SMED30033554

Overview
NameSMED30033554
Smed IDSMED30033554
Length (bp)884
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033554 (SMED30033554) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033554 (SMED30033554) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033554 (SMED30033554) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033554 (SMED30033554) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033554

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033554 dd_Smed_v4_492_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033554 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001232:21783..22664 -4374
Homology
BLAST of SMED30033554 vs. Ensembl Human
Match: PRXL2B (peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC:28390])

HSP 1 Score: 63.5438 bits (153), Expect = 1.719e-11
Identity = 37/115 (32.17%), Postives = 63/115 (54.78%), Query Frame = -2
Query:  104 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDI 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R   ++A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++   + IL  L I     +A+   + P  +C+ ++
Sbjct:   90 ELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGI-----SAEVCASDPP-QCDREV 198          
BLAST of SMED30033554 vs. Ensembl Human
Match: PRXL2B (peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC:28390])

HSP 1 Score: 63.1586 bits (152), Expect = 3.498e-11
Identity = 37/115 (32.17%), Postives = 63/115 (54.78%), Query Frame = -2
Query:  104 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDI 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R   ++A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++   + IL  L I     +A+   + P  +C+ ++
Sbjct:  120 ELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGI-----SAEVCASDPP-QCDREV 228          
BLAST of SMED30033554 vs. Ensembl Human
Match: PRXL2B (peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC:28390])

HSP 1 Score: 52.373 bits (124), Expect = 2.367e-7
Identity = 37/133 (27.82%), Postives = 63/133 (47.37%), Query Frame = -2
Query:  104 ELYVDIDKKSYANLGFKK------------------YSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDI 439
            ELY+D  K+ Y  LGFK+                  Y+ + ++ A      R   ++A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++   + IL  L I     +A+   + P  +C+ ++
Sbjct:  120 ELYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGI-----SAEVCASDPP-QCDREV 246          
BLAST of SMED30033554 vs. Ensembl Human
Match: PRXL2B (peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC:28390])

HSP 1 Score: 52.373 bits (124), Expect = 2.367e-7
Identity = 37/133 (27.82%), Postives = 63/133 (47.37%), Query Frame = -2
Query:  104 ELYVDIDKKSYANLGFKK------------------YSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDI 439
            ELY+D  K+ Y  LGFK+                  Y+ + ++ A      R   ++A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++   + IL  L I     +A+   + P  +C+ ++
Sbjct:  120 ELYLDESKQLYKELGFKRLWTQASPEFGQATWCLRRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPKEHILQVLGI-----SAEVCASDPP-QCDREV 246          
BLAST of SMED30033554 vs. Ensembl Human
Match: PRXL2B (peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC:28390])

HSP 1 Score: 50.0618 bits (118), Expect = 6.889e-7
Identity = 25/64 (39.06%), Postives = 38/64 (59.38%), Query Frame = -2
Query:  254 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQ 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R   ++A+  G  GN+ GD  Q+GG LVV +
Sbjct:   90 ELYLDESKQLYKELGFKRYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSK 153          
BLAST of SMED30033554 vs. Ensembl Zebrafish
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:406605])

HSP 1 Score: 72.4034 bits (176), Expect = 1.015e-14
Identity = 44/118 (37.29%), Postives = 69/118 (58.47%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ++Y+D  K+ Y +LGFK+Y+ + V+ A      R+  S+A   G  GN  GD  Q+GG L+V +GG  VL  + Q++ A++  +++I  AL I     N  A G  P  +CN+D+CTR
Sbjct:   90 DIYIDEMKQCYKDLGFKRYNAINVVPAAMGKKVREIASKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQKSPADNPPLEEITKALGISA---NVQA-GEKP--QCNEDVCTR 201          
BLAST of SMED30033554 vs. Ensembl Zebrafish
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:406605])

HSP 1 Score: 60.077 bits (144), Expect = 1.973e-10
Identity = 34/93 (36.56%), Postives = 56/93 (60.22%), Query Frame = -2
Query:  170 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKI 439
            ++Y+D  K+ Y +LGFK+Y+ + V+ A      R+  S+A   G  GN  GD  Q+GG L+V +GG  VL  + Q++ A++  +++I  AL I
Sbjct:   89 DIYIDEMKQCYKDLGFKRYNAINVVPAAMGKKVREIASKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQKSPADNPPLEEITKALGI 181          
BLAST of SMED30033554 vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:549974])

HSP 1 Score: 74.3294 bits (181), Expect = 2.268e-15
Identity = 43/118 (36.44%), Postives = 67/118 (56.78%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+SY  LGFK+YS + V+ A      R  +++A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++ I+  L I      A+ T  +   +CND++CTR
Sbjct:   90 ELYIDESKESYKTLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLESIVQTLGI-----TANVT-ESQRPQCNDEVCTR 201          
BLAST of SMED30033554 vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:549974])

HSP 1 Score: 63.929 bits (154), Expect = 1.206e-11
Identity = 40/115 (34.78%), Postives = 61/115 (53.04%), Query Frame = -2
Query:  107 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNADAT-GNTPAVECNDD 439
            ELY+D  K+SY  LGFK+YS + V+ A      R  +++A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++ I+  L I      A+ T    P   CN +
Sbjct:   90 ELYIDESKESYKTLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLESIVQTLGI-----TANVTESQRPQFLCNAE 199          
BLAST of SMED30033554 vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:549974])

HSP 1 Score: 62.7734 bits (151), Expect = 2.392e-11
Identity = 35/93 (37.63%), Postives = 54/93 (58.06%), Query Frame = -2
Query:  170 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKI 439
            ELY+D  K+SY  LGFK+YS + V+ A      R  +++A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++ I+  L I
Sbjct:   81 ELYIDESKESYKTLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLESIVQTLGI 173          
BLAST of SMED30033554 vs. Ensembl Mouse
Match: Prxl2b (peroxiredoxin like 2B [Source:MGI Symbol;Acc:MGI:1913719])

HSP 1 Score: 73.1738 bits (178), Expect = 5.225e-15
Identity = 41/118 (34.75%), Postives = 68/118 (57.63%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R   S+A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++   ++IL AL I     +A+   + P  +C++++C R
Sbjct:   90 ELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFIQKSPGDYVPQENILQALGI-----SAEVCSSKPP-QCDEEVCGR 201          
BLAST of SMED30033554 vs. Ensembl Mouse
Match: Prxl2b (peroxiredoxin like 2B [Source:MGI Symbol;Acc:MGI:1913719])

HSP 1 Score: 55.4546 bits (132), Expect = 1.929e-9
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = -2
Query:  245 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R   S+A+  G  GN+ GD  Q+GG LVV +GGS
Sbjct:   46 ELYLDESKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQSGGLLVVSKGGS 112          
BLAST of SMED30033554 vs. UniProt/SwissProt
Match: sp|B5X9L9|PXL2B_SALSA (Prostamide/prostaglandin F synthase OS=Salmo salar OX=8030 GN=prxl2b PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 7.316e-16
Identity = 45/118 (38.14%), Postives = 69/118 (58.47%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            +LY+D  K+ Y +LGFK+Y+ + V+ A      R+  ++A+  G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++DI  AL I     N  A G  P  +CNDD+CTR
Sbjct:   89 DLYIDEKKQCYKDLGFKRYTALSVVPAALGKKIREVTTKAKAQGIQGNFTGDLLQSGGMLIVAKGGEKVLLHFVQDSPGDYVPLEDISKALDISA---NVQA-GERP--QCNDDVCTR 200          
BLAST of SMED30033554 vs. UniProt/SwissProt
Match: sp|Q6AZG8|PXL2B_XENLA (Prostamide/prostaglandin F synthase OS=Xenopus laevis OX=8355 GN=prxl2b PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 3.561e-15
Identity = 44/118 (37.29%), Postives = 68/118 (57.63%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+SY +LGFK+YS + V+ A      R  +++A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++ I+  L I      A+ T  +   +CNDD+CTR
Sbjct:   90 ELYIDDSKQSYKDLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLETIVQTLGI-----TANVT-ESQRPQCNDDVCTR 201          
BLAST of SMED30033554 vs. UniProt/SwissProt
Match: sp|C1C416|PXL2B_LITCT (Prostamide/prostaglandin F synthase OS=Lithobates catesbeianus OX=8400 GN=prxl2b PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.288e-15
Identity = 44/118 (37.29%), Postives = 68/118 (57.63%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+SY  LGFK+Y+ + ++ A      R  +++A   G  GN  GD  Q+GG LVV +GG   L  + Q++  +   +D +++AL I      AD T ++   ECND++CTR
Sbjct:   90 ELYLDESKQSYKELGFKRYNALSIVPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLVVSKGGEKALLHFVQDSPGDFVPLDTLVTALGI-----TADVT-SSQRPECNDEVCTR 201          
BLAST of SMED30033554 vs. UniProt/SwissProt
Match: sp|Q28IJ3|PXL2B_XENTR (Prostamide/prostaglandin F synthase OS=Xenopus tropicalis OX=8364 GN=prxl2b PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.202e-14
Identity = 43/118 (36.44%), Postives = 67/118 (56.78%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+SY  LGFK+YS + V+ A      R  +++A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  ++  ++ I+  L I      A+ T  +   +CND++CTR
Sbjct:   90 ELYIDESKESYKTLGFKRYSALSVIPAALGKKVRDIVTKANADGVQGNFSGDLLQSGGMLIVSKGGEKVLLHFIQDSPGDYVPLESIVQTLGI-----TANVT-ESQRPQCNDEVCTR 201          
BLAST of SMED30033554 vs. UniProt/SwissProt
Match: sp|Q58CY6|PXL2B_BOVIN (Prostamide/prostaglandin F synthase OS=Bos taurus OX=9913 GN=PRXL2B PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.544e-14
Identity = 40/118 (33.90%), Postives = 67/118 (56.78%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ELY+D  K+ Y  LGFK+Y+ + ++ A      R+  ++A+  G  GN+ GD  Q+GG LVV +GG  VL  + Q++  ++A ++ IL AL I          G +   +C+++ C+R
Sbjct:   90 ELYLDESKQFYKELGFKRYNSLSILPAALGKPVREVAAKAKAVGIQGNLSGDLLQSGGLLVVAKGGDKVLLHFVQKSPGDYAPLESILQALGISAE------VGPSELPQCDEEACSR 201          
BLAST of SMED30033554 vs. TrEMBL
Match: A0A1S3HKN5 (prostamide/prostaglandin F synthase OS=Lingula unguis OX=7574 GN=LOC106156095 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 6.357e-22
Identity = 44/119 (36.97%), Postives = 73/119 (61.34%), Query Frame = -2
Query:   92 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEAR--TFGGNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTRK 439
            E+Y+D  ++ Y ++G+K+Y  +  + ++    SR +M++A+     G+ KGDG+QNGGT++V  GGS  L +++QEN  EH  ++D+L AL ID      +     P V C DD+C +K
Sbjct:   23 EVYIDQKQQCYKDMGYKRYGILSGLMSILKKVSRAAMAKAKEQNITGDFKGDGFQNGGTIIVSAGGSECLLNWRQENPGEHVPLEDVLKALGIDGGAPATEQKAEAPKVVCEDDVCYKK 141          
BLAST of SMED30033554 vs. TrEMBL
Match: A0A0B4U9E0 (Prostaglandin F synthase OS=Scylla olivacea OX=85551 GN=PGFS PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 6.292e-21
Identity = 51/116 (43.97%), Postives = 74/116 (63.79%), Query Frame = -2
Query:  101 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTF--GGNMKGDGYQNGGTLVV-DQGGSVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDIC 439
            ELY+D DKKS+ +L FKK  F+ ++ A+ +  +R ++ + + +  GG+MKGDG+QNGG LVV  +G  VLF +KQ+N A+HA   DIL AL I+      DAT    +V+  D  C
Sbjct:   46 ELYIDTDKKSFKDLNFKKLGFLNMVPALIAKVARDAVRKGKAWKVGGDMKGDGFQNGGLLVVAPKGEKVLFEFKQDNPADHADNSDILQALSIEVPTDLKDATAVDESVKVTDQEC 161          
BLAST of SMED30033554 vs. TrEMBL
Match: E9HJS9 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_231765 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 8.554e-20
Identity = 48/124 (38.71%), Postives = 79/124 (63.71%), Query Frame = -2
Query:   92 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQ--SMSEARTFGGNMKGDGYQNGGTLVVDQGGSVLFSYKQENVAEHASIDDILSALKIDKSELNADAT------GNTPAVECNDDICTRK 439
            ELY+D  KKS+ +LG++++S   + G + S  +R   ++ + R  GG+++GDG+QNGG +VV +GG +L+S+ QEN A+HA  +DIL AL +    L+  +T        +PA  C+ D+C+ K
Sbjct:   46 ELYIDEKKKSFNDLGYQRFSIWSLPGLLLSRIARNQTALGKERGVGGDLRGDGFQNGGLIVVGKGGKLLYSFVQENPADHAKNEDILKALNLSGLMLDNRSTDEQRPAAASPA-SCDQDVCSLK 168          
BLAST of SMED30033554 vs. TrEMBL
Match: A0A1D2N7E3 (Prostamide/prostaglandin F synthase OS=Orchesella cincta OX=48709 GN=Ocin01_05519 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.356e-19
Identity = 43/100 (43.00%), Postives = 69/100 (69.00%), Query Frame = -2
Query:  149 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEAR--TFGGNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNA 439
            +LYVD+DKK+Y ++G+K++  +GV+ ++F  A+R  +++ R      N+KGDG QNGGTLV+ +GG+ VL  Y+Q+N A+H  + +IL  L I   E N+
Sbjct:  138 DLYVDVDKKTYKDIGYKRFGTIGVLMSLFGKAARDRIAQNRQENLPSNLKGDGLQNGGTLVIAKGGAKVLLDYRQDNPADHIELSEILKVLNIPNPESNS 237          
BLAST of SMED30033554 vs. TrEMBL
Match: A0A5N5TKP4 (Prostamide/prostaglandin F synthase OS=Armadillidium nasatum OX=96803 GN=Anas_06143 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.703e-17
Identity = 42/119 (35.29%), Postives = 79/119 (66.39%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECND-DICTR 439
            ELY+D+ KKSY  + F KY+++ ++  + +  +R +  ++++ G  GN++GDG+Q GG +VVD+ G  +LF ++Q N A++ S +DIL AL +D + +    + +T  ++C+D D C++
Sbjct:   88 ELYLDLGKKSYTAMKFHKYNYVTIVPTLIAKVARDAYKKSKSVGIKGNLEGDGFQTGGLIVVDKNGEKILFEFRQNNPADNPSNEDILKALNLDSTNVPKLESKDTADLQCDDEDACSK 206          
BLAST of SMED30033554 vs. Ensembl Cavefish
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:103027709])

HSP 1 Score: 77.0258 bits (188), Expect = 1.715e-16
Identity = 45/118 (38.14%), Postives = 66/118 (55.93%), Query Frame = -2
Query:   95 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 439
            ++Y+D  K+ Y +LGFK+Y+ + V+ A      R+  S+A   G  GN  GD  Q+GG L+V +GG  VL  + Q+   +H  ++DI  AL I  S       G  P  +CNDD+CTR
Sbjct:   90 DIYIDEKKQCYKDLGFKRYNAINVVPAALGKKVREISSKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQDTPGDHVPLEDITKALGISASV----QAGVRP--QCNDDVCTR 201          
BLAST of SMED30033554 vs. Ensembl Sea Lamprey
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:406605])

HSP 1 Score: 59.3066 bits (142), Expect = 6.477e-11
Identity = 33/110 (30.00%), Postives = 58/110 (52.73%), Query Frame = -2
Query:  119 ELYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVE 439
            +L++D  K+ Y +LGFK+Y+ + ++        R  +++A   G  GN+ GD  Q GG L+V  GG  VL  ++Q++  +   ++ +L  L   +SE  A      P V+
Sbjct:   94 DLFIDDKKQCYNDLGFKRYNALSIIPVALGKKVRDIVAKAVEDGVSGNLSGDLLQTGGCLIVSAGGEKVLLCFRQDSPGDFVPVETVLEVLGF-QSEPKAQENAPQPEVQ 202          
BLAST of SMED30033554 vs. Ensembl Nematostella
Match: EDO33426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSB0])

HSP 1 Score: 63.929 bits (154), Expect = 4.709e-13
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = -2
Query:   98 SMSEARTFGGNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICT 334
            S S A+   GNMKGDG Q GG L+V QGG  +L S++Q +  +H +   IL+AL I ++   A  +   PA+EC++D C+
Sbjct:   10 SKSNAKGIKGNMKGDGMQTGGMLIVTQGGDKILLSHQQSSPGDHVANATILNALGISEASGGAGPSAQ-PAMECSEDACS 88          
BLAST of SMED30033554 vs. Ensembl Medaka
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:101173382])

HSP 1 Score: 72.7886 bits (177), Expect = 6.024e-15
Identity = 45/117 (38.46%), Postives = 63/117 (53.85%), Query Frame = -2
Query:   95 LYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGG-SVLFSYKQENVAEHASIDDILSALKIDKSELNADATGNTPAVECNDDICTR 436
            +YVD  K+ Y +LGFK+Y+ + V+ A      R   S+A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  +   ++DI  AL I  S       G  P   CNDD+CTR
Sbjct:   91 IYVDDQKRCYKDLGFKRYTAISVVPAALGKKVRDISSKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQDSPGDLVPLEDISKALGITASV----KAGQKPV--CNDDVCTR 201          
BLAST of SMED30033554 vs. Ensembl Medaka
Match: prxl2b (peroxiredoxin like 2B [Source:NCBI gene;Acc:101173382])

HSP 1 Score: 59.6918 bits (143), Expect = 5.973e-10
Identity = 36/95 (37.89%), Postives = 53/95 (55.79%), Query Frame = -2
Query:  161 LYVDIDKKSYANLGFKKYSFMGVMGAVFSSASRQSMSEARTFG--GNMKGDGYQNGGTLVVDQGGS-VLFSYKQENVAEHASIDDILSALKIDKS 436
            +YVD  K+ Y +LGFK+Y+ + V+ A      R   S+A   G  GN  GD  Q+GG L+V +GG  VL  + Q++  +   ++DI  AL I  S
Sbjct:   91 IYVDDQKRCYKDLGFKRYTAISVVPAALGKKVRDISSKASAEGIQGNFSGDLLQSGGMLIVAKGGEKVLLHFIQDSPGDLVPLEDISKALGITAS 185          
The following BLAST results are available for this feature:
BLAST of SMED30033554 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRXL2B1.719e-1132.17peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC... [more]
PRXL2B3.498e-1132.17peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC... [more]
PRXL2B2.367e-727.82peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC... [more]
PRXL2B2.367e-727.82peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC... [more]
PRXL2B6.889e-739.06peroxiredoxin like 2B [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033554 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033554 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prxl2b1.015e-1437.29peroxiredoxin like 2B [Source:NCBI gene;Acc:406605... [more]
prxl2b1.973e-1036.56peroxiredoxin like 2B [Source:NCBI gene;Acc:406605... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
prxl2b2.268e-1536.44peroxiredoxin like 2B [Source:NCBI gene;Acc:549974... [more]
prxl2b1.206e-1134.78peroxiredoxin like 2B [Source:NCBI gene;Acc:549974... [more]
prxl2b2.392e-1137.63peroxiredoxin like 2B [Source:NCBI gene;Acc:549974... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Prxl2b5.225e-1534.75peroxiredoxin like 2B [Source:MGI Symbol;Acc:MGI:1... [more]
Prxl2b1.929e-943.28peroxiredoxin like 2B [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of SMED30033554 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B5X9L9|PXL2B_SALSA7.316e-1638.14Prostamide/prostaglandin F synthase OS=Salmo salar... [more]
sp|Q6AZG8|PXL2B_XENLA3.561e-1537.29Prostamide/prostaglandin F synthase OS=Xenopus lae... [more]
sp|C1C416|PXL2B_LITCT8.288e-1537.29Prostamide/prostaglandin F synthase OS=Lithobates ... [more]
sp|Q28IJ3|PXL2B_XENTR1.202e-1436.44Prostamide/prostaglandin F synthase OS=Xenopus tro... [more]
sp|Q58CY6|PXL2B_BOVIN1.544e-1433.90Prostamide/prostaglandin F synthase OS=Bos taurus ... [more]
back to top
BLAST of SMED30033554 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HKN56.357e-2236.97prostamide/prostaglandin F synthase OS=Lingula ung... [more]
A0A0B4U9E06.292e-2143.97Prostaglandin F synthase OS=Scylla olivacea OX=855... [more]
E9HJS98.554e-2038.71Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
A0A1D2N7E39.356e-1943.00Prostamide/prostaglandin F synthase OS=Orchesella ... [more]
A0A5N5TKP41.703e-1735.29Prostamide/prostaglandin F synthase OS=Armadillidi... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prxl2b1.715e-1638.14peroxiredoxin like 2B [Source:NCBI gene;Acc:103027... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prxl2b6.477e-1130.00peroxiredoxin like 2B [Source:NCBI gene;Acc:406605... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033554 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO334264.709e-1342.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30033554 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prxl2b6.024e-1538.46peroxiredoxin like 2B [Source:NCBI gene;Acc:101173... [more]
prxl2b5.973e-1037.89peroxiredoxin like 2B [Source:NCBI gene;Acc:101173... [more]
back to top
BLAST of SMED30033554 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033554 ID=SMED30033554|Name=SMED30033554|organism=Schmidtea mediterranea sexual|type=transcript|length=884bp
GAAATGCACGAATCTCAATAGCTTCATCGCCTATTCAGGTCGGGAACCTT
TGTAATGAGCGAATCATAGATGAGAAGCGAGCAATCCATTATTTCCTTGT
GCAAATGTCATCATTGCATTCAACCGCAGGAGTATTTCCTGTTGCATCCG
CATTCAACTCGGATTTATCGATTTTCAACGCGCTCAGAATGTCATCGATA
CTAGCGTGCTCAGCAACATTTTCTTGTTTGTAACTGAAGAGAACAGAACC
ACCCTGATCGACAACGAGAGTGCCGCCATTCTGGTATCCGTCACCTTTCA
TGTTACCACCGAACGTGCGCGCCTCGGACATCGATTGCCGGGACGCACTC
GAGAAAACGGCTCCCATCACCCCCATGAAAGAATATTTCTTGAATCCGAG
ATTTGCGTACGATTTTTTGTCAATGTCGACATAGAGCTCTAAAACGGTTC
GATTGATAATCAATTCGATAAATTTTGAATAATTTTCCCCAAAAGCGCTA
TTTTAAAATTCCTGTAACTTGATTGGACCATTATAAATTCATAACTGAGG
CAAGATACATAAATAGAATTCACGATTTCTTTGCATGTTGATAATTTTTA
GCTATTTGTATCAATGTTGTTCAATTACATTGAATTCTAAAAAGGAACAA
AACATCTCTCGTGGAAATATATTCTCCTACATTTTATGTTTGAGCAGTGG
AGTATCCATATACCATCACACAATACCTTTGCTTTTATATATTAATTGCA
ATAATTATATATAAAATATAATTTTAGGCAATAACTTGAGCATCACAGTT
CAACATTAATTGACAAAATATAAATTATCAGCAAAAGTGAAATAATAATC
CATATATTACCTCCATTGAAATATTGACCAGCTA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: INTERPRO
TermDefinition
IPR032801PXL2A/B/C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032801Peroxiredoxin-like 2A/B/CPANTHERPTHR28630FAMILY NOT NAMEDcoord: 2..93
NoneNo IPR availablePANTHERPTHR28630:SF7PROSTAMIDE/PROSTAGLANDIN F SYNTHASEcoord: 2..93