K IGKGSFGKVFLA+RK DG  +A+KVL K+ I  R E KHIM+ERN+LV+N++HPFL  L++SFQT  KLYF LD+VNGGELFFHLQKER+F + RA+FY AE+ S+LGYLHS  I+YRDLKPENILLD +  I++  +
Sbjct:   23 EQRDKKKRYTVYKVLVSVGQHEWFVFRRYAEFDKLYNTLRKQFPSMNLKIPAKRIFGDNFDPEFIQQRRAGLHEFIKRLVSHPQLCNHPDVKSFLQMDKRQ--HLADASEDEDDKNSSTSRDINLGPSGNPQAKPTDFDFLKVIGKGSFGKVFLAKRKHDGKFYAIKVLQKKVILNRKEQKHIMAERNVLVKNVKHPFLVGLHYSFQTTDKLYFVLDFVNGGELFFHLQKERTFPEPRARFYIAEMASALGYLHSLKIVYRDLKPENILLDHEGHIVLTDF 301          

HSP 2 Score: 245.743 bits (626), Expect = 5.446e-71
Identity = 114/197 (57.87%), Postives = 143/197 (72.59%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDEN 2522
            GHI+LTDFGLCKEGI +  TT+TFCGTPEYLAPEV+KK PYD +VDWW  GSV+YEMLFGLPPFYS+DTH+MY  IL+ PL +R    S    +L  L+ K+  +RLG   DF+EIKVH FFS I+W  LV K++ PPF+P V+S  DI N DPEF +E +  SI  +Q +     SV + DD+F+GFSY PP D++
Sbjct:  294 GHIVLTDFGLCKEGISQTDTTTTFCGTPEYLAPEVLKKHPYDNTVDWWCLGSVLYEMLFGLPPFYSRDTHEMYDNILHKPLAMRPGASSTAWSLLQGLLEKDGTQRLGSNGDFNEIKVHNFFSSINWDDLVQKKIPPPFIPNVTSCCDISNFDPEFTEENVPNSICWTQSHSVVNASVMEADDAFLGFSYAPPSDDS 490          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: SGK1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:101173276])

HSP 1 Score: 238.039 bits (606), Expect = 5.378e-69
Identity = 110/196 (56.12%), Postives = 141/196 (71.94%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDE 2519
            GHIILTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +   ++L  L++K+  +RLG  NDF EIK H FFS I+W  L  K++ PPF P V+   D+R+ DPEF  EP+S SI  S  +     S+++  ++FVGFSY P +D 
Sbjct:  234 GHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNISNSARNLLEGLLQKDRTKRLGCTNDFIEIKNHVFFSPINWDELNAKKITPPFNPNVTGPNDLRHFDPEFTDEPVSSSIGCSPDSALFTASIKEAAEAFVGFSYAPSMDS 429          

HSP 2 Score: 234.572 bits (597), Expect = 1.046e-67
Identity = 117/218 (53.67%), Postives = 153/218 (70.18%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            F+KQR+ GLN+F+ +L  +    +  EV+    +       + E+   N          INLG S N  AKP+DF F+K IGKGSFGKV LAR ++D   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:   27 FMKQRRMGLNDFIQRLATNSYACKHPEVQSILNLSPP---QDAELMNVNPSPPSSPSQQINLGPSSNPSAKPSDFHFLKVIGKGSFGKVLLARHRTDDQFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 241          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: SGK1 (serum/glucocorticoid regulated kinase 1 [Source:NCBI gene;Acc:101173276])

HSP 1 Score: 237.269 bits (604), Expect = 2.062e-67
Identity = 110/195 (56.41%), Postives = 141/195 (72.31%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPID 2516
            GHIILTDFGLCKE IE  GTTSTFCGTPEYLAPEV+ K+PYDR+VDWW  G+V+YEML+GLPPFYS++T +MY  ILN PL L+ N  +   ++L  L++K+  +RLG  NDF EIK H FFS I+W  L  K++ PPF P V+   D+R+ DPEF  EP+S SI  S  +     S+++  ++FVGFSY P +D
Sbjct:  357 GHIILTDFGLCKENIEPNGTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNISNSARNLLEGLLQKDRTKRLGCTNDFIEIKNHVFFSPINWDELNAKKITPPFNPNVTGPNDLRHFDPEFTDEPVSSSIGCSPDSALFTASIKEAAEAFVGFSYAPSMD 551          

HSP 2 Score: 235.343 bits (599), Expect = 1.231e-66
Identity = 118/221 (53.39%), Postives = 154/221 (69.68%), Query Frame = 3
Query: 1074 DPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            D  F+KQR+ GLN+F+ +L  +    +  EV+    +       + E+   N          INLG S N  AKP+DF F+K IGKGSFGKV LAR ++D   +AVKVL K+ I K+ E KHIMSERN+L++N++HPFL  L++SFQT  KLYF LDY+NGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS NI+YRDLKPENILLD+Q  I++  +
Sbjct:  147 DNTFMKQRRMGLNDFIQRLATNSYACKHPEVQSILNLSPP---QDAELMNVNPSPPSSPSQQINLGPSSNPSAKPSDFHFLKVIGKGSFGKVLLARHRTDDQFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHYSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIILTDF 364          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: si:ch211-195b13.1 (serine/threonine-protein kinase Sgk1 [Source:NCBI gene;Acc:101162537])

HSP 1 Score: 232.646 bits (592), Expect = 4.363e-67
Identity = 104/193 (53.89%), Postives = 141/193 (73.06%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GHI+LTDFGLCKEG+E +GTTSTFCGTPEYLAPEV++K+ YDR+VDWW  GSV+YEML+GLPPFYS++T +MY  IL+    ++ N  +   ++L  L++K   +RLG K+DF E+K H FFS I+W  L+ K++ PPF+P VS   D+R+ DPEF + P+S S+ N  L   +  SV++   +F GFSY PP
Sbjct:  231 GHIVLTDFGLCKEGLEADGTTSTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAEMYNNILHKAPAMKPNVSNAGRELLEGLLQKERTKRLGAKDDFLELKYHSFFSPINWDDLMAKKITPPFIPSVSGPTDLRHFDPEFTQLPVSSSLCNDTLTVTS--SVKEAAGAFPGFSYGPP 421          

HSP 2 Score: 217.238 bits (552), Expect = 1.117e-61
Identity = 120/222 (54.05%), Postives = 159/222 (71.62%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINL----GVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            FIK+RK GLN+F  KL+ +P I +  EV +F  ID +N + E+E        +   E  + L     ++E    KP+DFD++K IGKGSFGKV LAR K   A +AVKVL K+ I K+ E KHIM+ER++L++N++HPFL  L++SFQT  KLYF LDYVNGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS +I+YRDLKPENILLD+Q  I++  +
Sbjct:   25 FIKERKMGLNDFFQKLVSTPHICQHAEVNNFLKID-ENQNEEDE-------NDLLSESRMCLKSRSSLAEETQIKPSDFDYLKIIGKGSFGKVLLARHKETMAYYAVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEISSALGYLHSLHIVYRDLKPENILLDSQGHIVLTDF 238          
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Match: si:ch211-195b13.1 (serine/threonine-protein kinase Sgk1 [Source:NCBI gene;Acc:101162537])

HSP 1 Score: 231.876 bits (590), Expect = 5.258e-67
Identity = 104/193 (53.89%), Postives = 141/193 (73.06%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPP 2510
            GHI+LTDFGLCKEG+E +GTTSTFCGTPEYLAPEV++K+ YDR+VDWW  GSV+YEML+GLPPFYS++T +MY  IL+    ++ N  +   ++L  L++K   +RLG K+DF E+K H FFS I+W  L+ K++ PPF+P VS   D+R+ DPEF + P+S S+ N  L   +  SV++   +F GFSY PP
Sbjct:  217 GHIVLTDFGLCKEGLEADGTTSTFCGTPEYLAPEVLQKQAYDRTVDWWCLGSVLYEMLYGLPPFYSRNTAEMYNNILHKAPAMKPNVSNAGRELLEGLLQKERTKRLGAKDDFLELKYHSFFSPINWDDLMAKKITPPFIPSVSGPTDLRHFDPEFTQLPVSSSLCNDTLTVTS--SVKEAAGAFPGFSYGPP 407          

HSP 2 Score: 216.468 bits (550), Expect = 1.604e-61
Identity = 120/222 (54.05%), Postives = 159/222 (71.62%), Query Frame = 3
Query: 1083 FIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINL----GVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            FIK+RK GLN+F  KL+ +P I +  EV +F  ID +N + E+E        +   E  + L     ++E    KP+DFD++K IGKGSFGKV LAR K   A +AVKVL K+ I K+ E KHIM+ER++L++N++HPFL  L++SFQT  KLYF LDYVNGGELF+HLQ+ER F + RA+FYAAEI S+LGYLHS +I+YRDLKPENILLD+Q  I++  +
Sbjct:   11 FIKERKMGLNDFFQKLVSTPHICQHAEVNNFLKID-ENQNEEDE-------NDLLSESRMCLKSRSSLAEETQIKPSDFDYLKIIGKGSFGKVLLARHKETMAYYAVKVLQKKIILKKKEQKHIMAERSVLMKNIKHPFLVGLHYSFQTTDKLYFVLDYVNGGELFYHLQRERVFLEPRARFYAAEISSALGYLHSLHIVYRDLKPENILLDSQGHIVLTDF 224          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000022857.1 (SMESG000022857.1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 279/286 (97.55%), Postives = 282/286 (98.60%), Query Frame = 3
Query:  879 MNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTY 1736
            MNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQ  I++  +
Sbjct:    1 MNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAPNLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFFGIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQGHIILTDF 286          

HSP 2 Score: 430.639 bits (1106), Expect = 1.563e-140
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENMAN 2531
            GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENMAN
Sbjct:  279 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENMAN 478          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000050951.1 (SMESG000050951.1)

HSP 1 Score: 173.711 bits (439), Expect = 5.412e-47
Identity = 115/382 (30.10%), Postives = 184/382 (48.17%), Query Frame = 3
Query: 1287 LAKPADFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTPISRLMK*FRSRKVVRKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLG-YKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIP 2429
            L    +F+ IKT+G GSFG V L + K      ++KVL K+ + +  ++ H +SE+ IL   + HPF+ +L +SF+    LY  ++YV+GGE+F HL+    + +    F+             K I  R           Q+ +  K      +   YF    I      F + +VV   ++    +           +A+R       LI   G+I +TDFG  K   +R   T T CGTPEYLAPE++  + Y  ++DWW+ G +IYEM  G PPFY  D  ++Y++IL     ++ +    +  I+  L+ K+   RLG  K+   ++K H +F   +W+ + NK+   P++P +   +D RN D     E  S  IP
Sbjct:   38 LCSINNFERIKTLGTGSFGMVLLVKDKKTSEYLSIKVLSKKRVHRMKQIDHTISEKKIL-SCVEHPFIVKLLYSFKDNYNLYMVMEYVSGGEMFSHLRNSIKYEKFPPTFF------------HKLIFKRKF---------QLDVFRKFTKSSEMEVIYFGIGQIVEKQTRFYAGQVVLAFEYLHYLN-----------IAYRDLKPENILIDRTGYIKITDFGFAKRIQKR---TYTLCGTPEYLAPEILLNKGYSMAIDWWALGVLIYEMTCGYPPFYDTDPLKIYEKILKGKYKIQKSFSETLFSIISGLLEKDLTHRLGNLKDGSKDLKNHKWFESFEWIRVFNKREPAPYIPLILDESDARNFDDFEETEIGSCDIP 383          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024241.1 (SMESG000024241.1)

HSP 1 Score: 160.614 bits (405), Expect = 4.548e-41
Identity = 81/177 (45.76%), Postives = 109/177 (61.58%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYK-NDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQL 2459
            GHI LTDFGLCKE +     T TFCGTPEYLAPEV+    Y RSVDWW  G V+YEM+ G  PFY+ D   +++ IL   + L  +      D+L +L+ KNP ER+G    D  EI +HPFF  IDW  L+ K++ PP+VP V  + D + I  EF +EP++ + P +  N  +Q+
Sbjct:  376 GHIKLTDFGLCKEEMYYGAFTKTFCGTPEYLAPEVLLDNDYSRSVDWWGLGVVMYEMMCGRLPFYNVDHEILFELILQENIKLPVHLTLSGQDMLSRLLIKNPNERIGGGVQDAVEIMIHPFFDNIDWDLLIKKKINPPWVPDVVDDKDTKYIPDEFAREPVTLTPPKNNNNYLSQI 552          

HSP 2 Score: 152.525 bits (384), Expect = 2.248e-38
Identity = 76/176 (43.18%), Postives = 115/176 (65.34%), Query Frame = 3
Query: 1254 DNINLGVSENKLAKPA--DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFT 1775
            +N++L VS   + +    DF  +  +GKG+FGKV L + K  G  +A+K+L K  + +++EV+H  +E  +L Q  RHPF+ +L +SF T   L F ++YVNGGE+++HL K R FS++R +FYAAEI  ++GYLHS+N+IYRDLK EN+LLD +  I +  +       +Y  FT
Sbjct:  222 ENVDLEVSRRPIKRYGLQDFQLLALLGKGTFGKVILCKEKETGTFYAMKILKKAVLIEKDEVEHTRTESRVL-QQFRHPFMTQLKYSFTTTDYLCFVMEYVNGGEIYYHLSKARIFSEERTKFYAAEILLAIGYLHSQNVIYRDLKLENLLLDCEGHIKLTDFGLCKEEMYYGAFT 396          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000024241.1 (SMESG000024241.1)

HSP 1 Score: 160.614 bits (405), Expect = 4.651e-41
Identity = 81/177 (45.76%), Postives = 109/177 (61.58%), Query Frame = 3
Query: 1932 GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLGYK-NDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIPNSQLNRRTQL 2459
            GHI LTDFGLCKE +     T TFCGTPEYLAPEV+    Y RSVDWW  G V+YEM+ G  PFY+ D   +++ IL   + L  +      D+L +L+ KNP ER+G    D  EI +HPFF  IDW  L+ K++ PP+VP V  + D + I  EF +EP++ + P +  N  +Q+
Sbjct:  377 GHIKLTDFGLCKEEMYYGAFTKTFCGTPEYLAPEVLLDNDYSRSVDWWGLGVVMYEMMCGRLPFYNVDHEILFELILQENIKLPVHLTLSGQDMLSRLLIKNPNERIGGGVQDAVEIMIHPFFDNIDWDLLIKKKINPPWVPDVVDDKDTKYIPDEFAREPVTLTPPKNNNNYLSQI 553          

HSP 2 Score: 152.525 bits (384), Expect = 2.382e-38
Identity = 76/176 (43.18%), Postives = 115/176 (65.34%), Query Frame = 3
Query: 1254 DNINLGVSENKLAKPA--DFDFIKTIGKGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFT 1775
            +N++L VS   + +    DF  +  +GKG+FGKV L + K  G  +A+K+L K  + +++EV+H  +E  +L Q  RHPF+ +L +SF T   L F ++YVNGGE+++HL K R FS++R +FYAAEI  ++GYLHS+N+IYRDLK EN+LLD +  I +  +       +Y  FT
Sbjct:  223 ENVDLEVSRRPIKRYGLQDFQLLALLGKGTFGKVILCKEKETGTFYAMKILKKAVLIEKDEVEHTRTESRVL-QQFRHPFMTQLKYSFTTTDYLCFVMEYVNGGEIYYHLSKARIFSEERTKFYAAEILLAIGYLHSQNVIYRDLKLENLLLDCEGHIKLTDFGLCKEEMYYGAFT 397          
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Match: SMESG000050951.1 (SMESG000050951.1)

HSP 1 Score: 154.836 bits (390), Expect = 5.348e-41
Identity = 106/365 (29.04%), Postives = 172/365 (47.12%), Query Frame = 3
Query: 1347 VFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLRHPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAEIGSSLGYLHSKNIIYRDLKPENIL--LDAQVSIMVKTYPGDMILRF-YFVFTPISRLMK*FRSRKVVRKLKFR*ARDECIIFIIIS*LVAFRASL*YAHLITF*GHIILTDFGLCKEGIEREGTTSTFCGTPEYLAPEVIKKEPYDRSVDWWSFGSVIYEMLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKERLG-YKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEFHKEPISGSIP 2429
            V L + K      ++KVL K+ + +  ++ H +SE+ IL   + HPF+ +L +SF+    LY  ++YV+GGE+F HL+    + +    F+   I      L       +  + E I   +   V    + Y G ++L F Y  +  I+                +R  + E I                   LI   G+I +TDFG  K   +R   T T CGTPEYLAPE++  + Y  ++DWW+ G +IYEM  G PPFY  D  ++Y++IL     ++ +    +  I+  L+ K+   RLG  K+   ++K H +F   +W+ + NK+   P++P +   +D RN D     E  S  IP
Sbjct:    2 VLLVKDKKTSEYLSIKVLSKKRVHRMKQIDHTISEKKIL-SCVEHPFIVKLLYSFKDNYNLYMVMEYVSGGEMFSHLRNSIKYEKFPPTFFHKLIFKRKFQLDVFRKFTKSSEMEVIYFGIGQIVEKQTRFYAGQVVLAFEYLHYLNIA----------------YRDLKPENI-------------------LIDRTGYIKITDFGFAKRIQKR---TYTLCGTPEYLAPEILLNKGYSMAIDWWALGVLIYEMTCGYPPFYDTDPLKIYEKILKGKYKIQKSFSETLFSIISGLLEKDLTHRLGNLKDGSKDLKNHKWFESFEWIRVFNKREPAPYIPLILDESDARNFDDFEETEIGSCDIP 327          
The following BLAST results are available for this feature:
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SGK31.688e-9154.51serum/glucocorticoid regulated kinase family membe... [more]
SGK35.983e-9154.51serum/glucocorticoid regulated kinase family membe... [more]
SGK35.983e-9154.51serum/glucocorticoid regulated kinase family membe... [more]
SGK35.983e-9154.51serum/glucocorticoid regulated kinase family membe... [more]
SGK35.983e-9154.51serum/glucocorticoid regulated kinase family membe... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgk-11.133e-6042.11Serine/threonine-protein kinase sgk-1 [Source:Uni... [more]
sgk-12.112e-6042.25Serine/threonine-protein kinase sgk-1 [Source:Uni... [more]
pkc-34.576e-4930.38Protein kinase C-like 3 [Source:UniProtKB/Swiss-P... [more]
pkc-12.209e-3940.31Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
pkc-15.228e-3940.31Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Akt11.394e-4147.02gene:FBgn0010379 transcript:FBtr0083226[more]
Akt11.394e-4147.02gene:FBgn0010379 transcript:FBtr0344470[more]
Akt11.394e-4147.02gene:FBgn0010379 transcript:FBtr0344717[more]
Akt11.394e-4147.02gene:FBgn0010379 transcript:FBtr0083227[more]
Pkc98E3.400e-4140.91gene:FBgn0003093 transcript:FBtr0301516[more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgk32.978e-9154.26serum/glucocorticoid regulated kinase family membe... [more]
sgk19.920e-7155.50serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
sgk12.642e-7055.50serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
sgk12.379e-6855.50serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
sgk12.379e-6855.50serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SGK39.742e-8953.07serum/glucocorticoid regulated kinase family membe... [more]
SGK33.729e-8753.07serum/glucocorticoid regulated kinase family membe... [more]
SGK33.768e-8753.07serum/glucocorticoid regulated kinase family membe... [more]
SGK31.083e-8351.64serum/glucocorticoid regulated kinase family membe... [more]
SGK33.690e-7750.92serum/glucocorticoid regulated kinase family membe... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sgk31.743e-9454.51serum/glucocorticoid regulated kinase 3 [Source:MG... [more]
Sgk34.078e-9454.51serum/glucocorticoid regulated kinase 3 [Source:MG... [more]
Sgk36.021e-9254.51serum/glucocorticoid regulated kinase 3 [Source:MG... [more]
Sgk36.021e-9254.51serum/glucocorticoid regulated kinase 3 [Source:MG... [more]
Sgk36.021e-9254.51serum/glucocorticoid regulated kinase 3 [Source:MG... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R4V0|SGK3_RAT2.970e-9154.51Serine/threonine-protein kinase Sgk3 OS=Rattus nor... [more]
sp|Q9ERE3|SGK3_MOUSE4.211e-9154.51Serine/threonine-protein kinase Sgk3 OS=Mus muscul... [more]
sp|Q5R7A7|SGK3_PONAB2.873e-9054.51Serine/threonine-protein kinase Sgk3 OS=Pongo abel... [more]
sp|Q96BR1|SGK3_HUMAN2.873e-9054.51Serine/threonine-protein kinase Sgk3 OS=Homo sapie... [more]
sp|Q06226|SGK1_RAT5.641e-7056.92Serine/threonine-protein kinase Sgk1 OS=Rattus nor... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4CKX91.914e-16348.35Non-specific serine/threonine protein kinase OS=Ma... [more]
A0A267FGH54.790e-9858.19Non-specific serine/threonine protein kinase OS=Ma... [more]
A0A1B6MNK03.201e-9656.58Uncharacterized protein (Fragment) OS=Graphocephal... [more]
O739271.554e-9539.96Non-specific serine/threonine protein kinase OS=Sq... [more]
A0A267EWI95.459e-9454.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgk38.812e-9756.23serum/glucocorticoid regulated kinase family membe... [more]
sgk31.443e-7654.55serum/glucocorticoid regulated kinase family membe... [more]
si:ch211-195b13.11.366e-6653.85serine/threonine-protein kinase Sgk1-like [Source:... [more]
si:ch211-195b13.11.610e-6653.85serine/threonine-protein kinase Sgk1-like [Source:... [more]
si:ch211-195b13.16.202e-6553.85serine/threonine-protein kinase Sgk1-like [Source:... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005485.18.887e-8655.74pep scaffold:Pmarinus_7.0:GL480333:786:25860:1 gen... [more]
ENSPMAT00000006766.13.382e-7354.63pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000003714.11.673e-4150.00pep scaffold:Pmarinus_7.0:GL480823:68:8916:1 gene:... [more]
ENSPMAT00000008480.13.076e-4144.64pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
sgk14.280e-3952.35serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FPK11.202e-5633.88Ser/Thr protein kinase; phosphorylates several ami... [more]
YPK14.411e-4543.88S/T protein kinase; phosphorylates, downregulates ... [more]
YPK23.238e-4140.49Protein kinase similar to S/T protein kinase Ypk1p... [more]
SCH92.178e-3850.68AGC family protein kinase; functional ortholog of ... [more]
TPK22.175e-3548.89cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO378002.633e-7255.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411661.038e-5030.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355851.625e-3751.47Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449252.921e-3543.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449383.663e-3538.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sgk33.409e-9354.09serum/glucocorticoid regulated kinase family membe... [more]
SGK15.378e-6956.12serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
SGK12.062e-6756.41serum/glucocorticoid regulated kinase 1 [Source:NC... [more]
si:ch211-195b13.14.363e-6753.89serine/threonine-protein kinase Sgk1 [Source:NCBI ... [more]
si:ch211-195b13.15.258e-6753.89serine/threonine-protein kinase Sgk1 [Source:NCBI ... [more]
back to top
BLAST of Non-specific serine/threonine protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022857.11.563e-14097.55SMESG000022857.1[more]
SMESG000050951.15.412e-4730.10SMESG000050951.1[more]
SMESG000024241.14.548e-4145.76SMESG000024241.1[more]
SMESG000024241.14.651e-4145.76SMESG000024241.1[more]
SMESG000050951.15.348e-4129.04SMESG000050951.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033568 ID=SMED30033568|Name=Non-specific serine/threonine protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=3102bp
TTATTTTATATGTATTTCTTATGAAATAAAATGTTTTGTCTTTTAAATGA
CAATTCAAATAGTTCTAATAAAAATAAGAATGAAATATTTATACAATAAA
ATGATTTCTTTAAGAAAGGCATTTAATCGGCCGGAATTATCAAAAACTTC
AAGAAATCTTTTGATTACAATGAAAAACCATTGTAAATTTTCACAAGCAT
TCACTCAACTGGCAAAAAAGTATGTTTCACTAGTAAAAGACATTGAAAAA
GTTCAAAGGTTTCTAATAAAATTTAATGTTCGTAGAGAAATTATCCATGC
CAAGGACAGTCAGTTGTCTTCTCTAAGAATTGATTCAGAATTTTGGTCAC
TTATAGAAATTTCTCAATTTATTTTAATAAATTATCCTTTGCTAAAAGTA
TACTTTATTCAGGACTTGGAATTCCTACAATGTTTTCAATTTATTCCAAA
TTATTGGATTGGAAATAACCGCAAAAGAATCATGGAATACATTTTTAACA
TTTTTATAATTCAACAAAATCATATTACATTTGAGAACAACAAAAATCCA
GCTACGTTGAAATCTTTATCATTTATTATTTGCTTAAAATCTAAAACCAT
TCTGGATCTTTCAGTATTACCATTAATTATAGCAAATGATATTAAGTGGC
TTAAATTTGAAAAGGCTCATATTTATGAAATAAATATAAAAACTATTTAT
AACGAAATAGTTTTTGATAATTCAGAAAGACTTGTTTTATTGAAGTAAAT
TAATACTTTACTAATTAATTAGTCATTCAAATATTTTTAAAGTGCTTGTT
CCATTAGAGCTTTGTATTAACATAAATTTATATCTACCAAGTTGGATTTA
TAAATTAATAAAGTTTACTGAGCATAATATGAATGCACGAGTCGCTGATC
AAGAAACTATTGATAAAAAATATATTGTGTATAAAATTGCTGTAGATCAT
GATAATAAATCTTGGTTCGTTTTGCGAAGATATCATGAATTCACTTGTCT
CATGGACTTTTTAAAAAAATCTGCACCAAATCTTAATTTGAAGTTACCAG
GAAAACGATTATTTGGCACATTTGATCCTAAATTTATTAAACAACGAAAA
GAAGGATTGAATGAGTTTGTTACTAAACTTTTAGATAGTCCTGATATTTG
GGAATTAAAAGAAGTGAGAGATTTTTTCGGAATTGATCGACAAAATTATG
ATCACGAAGAGGAAGTTAGTCAGGAAAACGTCGATGAGAATTATCCTCAT
GAAGATAACATTAATCTTGGGGTTTCCGAAAATAAATTAGCTAAACCTGC
AGATTTTGATTTTATTAAAACAATCGGTAAAGGTAGTTTTGGAAAGGTAT
TTTTAGCTCGCAGAAAATCAGATGGTGCAGTTTTTGCTGTAAAGGTTTTG
TATAAAGAAAATATTAAGAAACGAAATGAAGTGAAACATATAATGTCGGA
AAGAAATATTTTAGTACAGAATTTGCGACATCCTTTTCTGTGTCGGTTAT
ACTTTTCATTTCAAACCAAACGAAAACTGTATTTTTTTCTCGATTATGTA
AATGGAGGAGAGCTATTTTTTCATTTACAAAAAGAAAGGAGTTTTTCTCA
AAAACGTGCTCAATTCTACGCCGCAGAAATCGGGTCGTCGTTGGGTTATC
TCCATAGTAAAAATATAATTTACAGAGATTTGAAGCCAGAAAACATTTTA
CTAGATGCCCAGGTTAGTATAATGGTGAAAACTTATCCAGGAGATATGAT
TTTGCGCTTCTACTTTGTATTTACGCCCATCTCTCGCTTAATGAAATAAT
TTCGTTCAAGAAAAGTTGTTCGTAAATTGAAATTTCGTTAAGCGAGGGAT
GAGTGTATTATTTTCATTATCATTTCTTGATTGGTAGCTTTTCGGGCATC
ATTATAATATGCTCATCTTATTACGTTTTAGGGTCATATTATTTTGACCG
ATTTTGGGCTTTGCAAAGAGGGTATTGAACGAGAAGGAACAACGTCTACA
TTTTGTGGAACACCTGAGTATTTAGCGCCTGAAGTTATAAAAAAGGAACC
ATATGATCGATCAGTTGACTGGTGGAGTTTCGGATCAGTAATTTATGAAA
TGCTTTTTGGCTTACCACCCTTCTATTCTCAAGACACCCATCAAATGTAT
CAACGAATTCTTAACAGCCCTCTGCCACTAAGAGGAAACTGCCCATCAGT
GATATCAGACATACTTGTAAAATTAATTAGAAAAAATCCTAAAGAGCGAC
TTGGTTACAAAAATGACTTTGACGAAATAAAAGTACATCCTTTCTTTTCT
CAAATCGATTGGGTTGCACTAGTCAATAAACAAGTGAAACCACCGTTTGT
TCCCCAGGTGTCATCCAATGCTGACATTAGAAATATTGATCCAGAATTCC
ATAAAGAACCTATTTCGGGTTCAATTCCAAACTCACAGCTTAACAGAAGA
ACTCAACTGAGTGTTGAAGATGTGGATGATTCGTTTGTAGGATTTTCATA
TGTTCCTCCAATAGATGAAAACATGGCTAATTAAATGCTCGAGTTTTTAT
TAATTGAATTAAAATTTCTTAACGAATTTCAAAGGATTTGTGGAAACTTG
GTTTTTAGTTATTTTTGATTTTTATTTTTGAAATAAATTTTTAGAATTTT
TAAAAAAAAAATGGAAATAAATTAGATTAAATGTAATGCCCGGCGTCGCT
CATAGTTACCGCGCACTGGTTAGAAATGAAATCCTAGCGAAAGCTCAACG
GGAGTTATTGATTTCTCTGATTATAGATTTTAAAGAGCAGATTTATTAAA
AAATAATTCAAGTAATGGTTGAAATGTGTAATCTATATTGCATGAATAAT
AGATATCATATCAAATGCACTTCAATAAGCTGAATTAAATTTAAAAATAT
GCACTTTCTTTCTTTGAGTGGCATTGCAACTCATGCCGGGTACATAAGGT
TATGAATAATAGTGTCCGTTTTCGAAACTTCTAGCAATTTCATAACGCTT
TAATTAATTTTAAAAATATATATTATATCGATATAGATCGATGTAAATTT
ATTTGAATAAAATATAATTTTTAATCTAACTTATTTCCATATTCATATAA
AT
back to top

protein sequence of SMED30033568-orf-1

>SMED30033568-orf-1 ID=SMED30033568-orf-1|Name=SMED30033568-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MNARVADQETIDKKYIVYKIAVDHDNKSWFVLRRYHEFTCLMDFLKKSAP
NLNLKLPGKRLFGTFDPKFIKQRKEGLNEFVTKLLDSPDIWELKEVRDFF
GIDRQNYDHEEEVSQENVDENYPHEDNINLGVSENKLAKPADFDFIKTIG
KGSFGKVFLARRKSDGAVFAVKVLYKENIKKRNEVKHIMSERNILVQNLR
HPFLCRLYFSFQTKRKLYFFLDYVNGGELFFHLQKERSFSQKRAQFYAAE
IGSSLGYLHSKNIIYRDLKPENILLDAQVSIMVKTYPGDMILRFYFVFTP
ISRLMK*
back to top

protein sequence of SMED30033568-orf-2

>SMED30033568-orf-2 ID=SMED30033568-orf-2|Name=SMED30033568-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MLFGLPPFYSQDTHQMYQRILNSPLPLRGNCPSVISDILVKLIRKNPKER
LGYKNDFDEIKVHPFFSQIDWVALVNKQVKPPFVPQVSSNADIRNIDPEF
HKEPISGSIPNSQLNRRTQLSVEDVDDSFVGFSYVPPIDENMAN*
back to top

protein sequence of SMED30033568-orf-3

>SMED30033568-orf-3 ID=SMED30033568-orf-3|Name=SMED30033568-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MTIQIVLIKIRMKYLYNKMISLRKAFNRPELSKTSRNLLITMKNHCKFSQ
AFTQLAKKYVSLVKDIEKVQRFLIKFNVRREIIHAKDSQLSSLRIDSEFW
SLIEISQFILINYPLLKVYFIQDLEFLQCFQFIPNYWIGNNRKRIMEYIF
NIFIIQQNHITFENNKNPATLKSLSFIICLKSKTILDLSVLPLIIANDIK
WLKFEKAHIYEINIKTIYNEIVFDNSERLVLLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR000719Prot_kinase_dom
IPR000961AGC-kinase_C
IPR017892Pkinase_C
IPR011009Kinase-like_dom_sf
IPR001683Phox
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0004674protein serine/threonine kinase activity
GO:0035091phosphatidylinositol binding
GO:0016740transferase activity
GO:0017080sodium channel regulator activity
GO:0017081chloride channel regulator activity
GO:0000166nucleotide binding
GO:0005246calcium channel regulator activity
GO:0015459potassium channel regulator activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0032411positive regulation of transporter activity
GO:0035556intracellular signal transduction
GO:0042127regulation of cell proliferation
GO:0042981regulation of apoptotic process
GO:0001558regulation of cell growth
Vocabulary: cellular component
TermDefinition
GO:0031410cytoplasmic vesicle
GO:0055037recycling endosome
GO:0005768endosome
GO:0005769early endosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 2..103
e-value: 1.1E-7
score: 41.5
IPR001683Phox homologous domainPFAMPF00787PXcoord: 5..100
e-value: 1.2E-16
score: 60.7
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 1..107
score: 16.647
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 143..305
e-value: 8.3E-16
score: 68.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 144..281
e-value: 1.8E-38
score: 132.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 143..306
score: 29.276
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 2..107
e-value: 8.9E-26
score: 91.9
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 8..104
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 142..225
e-value: 1.1E-60
score: 207.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 226..283
e-value: 1.1E-60
score: 207.2
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 9..283
NoneNo IPR availablePANTHERPTHR24351:SF197coord: 9..283
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 149..172
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 263..275
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 142..283