Pol polyprotein-like protein

Overview
NamePol polyprotein-like protein
Smed IDSMED30033557
Length (bp)816
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Pol polyprotein-like protein vs. Ensembl Zebrafish
Match: CABZ01030006.1 (pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene:ENSDARG00000114113.1 transcript:ENSDART00000182402.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01030006.1)

HSP 1 Score: 75.0998 bits (183), Expect = 3.239e-15
Identity = 51/161 (31.68%), Postives = 75/161 (46.58%), Query Frame = 2
Query:   47 CKNCHVSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELP 526
            C  C V+K  N K          L++    R  ++  +DIMGP+P    + +Y+   +D  + W E  P+   ++      +  E +TR GV   I+     QF+SS F ELC K+NI    TT    Q N   ER +RTLKS +    ED ++     LP
Sbjct:   12 CAKCQVTKWDNRKP------AGKLQQVTTSRPNEMWRVDIMGPMPKSGKQNEYLLVFVDYFSKWVELFPMRHATAQTIATILRQEMLTRWGVPDFILSDRGAQFVSSLFTELCGKWNITPKLTTAYHPQTN-MTERVNRTLKSMIAGFVEDNHKTWDTYLP 165          
BLAST of Pol polyprotein-like protein vs. Ensembl Xenopus
Match: mybl2 (MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-GENE-982419])

HSP 1 Score: 63.929 bits (154), Expect = 3.920e-11
Identity = 40/135 (29.63%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  143 FKVIHMDIMGPL-PLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ I MD++GP+       ++I  I+D  T + EAIP+   SS    R + + + +R G+ K I+      F+S    ELC  + +  + T+    Q +  VERF++TLKS L+   +   +N    LP ++   
Sbjct:  146 FERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLKKVVDKDGKNWDYLLPYLMFAI 279          
BLAST of Pol polyprotein-like protein vs. Ensembl Xenopus
Match: nmbr (neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611])

HSP 1 Score: 62.003 bits (149), Expect = 1.573e-10
Identity = 37/114 (32.46%), Postives = 61/114 (53.51%), Query Frame = 2
Query:  143 FKVIHMDIMGPL-PLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLR 481
            F+ I MD++GP+       ++I  I+D  T + EAIP+   SS    R + + + +R G+ K I+      F+S    ELC  + +  + T+    Q +  VERF++TLKS L+
Sbjct:  213 FERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSMLK 325          
BLAST of Pol polyprotein-like protein vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.468e-8
Identity = 38/136 (27.94%), Postives = 66/136 (48.53%), Query Frame = 2
Query:  143 FKVIHMDIMGPL--PLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ + +D++GPL  P  S K+YI  ++D  T + EA+ + ++ +  T+     +  +R G    I+     QF S     L  +  +  IH++    Q N   ERF+ TLK+ LR   E   ++    LP +L  +
Sbjct:  708 FQRVAVDLIGPLSRPSRSGKQYILTVMDYATRYPEAVALRKIDAP-TVADALIQIFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTMLRTFVESGEKDWERYLPHLLFAY 842          
BLAST of Pol polyprotein-like protein vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 3.992e-7
Identity = 34/136 (25.00%), Postives = 63/136 (46.32%), Query Frame = 2
Query:  143 FKVIHMDIMGPL--PLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ + +D++GPL  P  + K+YI  ++D  T + EA+ +  + +      +  +  +R G    I+     QF+S     L  +  +  + ++    Q N   ERF+ TLK+ LR   E    +    LP +L  +
Sbjct:  155 FQRVAVDLIGPLSRPSRTGKQYILTMVDYATRYPEAVALRRIDAPAVADAL-IQIFSRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNMLRTFVEAGEGDWEKFLPCLLFAY 289          
BLAST of Pol polyprotein-like protein vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 9.218e-7
Identity = 36/116 (31.03%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  143 FKVIHMDIMGPLPLVSN-KKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAH 487
            F  + +D +GPLP   N  +Y   +I   T +  AIPI   S+    + I   +I + G  KT I     ++ +S   +LC    I++I +T    Q    VER HRTL   +R++
Sbjct:  965 FDRVVVDTIGPLPKSENGNEYAVTLICDLTKYLVAIPIANKSAKTVAKAIFESFILKYGPMKTFITDMGTEYKNSIITDLCKYLKIKNITSTAHHHQTVGVVERSHRTLNEYIRSY 1080          
BLAST of Pol polyprotein-like protein vs. UniProt/SwissProt
Match: sp|Q09575|YRD6_CAEEL (Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans OX=6239 GN=K02A2.6 PE=4 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.607e-6
Identity = 36/109 (33.03%), Postives = 52/109 (47.71%), Query Frame = 2
Query:  143 FKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLK 469
            +K IH+D  GPL    N  Y+  ++D  T + E      +S+  TI  +E E  +  G  +TII  N  Q  S  F ++C  + IEH  +     + N   ERF  TLK
Sbjct:  849 WKRIHIDFAGPL----NGCYLLVVVDAKTKYAEVKLTRSISAVTTIDLLE-EIFSIHGYPETIISDNGTQLTSHLFAQMCQSHGIEHKTSAVYYPRSNGAAERFVDTLK 952          
BLAST of Pol polyprotein-like protein vs. TrEMBL
Match: A0A182GF01 (Integrase catalytic domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG008772 PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.519e-26
Identity = 59/135 (43.70%), Postives = 80/135 (59.26%), Query Frame = 2
Query:  140 KFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            +F+ IH+D++GPLP     +Y+  IIDR T W EA+P+ EM++    + +   WI+R G  +TI      QF S  F EL     + HIHTT    Q N  VERFHRTLK++LR+ S+    N  + LPLVLLG 
Sbjct:   64 RFRNIHIDLVGPLPPSRGHRYLLTIIDRFTRWAEAVPLPEMTAPTVAKALLVGWISRFGTPETITSDQGRQFESEVFRELTSLLGVHHIHTTAYHPQSNGIVERFHRTLKASLRSASDS---NWYDRLPLVLLGL 195          
BLAST of Pol polyprotein-like protein vs. TrEMBL
Match: A0A0A9YG17 (Pro-Pol polyprotein (Fragment) OS=Lygus hesperus OX=30085 GN=pol_21 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 9.140e-25
Identity = 54/147 (36.73%), Postives = 78/147 (53.06%), Query Frame = 2
Query:  104 IKSNLKEFLECRKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            +K+ L+      KF+ IH+D++GPLP      Y   +IDR+T WTE  P+  + +     T+  EWI+R GV K I      QF S+ F  +C+   I    T +   Q N  +ERFHR LK++L+   +  N N  N LP V+LG 
Sbjct:    8 VKAPLEPIYTGNKFETIHIDLIGPLPASQGYNYCLTVIDRNTKWTECYPVRNIEANTITETLYKEWISRFGVPKIITTDQGRQFESAIFKSMCVTLGINRHRTNSFHPQSNGMIERFHRNLKTSLKPQIQ--NSNWVNNLPTVMLGL 152          
BLAST of Pol polyprotein-like protein vs. TrEMBL
Match: A0A2L2YVP0 (Integrase catalytic domain-containing protein (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.048e-24
Identity = 70/175 (40.00%), Postives = 88/175 (50.29%), Query Frame = 2
Query:   23 MTALIRNWCKNCHVSKK*NNKT*NLYDIKSNLKEFLEC-RKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            MT  IR W K C   +K           KS   E+ E   +F ++H+D++GPLP    K Y    IDR T W EAIPI ++++ +  R     WITR GV   II     QF S  F  L +    +  HTT    Q N KVERFHRTLK+ ++AHS   N      LP VLLG 
Sbjct:  265 MTKEIREWAKTCIQCQKVKIHR----HTKSQFSEYQEPDARFSMVHIDLIGPLPPSEGKMYCLTCIDRYTCWMEAIPIPDITANIVSRAFYENWITRFGVPTQIITDQGRQFESQLFRSLAVICGAKVQHTTPYHPQSNGKVERFHRTLKTAIKAHS---NIRWTESLPTVLLGL 432          
BLAST of Pol polyprotein-like protein vs. TrEMBL
Match: A0A182GDC4 (Integrase catalytic domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG007977 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 2.906e-24
Identity = 61/166 (36.75%), Postives = 87/166 (52.41%), Query Frame = 2
Query:   47 CKNCHVSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            C +C +SK       N + +   +   +   +F+ IH+D++GPLP     +Y+  IIDR T W EAIP+ +M++    + +   WI+R G  +TI      QF S  F EL       HIHTT    Q N  VERFHRT+K+ L   +    +  + ELPLVLLG 
Sbjct:   12 CLDCQLSKV------NRHTVSPYVPFDMPKSRFRHIHIDLVGPLPPSDGNRYVLTIIDRFTRWPEAIPLSDMTAPTVAKALTLGWISRFGTPETITSDQGRQFESDLFRELTYILGTHHIHTTAYHPQANGMVERFHRTMKAALMCKNV---KRWSEELPLVLLGL 168          
BLAST of Pol polyprotein-like protein vs. TrEMBL
Match: A0A182GJA0 (Integrase catalytic domain-containing protein OS=Aedes albopictus OX=7160 GN=RP20_CCG010915 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.092e-24
Identity = 67/168 (39.88%), Postives = 91/168 (54.17%), Query Frame = 2
Query:   47 CKNCHVSKK*NNKT*NLYDIKSNLKEF--LECRKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            C+ C +SK   + T       S L  F   +CR F+ IH+D++GPLP     +Y+  I+DR T W EAIP+ +M++    R +   W++R G  +TI      QF S  F EL     + HI TT    Q N  VERFHRTLK+ L    ++ NR   +ELPLVLLG 
Sbjct:   12 CQECQLSKVNRHTT-------SPLGSFDPPKCR-FRNIHVDLVGPLPPSKGNRYLLTILDRFTRWPEAIPLSDMTAPTVARALTEHWVSRFGTPETITTYQGRQFESDLFRELTSILGVHHIRTTAYHPQSNGMVERFHRTLKAALMC--KNTNR-WCDELPLVLLGL 168          
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000058127.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:35454045:35455481:1 gene:ENSAMXG00000038477.1 transcript:ENSAMXT00000058127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 4.481e-15
Identity = 48/173 (27.75%), Postives = 80/173 (46.24%), Query Frame = 2
Query:   35 IRNWCKNCH--VSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            +  WC+ C    S+K +         ++ L   +  R ++ I +DI+GPLP    K +YI  + D  + WTEA  +    +    + +  EWI R G  ++I       F S  F ELC   N+    T+  + Q +  +ERF+RTL S L    +   ++    LP V++ +
Sbjct:   40 VERWCRECTDCASRKTSGPA-----PRAPLLPSVTSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAY 207          
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000031920.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:11094903:11101818:1 gene:ENSAMXG00000039354.1 transcript:ENSAMXT00000031920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 7.297e-15
Identity = 48/170 (28.24%), Postives = 79/170 (46.47%), Query Frame = 2
Query:   44 WCKNCH--VSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            WC+ C    S+K +         ++ L   +  R ++ I +DI+GPLP    K +YI  + D  + WTEA  +    +    + +  EWI R G  ++I       F S  F ELC   N+    T+  + Q +  +ERF+RTL S L    +   ++    LP V++ +
Sbjct:    7 WCRECTDCASRKTSGPA-----PRAPLLPSVTSRPYERIALDILGPLPETPQKNRYILVVGDYFSKWTEAFSLPNQEAKTVAKVLTEEWICRYGAPRSIHTDQGRNFESHLFSELCRLLNMHKSRTSPYRPQSDGLIERFNRTLLSMLSLFVDANQQDWDALLPFVMMAY 171          
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000037741.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27788674:27792885:-1 gene:ENSAMXG00000029895.1 transcript:ENSAMXT00000037741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 6.663e-13
Identity = 45/171 (26.32%), Postives = 75/171 (43.86%), Query Frame = 2
Query:   35 IRNWCKNCHVSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVS-NKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            + +WCK C +            + ++ L+       F+ + +DI+GPLP+ S   KYI  I D  T W EA  +    +    RT+  ++I R G  ++I       F S+ F  +C   +I    TT      +  VER +RT+ + L    +    N    LP V++ +
Sbjct:  124 VMDWCKKCELCAVFKTSG---AEPRAPLRPIQAGYPFEKLGIDIVGPLPVTSQGNKYIIVIADYFTKWCEAFAMRAQDADTVARTVVEQFILRWGTPRSIHTDQGKNFDSALFRAICELLDIHKTRTTPYHPSSDGLVERLNRTITTMLSMFVDANQGNWDELLPYVMMAY 291          
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 1.990e-12
Identity = 48/177 (27.12%), Postives = 89/177 (50.28%), Query Frame = 2
Query:   23 MTALIRNWCKNCHVSKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVS-NKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWI---TR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLG 541
            M A +RN+C+ C V +  + +          +   +    F+ + MD++GPLP  +   +Y+  ++D  T + EA+ + + ++    R+I  E +   +R G+ K I+      F+S+   E+C    I+H+HT+    Q +  VER+++TLK  LR   ++  RN    LP +L  
Sbjct:  389 MEAEVRNFCQRCAVCQSTSPRK---PAPAPLIPLPIIGVPFERLGMDLVGPLPKSARGHEYLLVLVDYATRYPEAVALRKANT----RSIAKELVLLFSRVGLPKEILSDQGTPFVSNLMKEVCRLLKIKHLHTSIYHPQTDGLVERYNQTLKRMLRRLIDEDGRNWDLLLPYILFA 558          
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000039384.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:21146036:21149703:-1 gene:ENSAMXG00000035834.1 transcript:ENSAMXT00000039384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.781 bits (164), Expect = 2.310e-12
Identity = 49/173 (28.32%), Postives = 80/173 (46.24%), Query Frame = 2
Query:   35 IRNWCKNCHV--SKK*NNKT*NLYDIKSNLKEFLECRKFKVIHMDIMGPLPLVSN-KKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            ++ WC+ C V  + K   KT      ++ L   +  R F+ I +DI+GPLP+ +   KYI  I D  + W E+  I    +    R +  +++ R G+ + I       F SS F ELC    I+   T+    Q +  VER +RT+   L +  E    +    LP V++ +
Sbjct:  463 VKEWCRVCEVCATHKIVGKT-----PRAPLMPSVATRPFQRIALDIVGPLPVTATGNKYILVIADYFSKWAESYAIPNQEATTVARAVV-DFLLRWGMPQVIHTDQGRTFESSLFKELCRLLEIDKTRTSPYSPQSDGLVERLNRTIIGMLASFVEANQNSWDTLLPFVMMAY 629          
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Match: ENSORLT00000045127.1 (pep primary_assembly:ASM223467v1:10:587855:593081:1 gene:ENSORLG00000029202.1 transcript:ENSORLT00000045127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 6.134e-18
Identity = 49/144 (34.03%), Postives = 72/144 (50.00%), Query Frame = 2
Query:  116 LKEFLECRKFKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            ++  +  R F+ + ++I+GPLP   NK KYI  I D  + WTEA P+    +    + +  EW+ R G  ++I       F S+ F ELC   +I    T+    Q +  VERF+RTL S L    ED   N    LP V+L +
Sbjct:   29 MQTLVPSRPFERVALEILGPLPETPNKNKYILVISDYFSKWTEAFPLPNQEAQSIAKVLTEEWVCRFGAPRSIHSDQGRNFESTLFKELCSLLSIHKSRTSPYHPQSDGLVERFNRTLLSLLALFVEDNQLNWDKLLPYVMLAY 172          
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Match: ENSORLT00000030461.1 (pep primary_assembly:ASM223467v1:5:4384046:4385262:1 gene:ENSORLG00000026861.1 transcript:ENSORLT00000030461.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 2.909e-13
Identity = 47/135 (34.81%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  143 FKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ I MD++GPL   S+  KYI  I D  T + EA P+  + +   I  +  +  +R GV   II      F S T  +L  +  I+ I TT    Q +  VERF++TLK  LR    D  R+    LP VL  +
Sbjct:   49 FRRIAMDVVGPLEKSSSGYKYILVICDYATRFPEAFPLRSIKTPKIISAL-VQLFSRVGVPDEIITDQATNFTSGTMKQLQKELGIKGIRTTPYHPQTDGLVERFNQTLKQMLRKFVADTGRDWDKWLPFVLFAY 182          
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Match: ENSORLT00000033056.1 (pep primary_assembly:ASM223467v1:23:165526:166795:1 gene:ENSORLG00000025483.1 transcript:ENSORLT00000033056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 3.451e-13
Identity = 47/135 (34.81%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  143 FKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ I MD++GPL   S+  KYI  I D  T + EA P+  + +   I  +  +  +R GV   II      F S T  +L  +  I+ I TT    Q +  VERF++TLK  LR    D  R+    LP VL  +
Sbjct:  121 FRRIAMDVVGPLEKSSSGYKYILVICDYATRFPEAFPLRSIKTPKIISAL-VQLFSRVGVPDEIITDQATNFTSGTMKQLQKELGIKGIRTTPYHPQTDGLVERFNQTLKQMLRKFVADTGRDWDKWLPFVLFAY 254          
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Match: ENSORLT00000043660.1 (pep primary_assembly:ASM223467v1:15:27996403:27998990:-1 gene:ENSORLG00000029791.1 transcript:ENSORLT00000043660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 5.928e-13
Identity = 47/135 (34.81%), Postives = 66/135 (48.89%), Query Frame = 2
Query:  143 FKVIHMDIMGPLPLVSNK-KYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            F+ I MD++GPL   S+  KYI  I D  T + EA P+  + +   I  +  +  +R GV   II      F S T  +L  +  I+ I TT    Q +  VERF++TLK  LR    D  R+    LP VL  +
Sbjct:  197 FRRIAMDVVGPLEKSSSGYKYILVICDYATRFPEAFPLRSIKTPKIISAL-VQLFSRVGVPDEIITDQATNFTSGTMKQLQKELGIKGIRTTPYHPQTDGLVERFNQTLKQMLRKFVADTGRDWDKWLPFVLFAY 330          
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Match: ENSORLT00000042487.1 (pep primary_assembly:ASM223467v1:4:23584510:23586585:1 gene:ENSORLG00000030583.1 transcript:ENSORLT00000042487.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 2.119e-12
Identity = 39/147 (26.53%), Postives = 66/147 (44.90%), Query Frame = 2
Query:  104 IKSNLKEFLECRKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGF 544
            I++ +K FL  R  +V+ +D     P    ++ +  + D  T +T+A P  +  +  T + +  EW  + GV + +       F S    ELC  Y ++   TT    Q N + ERF+RTL   LR    +  R     LP ++  +
Sbjct:  283 IRTPMKHFLATRPLEVVAVDFTLLEPASDGRENVLVVTDVFTKFTQAFPTRDQKADTTAKVLLREWFMKYGVPERLHSDQGRNFESEVIQELCKLYGVKKTRTTPHHPQGNAQCERFNRTLHDLLRTLPPEKKRRWPEYLPELIYAY 429          
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Match: SMESG000055306.1 (SMESG000055306.1)

HSP 1 Score: 304.294 bits (778), Expect = 4.453e-106
Identity = 146/148 (98.65%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  335 MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTNCSPNLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP 778
            MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTN SP+LKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP
Sbjct:    1 MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTNRSPDLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP 148          
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Match: SMESG000054366.1 (SMESG000054366.1)

HSP 1 Score: 304.294 bits (778), Expect = 4.453e-106
Identity = 146/148 (98.65%), Postives = 147/148 (99.32%), Query Frame = 2
Query:  335 MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTNCSPNLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP 778
            MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTN SP+LKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP
Sbjct:    1 MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPKPMLDGLFSVTNRSPDLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP 148          
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Match: SMESG000000071.1 (SMESG000000071.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.702e-14
Identity = 51/142 (35.92%), Postives = 68/142 (47.89%), Query Frame = 2
Query:  125 FLECRKFKVIHMDIMGPLPLVSNKKYIFRIIDRDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYN 550
            F   + F++IH++I+GPL   +N                    Y   + L +R     WI R G  KTI+     QF S  F  LC  YNI+   TT    Q N K+ER H+TLK +LR  +ED  RN  N+ P +LLG  N
Sbjct:  232 FPSRQPFELIHVNIVGPLAPNNN--------------------YRQENKL-VRKFN--WIGRYGQPKTIMTDQVRQFESQLFEMLCKIYNIKRNRTTAFNPQANGKIERLHKTLKESLRTKAED--RNWLNQPPTILLGLRN 348          
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Match: SMESG000027384.1 (SMESG000027384.1)

HSP 1 Score: 69.707 bits (169), Expect = 5.088e-14
Identity = 39/99 (39.39%), Postives = 58/99 (58.59%), Query Frame = 2
Query:  146 KVIHMDIMGPLPLVSNKKYIFRIID----RDTSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQ 430
            K+  +++ G    + N+K    I+     + TSW EAIPI ++ S    +T+E EWI++    + II  N  QF+SS+F +LC KYNIEH+HTT    Q
Sbjct:  122 KLAQIEVNGKTNKIRNEKTFMSILLVHYLQSTSWPEAIPIGDIRSETVYKTMEREWISKFESPEIIITDNGKQFISSSFKKLCNKYNIEHLHTTPYHPQ 220          
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Match: SMESG000007179.1 (SMESG000007179.1)

HSP 1 Score: 69.3218 bits (168), Expect = 3.254e-13
Identity = 43/108 (39.81%), Postives = 55/108 (50.93%), Query Frame = 2
Query:  227 TSWTEAIPIYEMSSGLTIRTIENEWITR*GVFKTIIMGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRAHSEDPNRNLANELPLVLLGFYN 550
            T+W E I + E+S+      +E  WI R    KTII   + QF       LC  YN +    T    Q N K+ER HRTLK +LR  +ED  RN  N+LP +L G  N
Sbjct:  210 TNWFEVISLKEISAKYICNNLEFNWIARYDQPKTIITDQERQF-----EMLCKNYNFKRNRITAYNPQANGKIERLHRTLKESLRTKAED--RNWLNQLPTILPGQRN 310          
The following BLAST results are available for this feature:
BLAST of Pol polyprotein-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABZ01030006.13.239e-1531.68pep scaffold:GRCz11:KN150258.1:33006:36502:-1 gene... [more]
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mybl23.920e-1129.63MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-G... [more]
nmbr1.573e-1032.46neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000023941.12.468e-827.94pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
ENSXETT00000023851.13.992e-725.00pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P10394|POL4_DROME9.218e-731.03Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q09575|YRD6_CAEEL1.607e-633.03Uncharacterized protein K02A2.6 OS=Caenorhabditis ... [more]
back to top
BLAST of Pol polyprotein-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A182GF012.519e-2643.70Integrase catalytic domain-containing protein OS=A... [more]
A0A0A9YG179.140e-2536.73Pro-Pol polyprotein (Fragment) OS=Lygus hesperus O... [more]
A0A2L2YVP01.048e-2440.00Integrase catalytic domain-containing protein (Fra... [more]
A0A182GDC42.906e-2436.75Integrase catalytic domain-containing protein OS=A... [more]
A0A182GJA03.092e-2439.88Integrase catalytic domain-containing protein OS=A... [more]
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000058127.14.481e-1527.75pep primary_assembly:Astyanax_mexicanus-2.0:16:354... [more]
ENSAMXT00000031920.17.297e-1528.24pep primary_assembly:Astyanax_mexicanus-2.0:12:110... [more]
ENSAMXT00000037741.16.663e-1326.32pep primary_assembly:Astyanax_mexicanus-2.0:6:2778... [more]
ENSAMXT00000044431.11.990e-1227.12pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000039384.12.310e-1228.32pep primary_assembly:Astyanax_mexicanus-2.0:25:211... [more]
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pol polyprotein-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000045127.16.134e-1834.03pep primary_assembly:ASM223467v1:10:587855:593081:... [more]
ENSORLT00000030461.12.909e-1334.81pep primary_assembly:ASM223467v1:5:4384046:4385262... [more]
ENSORLT00000033056.13.451e-1334.81pep primary_assembly:ASM223467v1:23:165526:166795:... [more]
ENSORLT00000043660.15.928e-1334.81pep primary_assembly:ASM223467v1:15:27996403:27998... [more]
ENSORLT00000042487.12.119e-1226.53pep primary_assembly:ASM223467v1:4:23584510:235865... [more]
back to top
BLAST of Pol polyprotein-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055306.14.453e-10698.65SMESG000055306.1[more]
SMESG000054366.14.453e-10698.65SMESG000054366.1[more]
SMESG000000071.11.702e-1435.92SMESG000000071.1[more]
SMESG000027384.15.088e-1439.39SMESG000027384.1[more]
SMESG000007179.13.254e-1339.81SMESG000007179.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033557 ID=SMED30033557|Name=Pol polyprotein-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=816bp
TTATTGTTATTCTTTTATGCACATGACAGCACTAATCAGAAATTGGTGCA
AAAACTGCCACGTGTCAAAAAAATAAAATAACAAGACATAAAATTTGTAT
GATATAAAGTCGAATCTCAAAGAATTTCTAGAATGCAGAAAGTTCAAAGT
GATACATATGGACATCATGGGACCATTGCCTTTAGTCAGTAATAAAAAGT
ATATTTTTAGGATTATTGACAGAGATACATCTTGGACAGAAGCTATTCCA
ATTTACGAGATGTCGAGTGGTTTAACAATAAGAACCATTGAAAATGAATG
GATAACACGCTAAGGAGTTTTCAAAACCATCATAATGGGCAACGACATAC
AATTTCTTTCATCCACTTTCATGGAACTATGCTTAAAGTACAACATCGAA
CACATACATACCACTACGTGTCAATCTCAATGCAACGATAAAGTTGAGAG
GTTCCACCGAACGCTCAAATCAACCTTAAGAGCACACTCAGAAGATCCTA
ACAGAAATTTGGCGAATGAATTACCATTAGTTCTTCTAGGGTTTTACAAC
GACAAGCCTTGTTTGGAATTGACAGTTGCTTATCTTGGAACATCCGATGT
TTGGTTCAAAGAGGAGACAAGAACTGCACCCAAACCCATGCTTGATGGAC
TATTTTCTGTAACCAATTGCAGCCCTAATCTCAAAACATTCGAAATCAAA
CAACCGACAAGAACAATTCGGGTTTCAGTGGGTAAGCTTAAAGTCGCCTA
CTTTCGAGATGACAGTTTGGTTATTCCATAACCTGGAAAGATGCTATGTA
GCCATTTAATATTAAA
back to top

protein sequence of SMED30033557-orf-1

>SMED30033557-orf-1 ID=SMED30033557-orf-1|Name=SMED30033557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MGNDIQFLSSTFMELCLKYNIEHIHTTTCQSQCNDKVERFHRTLKSTLRA
HSEDPNRNLANELPLVLLGFYNDKPCLELTVAYLGTSDVWFKEETRTAPK
PMLDGLFSVTNCSPNLKTFEIKQPTRTIRVSVGKLKVAYFRDDSLVIP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 21..40