Phosphotransferase

Overview
NamePhosphotransferase
Smed IDSMED30033551
Length (bp)1533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphotransferase (SMED30033551) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphotransferase (SMED30033551) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphotransferase (SMED30033551) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphotransferase (SMED30033551) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033551

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033551SMESG000043559.1 SmedASXL_008243SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033551SMESG000043559.1 dd_Smed_v6_4327_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033551SMESG000043559.1 dd_Smed_v4_4327_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphotransferase vs. Ensembl Human
Match: HK2 (hexokinase 2 [Source:HGNC Symbol;Acc:HGNC:4923])

HSP 1 Score: 377.096 bits (967), Expect = 5.978e-121
Identity = 208/444 (46.85%), Postives = 287/444 (64.64%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE   L  D   +V   ++  M +GL+  TH +A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K   +E     YAIP + M G G ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI+     D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD FRTE+D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  VA RAA   G+G+A +++RI +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  446 LEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE---GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAIL--QHLGLESTCD-DSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFL--QSEDGSGKGAALITAVA 880          

HSP 2 Score: 338.191 bits (866), Expect = 4.259e-106
Identity = 184/431 (42.69%), Postives = 266/431 (61.72%), Query Frame = 2
Query:  119 QVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            ++     + M KGL   TH TA+VKM P++V   P G E G+FLALDLGGTN+RVL V +  N   K ++    YAIP D M G G +LFD+IA+ L +F+    +    + LGFTFSFPC Q  L+ + LV WTKGF ++  EG +V  L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G++   L   G F TK +S++E +   +      ++   L+       D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L    D++F+   SEDGSGKGAA + A++
Sbjct:   10 EISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQ---EDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFL--RSEDGSGKGAAMVTAVA 432          
BLAST of Phosphotransferase vs. Ensembl Human
Match: HK2 (hexokinase 2 [Source:HGNC Symbol;Acc:HGNC:4923])

HSP 1 Score: 377.096 bits (967), Expect = 1.287e-120
Identity = 208/444 (46.85%), Postives = 287/444 (64.64%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE   L  D   +V   ++  M +GL+  TH +A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K   +E     YAIP + M G G ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI+     D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD FRTE+D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  VA RAA   G+G+A +++RI +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  474 LEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE---GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAIL--QHLGLESTCD-DSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFL--QSEDGSGKGAALITAVA 908          

HSP 2 Score: 340.502 bits (872), Expect = 1.058e-106
Identity = 191/448 (42.63%), Postives = 272/448 (60.71%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            KVD Y   M L +E+           M KGL   TH TA+VKM P++V   P G E G+FLALDLGGTN+RVL V +  N   K ++    YAIP D M G G +LFD+IA+ L +F+    +    + LGFTFSFPC Q  L+ + LV WTKGF ++  EG +V  L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G++   L   G F TK +S++E +   +      ++   L+       D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L    D++F+   SEDGSGKGAA + A++
Sbjct:   21 KVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQ---EDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFL--RSEDGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 367.466 bits (942), Expect = 5.828e-117
Identity = 202/449 (44.99%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E L  F L  D   +V   +   M  GL   TH+ A VKM PS+V + P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   L+ WTKGF ATDC G +V  LL+ AI      D+  VAVVNDTVGT+ +CA ++  C VG+IVGTG+NA Y+E++  VE   GD+  +    INMEWGAFG++GCLD  RT YD  +DE SL+  +Q +EKM SGMYLGE+VR IL+D   K  LFRG++ ++L+T G F TK+LS++E D   L      +    LN       D+ +V+ VC  V+ RAA   G+G+A ++++I      ++  +TVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQM---CINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC---DDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 321.627 bits (823), Expect = 1.471e-99
Identity = 178/448 (39.73%), Postives = 268/448 (59.82%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSL--KQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            K+D Y   M L +E+           M  GL+   + TA+VKM P++V  +P G E+G F+ALDLGG+++R+L V +  ++N    +    Y  P + + G G +LFD++A+ L DF++   +    + +GFTFSFPC Q  ++ A L+ WTK F A+  EG +V +LL +AI    + D   VAVVNDTVGT+ +C   D  C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMYLGELVR+ILV +  + LLF G +   L T G F+T  +S +E++   L      +    L V   +D D   V+ VC  V+ R+A  + + +  +LNR+       +   TVG+DGSL+K H ++  R    + +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   21 KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 367.466 bits (942), Expect = 7.137e-117
Identity = 202/449 (44.99%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E L  F L  D   +V   +   M  GL   TH+ A VKM PS+V + P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   L+ WTKGF ATDC G +V  LL+ AI      D+  VAVVNDTVGT+ +CA ++  C VG+IVGTG+NA Y+E++  VE   GD+  +    INMEWGAFG++GCLD  RT YD  +DE SL+  +Q +EKM SGMYLGE+VR IL+D   K  LFRG++ ++L+T G F TK+LS++E D   L      +    LN       D+ +V+ VC  V+ RAA   G+G+A ++++I      ++  +TVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  472 RQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQM---CINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC---DDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFL--LSEDGSGKGAALITAV 911          

HSP 2 Score: 320.857 bits (821), Expect = 3.771e-99
Identity = 173/430 (40.23%), Postives = 262/430 (60.93%), Query Frame = 2
Query:  122 VMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSL--KQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            +M    + M  GL+   + TA+VKM P++V  +P G E+G F+ALDLGG+++R+L V +  ++N    +    Y  P + + G G +LFD++A+ L DF++   +    + +GFTFSFPC Q  ++ A L+ WTK F A+  EG +V +LL +AI    + D   VAVVNDTVGT+ +C   D  C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMYLGELVR+ILV +  + LLF G +   L T G F+T  +S +E++   L      +    L V   +D D   V+ VC  V+ R+A  + + +  +LNR+       +   TVG+DGSL+K H ++  R    + +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   43 IMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 464          
BLAST of Phosphotransferase vs. Ensembl Human
Match: HK1 (hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922])

HSP 1 Score: 367.466 bits (942), Expect = 7.137e-117
Identity = 202/449 (44.99%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E L  F L  D   +V   +   M  GL   TH+ A VKM PS+V + P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   L+ WTKGF ATDC G +V  LL+ AI      D+  VAVVNDTVGT+ +CA ++  C VG+IVGTG+NA Y+E++  VE   GD+  +    INMEWGAFG++GCLD  RT YD  +DE SL+  +Q +EKM SGMYLGE+VR IL+D   K  LFRG++ ++L+T G F TK+LS++E D   L      +    LN       D+ +V+ VC  V+ RAA   G+G+A ++++I      ++  +TVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  472 RQIEETLAHFHLTKDMLLEVKKRMRAEMELGLRKQTHNNAVVKMLPSFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQM---CINMEWGAFGDNGCLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC---DDSILVKTVCGVVSRRAAQLCGAGMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFL--LSEDGSGKGAALITAV 911          

HSP 2 Score: 320.857 bits (821), Expect = 3.771e-99
Identity = 173/430 (40.23%), Postives = 262/430 (60.93%), Query Frame = 2
Query:  122 VMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSL--KQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            +M    + M  GL+   + TA+VKM P++V  +P G E+G F+ALDLGG+++R+L V +  ++N    +    Y  P + + G G +LFD++A+ L DF++   +    + +GFTFSFPC Q  ++ A L+ WTK F A+  EG +V +LL +AI    + D   VAVVNDTVGT+ +C   D  C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMYLGELVR+ILV +  + LLF G +   L T G F+T  +S +E++   L      +    L V   +D D   V+ VC  V+ R+A  + + +  +LNR+       +   TVG+DGSL+K H ++  R    + +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   43 IMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTR--LGVEPSDD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKTHPQYSRRFHKTLRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 464          
BLAST of Phosphotransferase vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 375.555 bits (963), Expect = 2.379e-125
Identity = 202/451 (44.79%), Postives = 290/451 (64.30%), Query Frame = 2
Query:   62 PKEVV-EILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTV-DKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIG--DKTGL--DYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVE----RDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            PK+++ E  +   L     R++M  +E+SM +GLA +T   A VKM P+YV  +P G E G FLALDLGGTN+RVL + L Q  + K+    + +P   M G G+ LFD+IA  +  F+  + + D   + LGFTFSFPC Q GL   KLV WTKGF A+  EG +V  LL +A +   ++D+  VA++NDTVGTL +CA Q+  C +GVIVGTGTNA Y+E++D++    G  D+ G+  + ++IN EWGAFG+DG LD  RTE+D  +D +S++P Q ++EKM SGMY+GE  R++L DL  + LLF G    ++  P  F TK++SE++     D    F  T+ +L ED+ V      D A V  VC  ++TRAA+   +GIA LLNR+NKK +TVG+DGS+++FH  +P  +   + +L   DI++ L LSEDGSG+GAA +AA++
Sbjct:   35 PKDLIQEACQRLVLSDQQLRRIMQSMEKSMEQGLATSTKKVA-VKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKL-QGKETKMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGVTPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQIL-EDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAAVA 481          
BLAST of Phosphotransferase vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 375.555 bits (963), Expect = 2.379e-125
Identity = 202/451 (44.79%), Postives = 290/451 (64.30%), Query Frame = 2
Query:   62 PKEVV-EILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTV-DKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIG--DKTGL--DYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVE----RDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            PK+++ E  +   L     R++M  +E+SM +GLA +T   A VKM P+YV  +P G E G FLALDLGGTN+RVL + L Q  + K+    + +P   M G G+ LFD+IA  +  F+  + + D   + LGFTFSFPC Q GL   KLV WTKGF A+  EG +V  LL +A +   ++D+  VA++NDTVGTL +CA Q+  C +GVIVGTGTNA Y+E++D++    G  D+ G+  + ++IN EWGAFG+DG LD  RTE+D  +D +S++P Q ++EKM SGMY+GE  R++L DL  + LLF G    ++  P  F TK++SE++     D    F  T+ +L ED+ V      D A V  VC  ++TRAA+   +GIA LLNR+NKK +TVG+DGS+++FH  +P  +   + +L   DI++ L LSEDGSG+GAA +AA++
Sbjct:   35 PKDLIQEACQRLVLSDQQLRRIMQSMEKSMEQGLATSTKKVA-VKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKL-QGKETKMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGVTPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQIL-EDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAAVA 481          
BLAST of Phosphotransferase vs. Ensembl Celegans
Match: hxk-1 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q19440])

HSP 1 Score: 374.785 bits (961), Expect = 4.339e-125
Identity = 198/432 (45.83%), Postives = 282/432 (65.28%), Query Frame = 2
Query:  116 RQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTV-DKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIG--DKTGL--DYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVE----RDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            R++M  +E+SM +GLA +T   A VKM P+YV  +P G E G FLALDLGGTN+RVL + L Q  + K+    + +P   M G G+ LFD+IA  +  F+  + + D   + LGFTFSFPC Q GL   KLV WTKGF A+  EG +V  LL +A +   ++D+  VA++NDTVGTL +CA Q+  C +GVIVGTGTNA Y+E++D++    G  D+ G+  + ++IN EWGAFG+DG LD  RTE+D  +D +S++P Q ++EKM SGMY+GE  R++L DL  + LLF G    ++  P  F TK++SE++     D    F  T+ +L ED+ V      D A V  VC  ++TRAA+   +GIA LLNR+NKK +TVG+DGS+++FH  +P  +   + +L   DI++ L LSEDGSG+GAA +AA++
Sbjct:   49 RRIMQSMEKSMEQGLATSTKKVA-VKMLPTYVDSVPNGTESGDFLALDLGGTNFRVLHIKL-QGKETKMTGKIFRVPESIMRGTGEALFDHIAGCMAKFMGENDLKDAQKLPLGFTFSFPCEQEGLTKGKLVTWTKGFKASGVEGVDVVTLLHEACHRRKDIDIDVVALLNDTVGTLMACAFQENSCQIGVIVGTGTNACYMERLDRIPKLAGYVDEHGVTPEEMIINTEWGAFGDDGALDFLRTEWDEVVDRESINPGQHLYEKMISGMYMGECARVVLEDLAKQGLLFGGN-SDAISVPHCFPTKFVSEIDSDLLEDDDRTFQKTYQIL-EDIGVEMITANDCANVAYVCSLISTRAAHLTAAGIAMLLNRMNKKHVTVGVDGSVYRFHPTYPTLLDAKIGELIVGDIEYKLMLSEDGSGRGAALVAAVA 476          
BLAST of Phosphotransferase vs. Ensembl Celegans
Match: hxk-2 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q9XU15])

HSP 1 Score: 305.064 bits (780), Expect = 3.246e-97
Identity = 174/455 (38.24%), Postives = 273/455 (60.00%), Query Frame = 2
Query:   41 VKMPNRLPKEVVE---ILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAI-NNLNLDVKCVAVVNDTVGTLTSCALQ-DCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDY----VVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAAL 1378
             KM ++L +E +    ++  F L     R++M  L ++M++GL     + +++ M PS+V +LP GKE G+F+A+DLGGTN RV+L+ L+     +  +    +P   M G G++LFDYIA+ L DF+    +    + +GFTFS+PC Q GL +A L+RWTKG +AT C GE+V +LL+ AI  +  + V  VA++NDTVGT+ + A +    C +GVI+GTGTNASY+E   K+   + + T  DY    ++I+ EWG FG++G  D   T YD  +D +S HP     +K+ +GM +GELVR++L  L    +LF G   + L T  +F TKY+SE+  D   ++  T  +++E L +      D  ++R VC  V+ R+A    + IAC+LNR+ +  + V IDGS +K+H  F   + + + +L +  + F +  + DGSG+GAA IAA+
Sbjct:   34 AKMASKLNEESISLESVMAEFKLSNTTLRRMMSHLSDNMDRGLESGL-ERSTIAMLPSFVPELPNGKERGKFVAMDLGGTNLRVMLMELEPGEPMRTKQFNTRMPNAAMHGTGQKLFDYIAKALCDFLVERELADEHLPVGFTFSYPCDQTGLRSATLLRWTKGVTATGCVGEDVVQLLEDAIARDGRVKVNIVALINDTVGTMVAAAYEAGGHCDIGVIIGTGTNASYMEDSRKIVHGLANATE-DYNHKSMIIDTEWGGFGDNGEADYIFTRYDKIVDSKSDHPGVNSLDKLIAGMCMGELVRLVLERLCENKVLFNGIGSKMLRTRNTFPTKYISEILHDDCGVYSNTRQIMDE-LGIEGATFSDMLLLREVCVVVSRRSANLAAAAIACVLNRVRRPNMLVAIDGSTYKYHPFFNHWVCEKIRELLDPGLDFKIVQTGDGSGRGAALIAAI 485          
BLAST of Phosphotransferase vs. Ensembl Celegans
Match: hxk-3 (Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:U4PC09])

HSP 1 Score: 267.7 bits (683), Expect = 4.662e-84
Identity = 153/447 (34.23%), Postives = 255/447 (57.05%), Query Frame = 2
Query:   59 LPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADK-MCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAIN-NLNLDVKCVAVVNDTVGTLTSCALQ-DCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDY--VVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE 1384
            LP EV EIL  F L  +  +++   +E+ M  GLA      +S+ M PSYV  LP G E G+++A+DL G N R++L+++         ET   I A+  M G G +LF +I   LQ F++   +    + +GF FS+PC    + +A+L+ WTKGF   DC   ++  LL++A+  N++  V   AV+NDTVG L + A +   +C +GV++G G N+SY+EK  ++  F     G D+  +++  EW  FG+ G LD   T++D ++D  S+H  +Q+ +K+C  +Y+GE+VR +L  LV   +LF G+  + L+   SF TKY+SE+  +   +F     +  E+L V      D  I+R VC+ ++ R A  + + I+ LL  +    + +G+ G+L +FH  + + + + + +L    +KF L  +++GS +GAA IAA++E
Sbjct:    4 LPPEVEEILAKFRLNREQLQEISEKVEQQMKMGLA--KTQGSSIAMLPSYVPALPDGTETGKYVAIDLSGKNLRIMLLTMNGAGTTPTHETVNYIVANHVMKGTGDQLFTFIVNCLQRFLQEFGLVDANLPIGFVFSYPCELLSIRSARLLWWTKGFDIKDCLQRDIVALLEEALEMNMSTKVSIKAVMNDTVGQLAAAAHKYGPECTIGVVIGYGCNSSYLEKTSRITKFDAKARGYDHDNMIVVTEWEEFGKHGELDDILTQFDREVDAASVHKGKQLIDKLCGALYIGEVVRRVLSQLVLDRVLFEGQSCEKLDEDESFPTKYISEILGEEEGVFKACRRIC-EELEVEMHGTGDYIIIREVCDVISRRGASIVAAAISALLRHLELSSVKIGVGGALIQFHPTYHQMLKEKLEELTPITMKFELVPADEGSCQGAALIAAVAE 447          
BLAST of Phosphotransferase vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0333335)

HSP 1 Score: 384.03 bits (985), Expect = 3.571e-129
Identity = 196/438 (44.75%), Postives = 283/438 (64.61%), Query Frame = 2
Query:   71 VVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            V E+ +   L  +  +++ + +   + +GLA  TH  A+VK F +YV  LP G E G+FLALDLGGTN+RVLL+ L++N   ++    YAIP   M G G +LFD+IA+ L +F+  H V K  + LGFTFSFP  Q GL    L  WTKGF+      E+V +LL+ AI    ++ +   A++NDT GTL SCA ++  C +G+IVGTG NA Y+E++++ E F  +     +V+IN EWGAFG++G LD  RTE+D  +D  S++P +Q FEKM SGMY+GELVR++LV +    +LF G+  + L T G F TKY+SE+E D P  F     +L E+L + +  D D A VR +CE V+ RAA+ + +GIA L+N++++  +TVG+DGS+++FH KF   M + + QL    I F L LSEDGSG+GAA +AA++
Sbjct:    2 VHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENNDFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELFAAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVL-EELGLTNATDGDCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAVA 438          
BLAST of Phosphotransferase vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0071362)

HSP 1 Score: 384.03 bits (985), Expect = 3.571e-129
Identity = 196/438 (44.75%), Postives = 283/438 (64.61%), Query Frame = 2
Query:   71 VVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            V E+ +   L  +  +++ + +   + +GLA  TH  A+VK F +YV  LP G E G+FLALDLGGTN+RVLL+ L++N   ++    YAIP   M G G +LFD+IA+ L +F+  H V K  + LGFTFSFP  Q GL    L  WTKGF+      E+V +LL+ AI    ++ +   A++NDT GTL SCA ++  C +G+IVGTG NA Y+E++++ E F  +     +V+IN EWGAFG++G LD  RTE+D  +D  S++P +Q FEKM SGMY+GELVR++LV +    +LF G+  + L T G F TKY+SE+E D P  F     +L E+L + +  D D A VR +CE V+ RAA+ + +GIA L+N++++  +TVG+DGS+++FH KF   M + + QL    I F L LSEDGSG+GAA +AA++
Sbjct:    2 VHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENNDFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELFAAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVL-EELGLTNATDGDCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAVA 438          
BLAST of Phosphotransferase vs. Ensembl Fly
Match: Hex-A (gene:FBgn0001186 transcript:FBtr0071361)

HSP 1 Score: 385.956 bits (990), Expect = 1.234e-128
Identity = 197/440 (44.77%), Postives = 284/440 (64.55%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            K V E+ +   L  +  +++ + +   + +GLA  TH  A+VK F +YV  LP G E G+FLALDLGGTN+RVLL+ L++N   ++    YAIP   M G G +LFD+IA+ L +F+  H V K  + LGFTFSFP  Q GL    L  WTKGF+      E+V +LL+ AI    ++ +   A++NDT GTL SCA ++  C +G+IVGTG NA Y+E++++ E F  +     +V+IN EWGAFG++G LD  RTE+D  +D  S++P +Q FEKM SGMY+GELVR++LV +    +LF G+  + L T G F TKY+SE+E D P  F     +L E+L + +  D D A VR +CE V+ RAA+ + +GIA L+N++++  +TVG+DGS+++FH KF   M + + QL    I F L LSEDGSG+GAA +AA++
Sbjct:   93 KMVHELCQQLLLTDEQVQELCYRILHELRRGLAKDTHPKANVKCFVTYVQDLPNGNERGKFLALDLGGTNFRVLLIHLQENNDFQMESRIYAIPQHIMIGSGTQLFDHIAECLSNFMAEHNVYKERLPLGFTFSFPLRQLGLTKGLLETWTKGFNCAGVVNEDVVQLLKDAIARRGDVQIDVCAILNDTTGTLMSCAWKNHNCKIGLIVGTGANACYMERVEEAELFAAEDPRKKHVLINTEWGAFGDNGALDFVRTEFDRDIDVHSINPGKQTFEKMISGMYMGELVRLVLVKMTQAGILFNGQDSEVLNTRGLFFTKYVSEIEADEPGNFTNCRLVL-EELGLTNATDGDCANVRYICECVSKRAAHLVSAGIATLINKMDEPTVTVGVDGSVYRFHPKFHNLMVEKISQLIKPGITFDLMLSEDGSGRGAALVAAVA 531          
BLAST of Phosphotransferase vs. Ensembl Fly
Match: Hex-t2 (gene:FBgn0042710 transcript:FBtr0085011)

HSP 1 Score: 363.999 bits (933), Expect = 6.708e-121
Identity = 187/446 (41.93%), Postives = 281/446 (63.00%), Query Frame = 2
Query:   44 KMPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLD-YVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
            KMP+ +  E+   ++ F +  +   +V+  + + +  GLA  TH  A +K F S+V  LPTGKE G++LALDLGG+N+RVLLV+L  N   + +   Y  P   M G GK LFD++A+ L +F   H ++   + LGFTFSFP  Q GL+   LV WTKGFS     G+NV  LLQ+AI+   +L +  VA++NDTVGTL SCA     C +G+IVGTG+NA YVEK    E F G +T     ++IN EWGAFG++G L+  RT YD  +D+ + +P +Q FEK  SGMY+GELVR+++ D++ K  +F G + + ++   SF T Y+S+VE D P  +   + +L+E L +   ++ D   +R +CE V++R+A     G+  ++N++N  E+ +GIDGS+++FH K+ + +   + +L    +KF L +SEDGSG+GAA +AA
Sbjct:   33 KMPSLVNTEIEAAVKGFLIDQEKMTEVVERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLISNSDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQGLSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHPNCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPSMIINCEWGAFGDNGVLEFVRTSYDKAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAYISDVESDAPGEYRNCNKVLSE-LGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINKMNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAA 477          
BLAST of Phosphotransferase vs. Ensembl Fly
Match: Hex-C (gene:FBgn0001187 transcript:FBtr0087399)

HSP 1 Score: 359.762 bits (922), Expect = 1.153e-119
Identity = 199/449 (44.32%), Postives = 277/449 (61.69%), Query Frame = 2
Query:   59 LPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGD-KTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLF-----RGEVPQSLE-TPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            L  EV E+++PF L     ++V       + +GL  +TH  A+VK FP+YV  LPTG E G++LALDLGGTN+RVLLVSLK +    +    YA+P D M G G +LFD+IA  L  FV+ H +    + LGFTFSFPC Q GL    LVRWTKGF     EGE+V  +L +AI    + D+  VA++NDT GTL SCA ++  C VGVIVGTG NA YVE ++ V+    D K     V++N EWGAFGE G LD  RTEYD ++DE+SL+  +Q+FEKM +GMYLG LVR++L+  + + L+F     R E    L+     F T+Y+SE+E D    F  T  ++     +      D   +R +CE VA RAA  +  G++ L+NR + + + VG+DGS++++H KF   M   + +L   D ++ + LSEDGSG+GAA +AA++
Sbjct:    2 LDAEVRELMQPFVLSDYQVQEVYSRFCLEVARGLKRSTHPQANVKCFPTYVQDLPTGDEMGKYLALDLGGTNFRVLLVSLKGHHDATVDSQIYAVPKDLMVGPGVDLFDHIAGCLAKFVEKHDMKTAYLPLGFTFSFPCVQLGLKEGILVRWTKGFDCAGVEGEDVGRMLHEAIQRRGDADIAVVAILNDTTGTLMSCAHRNADCRVGVIVGTGCNACYVEDVENVDLLRADFKKTKRSVIVNAEWGAFGEGGQLDFVRTEYDREVDEKSLNRSEQLFEKMTAGMYLGNLVRLVLLRALERKLIFKQSSRRPEFASVLQRNEEVFETRYISEIEDDSFPEFASTRKIVKNLFGLEKASVEDCQTLRYICECVAKRAATLVAIGVSGLVNRTSNRRVIVGMDGSVYRYHPKFDAYMRQTLQKLVKADKEWDIMLSEDGSGRGAALVAAVA 450          
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 380.178 bits (975), Expect = 1.151e-122
Identity = 203/449 (45.21%), Postives = 288/449 (64.14%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E LE F L  D   +V   +   +  GL+ +T +TA+VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I      D+  VA+VNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  G++     + +NMEWGAFG++GCLD  RT+YD  +D+ SL+  +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  394 RQIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVSGEE---GRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVTFL--LSEDGSGKGAALITAV 833          

HSP 2 Score: 297.36 bits (760), Expect = 3.344e-91
Identity = 165/391 (42.20%), Postives = 238/391 (60.87%), Query Frame = 2
Query:  233 EEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT-YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAA 1375
            E+G F+ALDLGG+N+R+L V +    K  + +E+  Y  P D + G G  LFD++A+ L DF++   +    + +GFTFSFPCSQ  L+ A L+ WTK F     EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G   TK++S +E+    L      +    L V   ED D   V+ VC  V+ R+A  I + +  +L R+       +   TVGIDGSL+K H ++  R+   V +L  E D++F+  LSE GSGKGAA + A
Sbjct:    2 EKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVEGDE---GRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLVPESDVRFL--LSESGSGKGAALVTA 384          
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 379.793 bits (974), Expect = 7.081e-122
Identity = 203/449 (45.21%), Postives = 288/449 (64.14%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E LE F L  D   +V   +   +  GL+ +T +TA+VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I      D+  VA+VNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  G++     + +NMEWGAFG++GCLD  RT+YD  +D+ SL+  +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVSGEE---GRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVTFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 330.872 bits (847), Expect = 3.417e-103
Identity = 181/430 (42.09%), Postives = 260/430 (60.47%), Query Frame = 2
Query:  116 RQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT-YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAA 1375
            R +M      M  GLA  T+ TA+VKM P++V  +P G E+G F+ALDLGG+N+R+L V +    K  + +E+  Y  P D + G G  LFD++A+ L DF++   +    + +GFTFSFPCSQ  L+ A L+ WTK F     EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G   TK++S +E+    L      +    L V   ED D   V+ VC  V+ R+A  I + +  +L R+       +   TVGIDGSL+K H ++  R+   V +L  E D++F+  LSE GSGKGAA + A
Sbjct:   37 RDIMARFRREMENGLARDTNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVEGDE---GRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLVPESDVRFL--LSESGSGKGAALVTA 458          
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Match: hk1 (hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848])

HSP 1 Score: 379.793 bits (974), Expect = 7.081e-122
Identity = 203/449 (45.21%), Postives = 288/449 (64.14%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E LE F L  D   +V   +   +  GL+ +T +TA+VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I      D+  VA+VNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  G++     + +NMEWGAFG++GCLD  RT+YD  +D+ SL+  +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   M   V +L  + ++ F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIAETLEEFRLTKDQLLEVKKRMRTEIQNGLSKSTQNTATVKMLPTYVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIEVMQGTGEELFDHIVYCISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGLLVNWTKGFKATDCEGEDVVGLLREGIKRREEFDLDVVAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVSGEE---GRMCVNMEWGAFGDNGCLDDIRTKYDDAVDDLSLNAGKQKYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCNVTFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 330.872 bits (847), Expect = 3.417e-103
Identity = 181/430 (42.09%), Postives = 260/430 (60.47%), Query Frame = 2
Query:  116 RQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT-YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAA 1375
            R +M      M  GLA  T+ TA+VKM P++V  +P G E+G F+ALDLGG+N+R+L V +    K  + +E+  Y  P D + G G  LFD++A+ L DF++   +    + +GFTFSFPCSQ  L+ A L+ WTK F     EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G   TK++S +E+    L      +    L V   ED D   V+ VC  V+ R+A  I + +  +L R+       +   TVGIDGSL+K H ++  R+   V +L  E D++F+  LSE GSGKGAA + A
Sbjct:   37 RDIMARFRREMENGLARDTNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCSQSKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHMDMVEGDE---GRMCINTEWGAFGDDGTLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTR--LGVEPSED-DCIAVQHVCAIVSFRSANLIAATLGAILTRLKDNKNTPRLRTTVGIDGSLYKMHPQYARRLHKTVRRLVPESDVRFL--LSESGSGKGAALVTA 458          
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 368.237 bits (944), Expect = 2.380e-117
Identity = 196/450 (43.56%), Postives = 285/450 (63.33%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP--KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLK-NEDIKFVLKLSEDGSGKGAAAIAALSE 1384
            KE+ + L  F L     ++V   +   + +GL   TH TASVKM P+YV + P G E G++LALDLGGTN+RVL+V ++   +   ++    YAIP + M G G+ELFD+I Q + DF+    +    + LGFTFSFPC+Q G++   LV WTKGF ATDCEG +V ++L++AI   N  D+  VA+VNDTVGT+ +CA +D KC +G+I GTG+N  Y+E++  +E   GD+  +    +N EWG FGE+  ++  RT YD ++D  SL+  +Q FEKM SGMYLGE+VR IL+DL  +  LFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I      ++ +ITVG+DG+L+K H  F   + + V +L  N  + F+  LSEDGSGKGAA I A++ 
Sbjct:  468 KEIDDTLAAFALTSTQLQEVKQKMHVELERGLKKETHPTASVKMLPTYVYRTPDGTERGKYLALDLGGTNFRVLVVKIRTGMRNSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCNQTGIDKGDLVCWTKGFKATDCEGYDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMMTCAYEDPKCQIGLIAGTGSNVCYMEEMKNIEIVEGDEGQM---CVNTEWGGFGENDNIEDIRTRYDREVDSGSLNAGKQRFEKMTSGMYLGEIVRQILIDLTKRGFLFRGRITERLKTKGIFETKFLSQIESDRLALLQVRCIL--QSLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDRLDITVGVDGTLYKLHPHFSTILKETVRELAPNCKVDFI--LSEDGSGKGAALITAVAR 909          

HSP 2 Score: 318.161 bits (814), Expect = 2.325e-98
Identity = 180/450 (40.00%), Postives = 284/450 (63.11%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKK----EITVGIDGSLFKFHTKFPERMTDIV-HQLKNEDIKFVLKLSEDGSGKGAAAIAALSE 1384
            K+V   L    L  D  + +       M KGL+  ++  A+VKM P++V   P G E+G+FLALDLGG+ ++VL V + ++ K K+ +E+ T+ IP + + G+G ELF+++A++L+ F++ H ++     LGFTFSFPC+Q  ++   L+ W+K F     +G NV + L++AI  + +LDV  +A+VNDTVG + +C   D  C VGVIVGTGTNA Y+E++  ++   GD+  +    IN E GAFG+DG LD F T +D ++D  S++P +Q+FEKM SGMY+GELVR+IL+ +  K LLFRG++  +L T G+FHT ++  +E+    L      +  EDL +   +D D   V+ VC  V+ R+A  + + +A +L RI  NKK      TVG+DG++++ H ++P+R+  +V H + +  ++FV  LSE GS KGAA + A+++
Sbjct:   20 KKVDRFLYAMRLSEDQLKDISARFRLEMEKGLSSESNAAAAVKMLPTHVYSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGKGKVEMESETFPIPEEIVNGRGTELFEHVAESLKSFLQKHHINHTRKPLGFTFSFPCAQSKIDEGVLLSWSKNFKVRGVQGTNVVQSLRKAIRKVGDLDVDVLAMVNDTVGAMMTCGYDDQNCEVGVIVGTGTNACYMEEMRHIDLVEGDEGRM---CINTELGAFGDDGVLDDFITSFDREIDAASINPGKQLFEKMVSGMYMGELVRLILLRMAKKGLLFRGQISDALRTKGTFHTNHMCLIEQYKSGLENTKEIL--EDLGLNPSDD-DCIAVQHVCTIVSFRSANLVAAALAAILTRIRENKKLKTLRTTVGVDGTVYRTHPQYPKRLHKVVRHLVPDCHVRFV--LSESGSAKGAAMVTAVAQ 461          
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Match: hk2 (hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017])

HSP 1 Score: 366.696 bits (940), Expect = 5.110e-117
Identity = 203/455 (44.62%), Postives = 284/455 (62.42%), Query Frame = 2
Query:   56 RLPKEVVE---ILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETT---YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            RL K+  E   +L+   L  D   +V   +EE M +GLA  TH+ A+VKM P++V   P G E G FLALDLGGTN+RVLLV ++   K + +E     Y IP D   G G+ELFD+I   + DF++   +    + LGFTFSFPC Q  L+   L++WTKGF A+ CEGE+VA LL+ AI+     D+  VAVVNDTVGT+ +C  +D +C VG+IVGTGTNA Y+E++  VE   GD+     + +NMEWGAFG+ G LD   TE+D  +D+QS +P +Q +EKM SGMYLGE+VR +L+    K LLFRG++ + L+T G F TK+LS++E D   L      +  + L + S    D+ +V+ VC  V+ RAA   G+G+A ++++I      N+  ITVG+DG+L+K H  F   M + +  L   + +  L  SEDGSGKGAA I A++
Sbjct:  436 RLAKQHAERQRVLDTLRLGRDQLLEVKKRMEEEMKRGLAKKTHNNATVKMLPTFVRSTPDGTERGDFLALDLGGTNFRVLLVRVRGG-KRRNVEMNNKIYTIPQDITQGTGEELFDHIVHCIADFLEYMGMKGASLPLGFTFSFPCHQDKLDQGILIKWTKGFKASGCEGEDVASLLKDAIHRCEEFDLDVVAVVNDTVGTMMTCGYEDPQCEVGLIVGTGTNACYMEEMSNVELVDGDEG---RMCVNMEWGAFGDQGELDDIWTEFDRAVDDQSTYPGKQRYEKMISGMYLGEIVRNVLLHFTAKGLLFRGKLSERLKTRGIFETKFLSQIESDRLALRQVRSIL--QHLGLTSSTCDDSILVKEVCSVVSKRAAQLCGAGLAAVVDKIRLNRGLNQLSITVGVDGTLYKLHPHFATIMRETLRDLA-PNCEVSLVQSEDGSGKGAALITAVA 883          

HSP 2 Score: 342.813 bits (878), Expect = 6.368e-108
Identity = 187/440 (42.50%), Postives = 271/440 (61.59%), Query Frame = 2
Query:   98 LKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKII--ETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVE--RDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            L  ++   V     + M+KGL   T+ TA+VKM P++V   P G E G FLALDLGGTN+RVLLV +  N   K+      YAIP + M G G ELFD+IA+ L +F++   + +  + LGFTFSFPC Q  L+ + LV WTKGF A+  EG++V  LL++AI    + D+  VAV+NDTVGT+ +C   D  C +G+IVGTGTNA Y+E++  +E   GD+     + +NMEWGAFG+DG LD  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +    LLF+G     L T G F T ++S +E  +D   +      +    L+       D    + VC+ V+TRAA+   + +A +L +I      ++   ++G+DGS++K H +F  R+  +V  L  + D++F+   SEDGSGKGAA + A++
Sbjct:    3 LSNENLMDVSKRFRKEMDKGLGRDTNPTAAVKMLPTFVRSTPDGTETGDFLALDLGGTNFRVLLVKVSSNGMQKVEMENQIYAIPENIMRGCGSELFDHIAECLANFLEKLGIKEKKLPLGFTFSFPCQQTKLDESFLVSWTKGFKASGVEGKDVVSLLRKAIRKRGDFDIDIVAVINDTVGTMMTCGYDDHHCEIGLIVGTGTNACYMEEMRHLELVDGDEG---RMCVNMEWGAFGDDGALDDLRTEFDREIDAGSLNPGKQLFEKMISGMYMGELVRLILVKMAKDGLLFQGHTTPDLLTTGHFQTSFVSAIENRKDDEGIVSAEQVLRGLGLDPTP---EDCVATQRVCQIVSTRAAHLCAASLAAVLRQIRDNKASDRLRTSIGVDGSVYKNHPEFARRLNKMVRSLVPDCDVRFL--RSEDGSGKGAAMVTAVA 434          
BLAST of Phosphotransferase vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 377.481 bits (968), Expect = 3.839e-122
Identity = 200/449 (44.54%), Postives = 280/449 (62.36%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            +++ E LE F L  +   +V   +   +  GL   TH++A VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP D M G G+ELFD+IA  + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I     D+  VA+VNDTVGT+ +CA +D  C +G+IVGTG+NA Y+E+   +E   GD+     + +NMEWGAFG++GCLD  RT YD  +D+ SL+  +Q +EKM SGMYLGE+VR IL+D   +  LFRG++ ++L+T   F TK+LS++E D   L      +    LN       D+ IV+ VC  V+ RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M   V  L  + ++ F+  LSEDGSGKGAA I A++
Sbjct:  341 RQIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVDGDQ---GRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLALLQVRSILQQLGLNSTC---DDSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLAPKCNVSFL--LSEDGSGKGAALITAVA 780          

HSP 2 Score: 193.356 bits (490), Expect = 4.471e-53
Identity = 126/349 (36.10%), Postives = 185/349 (53.01%), Query Frame = 2
Query:  371 KELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQI---------FEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPE-RMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            K LFD++A+ L DF++   +    + +GFTFSFPC Q  ++   LV WTK F A+  EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAF                 D  SL+P +Q          FEKM SGMY+GELVR+ILV +  + LLF G +   L T G F TK++S +E+    L      +    L V    + D   V+ VC  V+ R+A  + + +  +L R+   +                P  R+   V +L  E D++F+  LSE GSGKGAA + A++
Sbjct:   24 KVLFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVEGDE---GRMCINTEWGAF-----------------DRGSLNPGKQSLTVTLTLHRFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR--LGVEPSHE-DCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNK--------------GVPRLRLHKTVRRLVPESDVRFL--LSESGSGKGAAMVTAVA 333          
BLAST of Phosphotransferase vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 376.326 bits (965), Expect = 1.613e-121
Identity = 200/449 (44.54%), Postives = 280/449 (62.36%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            +++ E LE F L  +   +V   +   +  GL   TH++A VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP D M G G+ELFD+IA  + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I     D+  VA+VNDTVGT+ +CA +D  C +G+IVGTG+NA Y+E+   +E   GD+     + +NMEWGAFG++GCLD  RT YD  +D+ SL+  +Q +EKM SGMYLGE+VR IL+D   +  LFRG++ ++L+T   F TK+LS++E D   L      +    LN       D+ IV+ VC  V+ RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M   V  L  + ++ F+  LSEDGSGKGAA I A++
Sbjct:  361 RQIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVDGDQ---GRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLALLQVRSILQQLGLNSTC---DDSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLAPKCNVSFL--LSEDGSGKGAALITAVA 800          

HSP 2 Score: 233.032 bits (593), Expect = 2.241e-67
Identity = 133/338 (39.35%), Postives = 199/338 (58.88%), Query Frame = 2
Query:  377 LFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPE-RMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LFD++A+ L DF++   +    + +GFTFSFPC Q  ++   LV WTK F A+  EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DGCL+  R+E+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G F TK++S +E+    L      +    L V    + D   V+ VC  V+ R+A  + + +  +L R+   +                P  R+   V +L  E D++F+  LSE GSGKGAA + A++
Sbjct:   38 LFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVEGDE---GRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIEKSKEGLSKAKDILTR--LGVEPSHE-DCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNK--------------GVPRLRLHKTVRRLVPESDVRFL--LSESGSGKGAAMVTAVA 353          
BLAST of Phosphotransferase vs. Ensembl Xenopus
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:100124752])

HSP 1 Score: 375.941 bits (964), Expect = 6.364e-121
Identity = 200/449 (44.54%), Postives = 280/449 (62.36%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            +++ E LE F L  +   +V   +   +  GL   TH++A VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP D M G G+ELFD+IA  + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I     D+  VA+VNDTVGT+ +CA +D  C +G+IVGTG+NA Y+E+   +E   GD+     + +NMEWGAFG++GCLD  RT YD  +D+ SL+  +Q +EKM SGMYLGE+VR IL+D   +  LFRG++ ++L+T   F TK+LS++E D   L      +    LN       D+ IV+ VC  V+ RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M   V  L  + ++ F+  LSEDGSGKGAA I A++
Sbjct:  403 RQIDETLEEFKLSREQLLEVKRRMRIEIENGLRKKTHESAKVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIDVMQGTGEELFDHIAHCISDFLDYMGIKGARLPLGFTFSFPCMQTSLDAGILVTWTKGFKATDCEGEDVVNLLREGIKRREFDLDVVAIVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYMEETKNIEMVDGDQ---GRMCVNMEWGAFGDNGCLDDIRTVYDKAVDDLSLNSGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISEALKTTSIFETKFLSQIESDRLALLQVRSILQQLGLNSTC---DDSIIVKEVCGAVSRRAAQVCGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSKIMHQTVKDLAPKCNVSFL--LSEDGSGKGAALITAVA 842          

HSP 2 Score: 230.72 bits (587), Expect = 3.409e-66
Identity = 133/340 (39.12%), Postives = 198/340 (58.24%), Query Frame = 2
Query:  371 KELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPE-RMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            K LFD++A+ L DF++   +    + +GFTFSFPC Q  ++   LV WTK F A+  EG +V +LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DGCL+  R+E+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G F TK++S +E     +           L V    + D   V+ VC  V+ R+A  + + +  +L R+   +                P  R+   V +L  E D++F+  LSE GSGKGAA + A++
Sbjct:   84 KILFDHVAECLGDFMQKKQIKDKKLPVGFTFSFPCIQTKIDEGVLVTWTKRFKASGVEGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDMVEGDE---GRMCINTEWGAFGDDGCLEDIRSEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFETKHVSAIENKAKDIL--------TRLGVEPSHE-DCIAVQHVCTIVSFRSANLVAATLGGILIRLRDNK--------------GVPRLRLHKTVRRLVPESDVRFL--LSESGSGKGAAMVTAVA 395          
BLAST of Phosphotransferase vs. Ensembl Xenopus
Match: HK2 (hexokinase domain containing 1 [Source:NCBI gene;Acc:100485269])

HSP 1 Score: 373.629 bits (958), Expect = 6.892e-120
Identity = 198/444 (44.59%), Postives = 281/444 (63.29%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP-KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAIN-NLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE---DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE F L      +V  ++ + M++GL   +H+ A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++   +  ++    Y IP D M G G+ELFD+I   + DF++   +    + LGFTFSFPC Q  LN   L++WTKGF AT CEGE+V  LL++AI+ +   D+  VAVVNDTVGT+ +C  +D  C +G+IVGTG+NA Y+E++  VE   G++     + INMEWGAFG++ CL+ FRT +D  +DE SL+P +Q +EKM SGMYLGE+VR IL+D   + LLFRG++ + L+T G F TK+LS++E D   L      + +  LN       D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F    + I+HQ  N+     +     SEDGSGKGAA I A++
Sbjct:  419 LEAFSLSTKQLLEVKKIMRQEMDRGLKKESHEEAPVKMLPTYVRSTPDGTEKGDFLALDLGGTNFRVLLVRVRNGRRGVEMHNKIYTIPQDAMVGTGEELFDHIVHCIADFLEYMGMKGVSLPLGFTFSFPCHQNSLNEGILLKWTKGFKATGCEGEDVVNLLKEAIHRHEEFDLDVVAVVNDTVGTMMTCGYEDPNCEMGLIVGTGSNACYMEEMRNVELVEGEE---GRMCINMEWGAFGDNDCLEEFRTVFDRAVDELSLNPGKQRYEKMISGMYLGEIVRNILIDFTKRGLLFRGKISERLKTRGIFETKFLSQIESDRLALLQVRSILQHLGLNSTC---DDSIIVKEVCTVVARRAAQLCGAGVAAVVDKIRENRGLETLKVTVGVDGTLYKLHPHF----SSIMHQTVNDLSPKCQVTFLQSEDGSGKGAALITAVA 852          

HSP 2 Score: 310.071 bits (793), Expect = 1.113e-95
Identity = 181/431 (42.00%), Postives = 251/431 (58.24%), Query Frame = 2
Query:  119 QVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKII--ETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGV-IVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            +V    E+ M KGL   T  TA VKM P++V   P G E G FLALDLGGTN+RVL V +  N   K+      YAIPAD M G G++LFD+IA+ L +F++   +    + LGFTFSFPC Q  L+ + LV WTKGF A   EG++V  LL++AI                            K GV + I GTGTNA Y+E +  ++   GD+     + INMEWGAFG+DGCLD  RT++D ++D  SL+P +Q+FEKM SGMY+GELVR ILV +  ++LLF G +   L T G F T+Y+SE+E+D   +    H +L +     S E  D+     +C+ V+TR+A    + +  +L RI +       + TVG+DGS++K H  F  R+   V +L  E D++F+   SEDGSGKGAA + A++
Sbjct:   10 EVSSRFEKQMEKGLGQETSPTACVKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLRVKVSDNGMKKVEMENQIYAIPADLMRGSGEQLFDHIAECLGNFMEKLNIKDKKLPLGFTFSFPCQQTKLDESILVNWTKGFKACGVEGKDVVTLLRKAIK---------------------------KRGVSMGIWGTGTNACYMEDMRHIDLVEGDE---GRMCINMEWGAFGDDGCLDEIRTQFDREIDMGSLNPGKQLFEKMISGMYMGELVRFILVKMAKEDLLFEGRITADLLTRGHFETRYVSEIEKDKEGIKK-AHEILTKLGLEPSHE--DSVATHRICQIVSTRSANLCAATLGAVLRRIRENKGVERLKSTVGVDGSVYKNHPHFARRLQKTVRRLVPECDVRFI--RSEDGSGKGAAMVTAVA 405          
BLAST of Phosphotransferase vs. Ensembl Xenopus
Match: HK2 (hexokinase domain containing 1 [Source:NCBI gene;Acc:100485269])

HSP 1 Score: 374.015 bits (959), Expect = 1.247e-119
Identity = 198/444 (44.59%), Postives = 281/444 (63.29%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP-KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAIN-NLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE---DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE F L      +V  ++ + M++GL   +H+ A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++   +  ++    Y IP D M G G+ELFD+I   + DF++   +    + LGFTFSFPC Q  LN   L++WTKGF AT CEGE+V  LL++AI+ +   D+  VAVVNDTVGT+ +C  +D  C +G+IVGTG+NA Y+E++  VE   G++     + INMEWGAFG++ CL+ FRT +D  +DE SL+P +Q +EKM SGMYLGE+VR IL+D   + LLFRG++ + L+T G F TK+LS++E D   L      + +  LN       D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F    + I+HQ  N+     +     SEDGSGKGAA I A++
Sbjct:  459 LEAFSLSTKQLLEVKKIMRQEMDRGLKKESHEEAPVKMLPTYVRSTPDGTEKGDFLALDLGGTNFRVLLVRVRNGRRGVEMHNKIYTIPQDAMVGTGEELFDHIVHCIADFLEYMGMKGVSLPLGFTFSFPCHQNSLNEGILLKWTKGFKATGCEGEDVVNLLKEAIHRHEEFDLDVVAVVNDTVGTMMTCGYEDPNCEMGLIVGTGSNACYMEEMRNVELVEGEE---GRMCINMEWGAFGDNDCLEEFRTVFDRAVDELSLNPGKQRYEKMISGMYLGEIVRNILIDFTKRGLLFRGKISERLKTRGIFETKFLSQIESDRLALLQVRSILQHLGLNSTC---DDSIIVKEVCTVVARRAAQLCGAGVAAVVDKIRENRGLETLKVTVGVDGTLYKLHPHF----SSIMHQTVNDLSPKCQVTFLQSEDGSGKGAALITAVA 892          

HSP 2 Score: 308.916 bits (790), Expect = 7.293e-95
Identity = 182/436 (41.74%), Postives = 254/436 (58.26%), Query Frame = 2
Query:  119 QVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKII--ETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQ-----FGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            +V    E+ M KGL   T  TA VKM P++V   P G E G FLALDLGGTN+RVL V +  N   K+      YAIPAD M G G++            VK   +         T+++ C +     F L  + LV WTKGF A   EG++V  LL++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTGTNA Y+E +  ++   GD+     + INMEWGAFG+DGCLD  RT++D ++D  SL+P +Q+FEKM SGMY+GELVR ILV +  ++LLF G +   L T G F T+Y+SE+E+D   +    H +L +     S E  D+     +C+ V+TR+A    + +  +L RI +       + TVG+DGS++K H  F  R+   V +L  E D++F+   SEDGSGKGAA + A++
Sbjct:   38 EVSSRFEKQMEKGLGQETSPTACVKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLRVKVSDNGMKKVEMENQIYAIPADLMRGSGEQ------------VKARHI--------CTYTYICRKEKPFSFSLLQSILVNWTKGFKACGVEGKDVVTLLRKAIKKRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGTNACYMEDMRHIDLVEGDE---GRMCINMEWGAFGDDGCLDEIRTQFDREIDMGSLNPGKQLFEKMISGMYMGELVRFILVKMAKEDLLFEGRITADLLTRGHFETRYVSEIEKDKEGIKK-AHEILTKLGLEPSHE--DSVATHRICQIVSTRSANLCAATLGAVLRRIRENKGVERLKSTVGVDGSVYKNHPHFARRLQKTVRRLVPECDVRFI--RSEDGSGKGAAMVTAVA 445          
BLAST of Phosphotransferase vs. Ensembl Mouse
Match: Hk2 (hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197])

HSP 1 Score: 370.163 bits (949), Expect = 2.059e-118
Identity = 203/444 (45.72%), Postives = 286/444 (64.41%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE   L  +   +V   ++  M +GL+  TH+ A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K + +E     Y+IP + M G G+ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI      D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD  RT +D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      + +  L + S  D D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  446 LESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEE---GRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRH--LGLESTCD-DSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFL--ESEDGSGKGAALITAVA 880          

HSP 2 Score: 343.969 bits (881), Expect = 2.157e-108
Identity = 186/431 (43.16%), Postives = 274/431 (63.57%), Query Frame = 2
Query:  119 QVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            ++     + M KGL   TH TA+VKM P++V   P G E G+FLALDLGGTN+RVL V +  N   + ++    YAIP D M G G +LFD+IA+ L +F+    + +  + LGFTFSFPC Q  L+ + LV WTKGF ++  EG +V +L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +    LLF+G++   L T GSF TK +S++E D   +      ++   L ++  ++ D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L  + D++F+   SEDGSGKGAA + A++
Sbjct:   10 EISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVR--LGLSPLQE-DCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFL--RSEDGSGKGAAMVTAVA 432          
BLAST of Phosphotransferase vs. Ensembl Mouse
Match: Hk2 (hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197])

HSP 1 Score: 369.777 bits (948), Expect = 4.977e-118
Identity = 203/444 (45.72%), Postives = 286/444 (64.41%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE   L  +   +V   ++  M +GL+  TH+ A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K + +E     Y+IP + M G G+ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI      D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD  RT +D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      + +  L + S  D D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  474 LESLKLSHEQLLEVKRRMKVEMEQGLSKETHEAAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKRRGVEMHNKIYSIPQEVMHGTGEELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDQSILLKWTKGFKASGCEGEDVVTLLKEAIRRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVDGEE---GRMCVNMEWGAFGDNGCLDDLRTVFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILRH--LGLESTCD-DSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDNLKVTVGVDGTLYKLHPHFAKVMHETVRDLAPKCDVSFL--ESEDGSGKGAALITAVA 908          

HSP 2 Score: 345.51 bits (885), Expect = 1.048e-108
Identity = 193/448 (43.08%), Postives = 280/448 (62.50%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            KVD Y   M L +E+           M KGL   TH TA+VKM P++V   P G E G+FLALDLGGTN+RVL V +  N   + ++    YAIP D M G G +LFD+IA+ L +F+    + +  + LGFTFSFPC Q  L+ + LV WTKGF ++  EG +V +L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +    LLF+G++   L T GSF TK +S++E D   +      ++   L ++  ++ D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L  + D++F+   SEDGSGKGAA + A++
Sbjct:   21 KVDQYLYHMRLSDETLLEISRRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQRVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKEKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVDLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGTLNDIRTEFDREIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKAELLFQGKLSPELLTTGSFETKDVSDIEDDKDGIQKAYQILVR--LGLSPLQE-DCVATHRICQIVSTRSASLCAATLAAVLWRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKAVRRLVPDCDVRFL--RSEDGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Mouse
Match: Hkdc1 (hexokinase domain containing 1 [Source:MGI Symbol;Acc:MGI:2384910])

HSP 1 Score: 368.622 bits (945), Expect = 1.661e-117
Identity = 190/448 (42.41%), Postives = 283/448 (63.17%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKE------ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K++ ++L  F L  +    V   +   +  GL   TH  A+VKM P+YV  +P G E+G+FLALDLGGTN+RVLLV +++    ++    +AIP + M G G+ELFD+I Q + DF+    +    + LGFTFSFPC Q  ++   LV WTKGF ATDCEGE+V ++L++AI   N  D+  VA+VNDTVGT+ +C  +D +C +G+I GTG+N  Y+E++  +E   GD+     + +N EWG FG++GC+D  RT+YD ++DE SL+  +Q +EKM SGMYLGE+VR IL+DL  + LLFRG++ + L T G F TK+LS++E D   L      +    L+       D+ +V+ VC  V+ RAA   G+G+A ++ +  + +      +TVG+DG+L+K H  F   + + V +L  + D+ F+  LSEDGSGKGAA I A+++
Sbjct:  468 KQIDKVLALFQLTREQLLGVRDKMRAELEYGLKKKTHSLATVKMLPTYVYGMPDGTEKGKFLALDLGGTNFRVLLVKIRRR-SVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFTFSFPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAIVNDTVGTMMTCGYEDPRCEIGLIAGTGSNVCYMEEMRNIELVDGDE---GRMCVNTEWGGFGDNGCIDDIRTQYDKEVDEGSLNAGKQRYEKMTSGMYLGEIVRRILIDLTRQGLLFRGQISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTC---EDSIVVKEVCGAVSRRAAQMCGAGMAAIVEKRREDQGLQHFKVTVGVDGTLYKLHPHFSRILQETVKELAPQCDVTFM--LSEDGSGKGAALITAVAK 906          

HSP 2 Score: 318.161 bits (814), Expect = 2.382e-98
Identity = 184/449 (40.98%), Postives = 267/449 (59.47%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT-YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAIN-NLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKK----EITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            K+V   L    L  +    +M   +  M KGL   T+ TASVKM P++V  +P G E G+FL+LDLGG+ +RVL V + Q  +  + +E+  Y +P +   G G ELFDY+A  L DF+K   +    + LGFTFSFPC Q  L    L+ WTK F A   +  +V   L  A+  + +LDV  +A+VNDTVGT+ +CA  D  C VGVI+GTGTNA Y+E +  ++   GD+     + IN EWGAFG+DG L+  RTE+D +LD  SL+P +Q+FEKM SG+Y+GELVR+IL+ +    LLF G    +L T G   T++++ +E     L      ++  DL +   E  D   V+ VC  V+ R+A    + +A +L R+  NKK      TVG+DG+L+K H ++P+R+  +V +L  N D++F+  LSE GS KGAA + A++
Sbjct:   20 KKVDRFLYHMRLSDETLVDIMARFQAEMEKGLGKDTNPTASVKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGQQNVQMESQFYPMPNEITRGNGTELFDYVADCLADFMKTKNLTHKKLPLGFTFSFPCRQNKLEEGVLLSWTKKFKARGVQDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDPNCEVGVIIGTGTNACYMEDMSNIDLVEGDE---GRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGLYMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVAAMEMSKEGLANTREILV--DLGLEPSES-DCIAVQHVCTIVSFRSANLCAAALATILTRLRENKKLARLRTTVGMDGTLYKTHPQYPKRLHKVVRRLVPNCDVRFL--LSESGSTKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Mouse
Match: Hk1 (hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103])

HSP 1 Score: 360.918 bits (925), Expect = 1.413e-114
Identity = 199/449 (44.32%), Postives = 273/449 (60.80%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKE------ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E L  F L      +V   L   M  GL   T+  A+VKM PSYV  +P G E G FLALDLGGTN+RVLLV ++   K + +E     Y+IP + M G G ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   L+ WTKGF ATDC G +VA LL+ A+      D+  VAVVNDTVGT+ +CA ++  C +G+IVGTG+NA Y+E++  VE   G++  +    INMEWGAFG++GCLD  RT++D  +DE SL+  +Q FEKM SGMYLGE+VR IL+D   K  LFRG++ + L+T G F TK+LS++E D   L      +    LN       D+ +V+ VC  V+ RAA   G+G+A ++ +I +        +TVG+DG+L+K H  F   M   V +L  +  + F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSG-KKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQM---CINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC---DDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 318.931 bits (816), Expect = 1.237e-98
Identity = 178/448 (39.73%), Postives = 266/448 (59.38%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEE-----------SMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            K+D Y   M L +E            M  GL+   + TASVKM P++V  +P G E+G F+ALDLGG+++R+L V +       + +E+  Y  P + + G G +LFD++A+ L DF++   +    + +GFTFSFPC Q  ++ A L+ WTK F A+  EG +V +LL +AI    + D   VAVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D +LD  SL+P +Q+FEKM SGMY+GELVR+ILV +  ++LLF G +   L T G F T  ++ +E D   +      +    L V    D D   V+ VC  V+ R+A  + + +  +LNR+       +   TVG+DGSL+K H ++  R    + +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   21 KIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTR--LGVEPSHD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Mouse
Match: Hk1 (hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103])

HSP 1 Score: 360.533 bits (924), Expect = 1.782e-114
Identity = 199/449 (44.32%), Postives = 273/449 (60.80%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKE------ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ E L  F L      +V   L   M  GL   T+  A+VKM PSYV  +P G E G FLALDLGGTN+RVLLV ++   K + +E     Y+IP + M G G ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   L+ WTKGF ATDC G +VA LL+ A+      D+  VAVVNDTVGT+ +CA ++  C +G+IVGTG+NA Y+E++  VE   G++  +    INMEWGAFG++GCLD  RT++D  +DE SL+  +Q FEKM SGMYLGE+VR IL+D   K  LFRG++ + L+T G F TK+LS++E D   L      +    LN       D+ +V+ VC  V+ RAA   G+G+A ++ +I +        +TVG+DG+L+K H  F   M   V +L  +  + F+  LSEDGSGKGAA I A+
Sbjct:  467 RQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSG-KKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQM---CINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC---DDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFL--LSEDGSGKGAALITAV 906          

HSP 2 Score: 318.161 bits (814), Expect = 1.883e-98
Identity = 177/451 (39.25%), Postives = 268/451 (59.42%), Query Frame = 2
Query:   92 FDLKVDDYRQVMHLLEE-----------SMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            ++ ++D Y   M L +E            M  GL+   + TASVKM P++V  +P G E+G F+ALDLGG+++R+L V +       + +E+  Y  P + + G G +LFD++A+ L DF++   +    + +GFTFSFPC Q  ++ A L+ WTK F A+  EG +V +LL +AI    + D   VAVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D +LD  SL+P +Q+FEKM SGMY+GELVR+ILV +  ++LLF G +   L T G F T  ++ +E D   +      +    L V    D D   V+ VC  V+ R+A  + + +  +LNR+       +   TVG+DGSL+K H ++  R    + +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   17 WEARIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEILTR--LGVEPSHD-DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 459          
BLAST of Phosphotransferase vs. UniProt/SwissProt
Match: sp|Q26609|HXK_SCHMA (Hexokinase OS=Schistosoma mansoni OX=6183 PE=1 SV=2)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 267/442 (60.41%), Postives = 328/442 (74.21%), Query Frame = 2
Query:   53 NRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCK-PKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
             +L ++VVEIL+PFDL V DY ++   + ESM  GL  +T++ +S+KMFPSYVTK P G E G FLALDLGGTNYRVL V+L+   K P+I E TY IPA+KM G G ELF YIA+TL DF++ + +     +LGFTFSFPC Q GL +A LVRWTKGFSA   EG NVAELLQ  ++   L+VKCVAVVNDTVGTL SCAL+D KC VG+IVGTGTN +Y+E   KVE   G K     VVIN EWGAFGE G LD +RT++D  +D  SLHP +Q++EKM SGMYLGELVR I+V LV + +LFRG++P+ L+   S  T+YL++VERDP HL Y THYML +DL+V   E  D  IVR  CE V  RAAY  G+GIAC+L RIN+ E+TVG+DGSL+KFH KF ERMTD+V +LK ++ +F L+LSEDGSGKGAAAIAA
Sbjct:    6 QQLFEKVVEILKPFDLSVVDYEEICDRMGESMRLGLQKSTNEKSSIKMFPSYVTKTPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYCIPAEKMSGSGTELFKYIAETLADFLENNGMKDKKFDLGFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQTELDKRELNVKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNVAYIEDSSKVELMDGVKE--PEVVINTEWGAFGEKGELDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIVRYACEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLYKFHPKFCERMTDMVDKLKPKNTRFCLRLSEDGSGKGAAAIAA 445          
BLAST of Phosphotransferase vs. UniProt/SwissProt
Match: sp|P52789|HXK2_HUMAN (Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2)

HSP 1 Score: 377.096 bits (967), Expect = 6.182e-120
Identity = 208/444 (46.85%), Postives = 287/444 (64.64%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LE   L  D   +V   ++  M +GL+  TH +A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K   +E     YAIP + M G G ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI+     D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD FRTE+D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  VA RAA   G+G+A +++RI +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  474 LEHLQLSHDQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKWGGVEMHNKIYAIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGFEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE---GRMCVNMEWGAFGDNGCLDDFRTEFDVAVDELSLNPGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAIL--QHLGLESTCD-DSIIVKEVCTVVARRAAQLCGAGMAAVVDRIRENRGLDALKVTVGVDGTLYKLHPHFAKVMHETVKDLAPKCDVSFL--QSEDGSGKGAALITAVA 908          

HSP 2 Score: 340.502 bits (872), Expect = 5.083e-106
Identity = 191/448 (42.63%), Postives = 272/448 (60.71%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            KVD Y   M L +E+           M KGL   TH TA+VKM P++V   P G E G+FLALDLGGTN+RVL V +  N   K ++    YAIP D M G G +LFD+IA+ L +F+    +    + LGFTFSFPC Q  L+ + LV WTKGF ++  EG +V  L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G++   L   G F TK +S++E +   +      ++   L+       D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L    D++F+   SEDGSGKGAA + A++
Sbjct:   21 KVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGSLNDIRTEFDQEIDMGSLNPGKQLFEKMISGMYMGELVRLILVKMAKEELLFGGKLSPELLNTGRFETKDISDIEGEKDGIRKAREVLMRLGLDPTQ---EDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTVRRLVPGCDVRFL--RSEDGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. UniProt/SwissProt
Match: sp|Q9NFT7|HXK2_DROME (Hexokinase type 2 OS=Drosophila melanogaster OX=7227 GN=Hex-t2 PE=2 SV=4)

HSP 1 Score: 363.999 bits (933), Expect = 6.724e-120
Identity = 187/446 (41.93%), Postives = 281/446 (63.00%), Query Frame = 2
Query:   44 KMPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLD-YVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
            KMP+ +  E+   ++ F +  +   +V+  + + +  GLA  TH  A +K F S+V  LPTGKE G++LALDLGG+N+RVLLV+L  N   + +   Y  P   M G GK LFD++A+ L +F   H ++   + LGFTFSFP  Q GL+   LV WTKGFS     G+NV  LLQ+AI+   +L +  VA++NDTVGTL SCA     C +G+IVGTG+NA YVEK    E F G +T     ++IN EWGAFG++G L+  RT YD  +D+ + +P +Q FEK  SGMY+GELVR+++ D++ K  +F G + + ++   SF T Y+S+VE D P  +   + +L+E L +   ++ D   +R +CE V++R+A     G+  ++N++N  E+ +GIDGS+++FH K+ + +   + +L    +KF L +SEDGSG+GAA +AA
Sbjct:   33 KMPSLVNTEIEAAVKGFLIDQEKMTEVVERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLISNSDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQGLSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHPNCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPSMIINCEWGAFGDNGVLEFVRTSYDKAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAYISDVESDAPGEYRNCNKVLSE-LGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINKMNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAA 477          
BLAST of Phosphotransferase vs. UniProt/SwissProt
Match: sp|Q1W674|HXK2_PIG (Hexokinase-2 OS=Sus scrofa OX=9823 GN=HK2 PE=2 SV=1)

HSP 1 Score: 373.244 bits (957), Expect = 1.874e-118
Identity = 203/444 (45.72%), Postives = 285/444 (64.19%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            LEP  L  +   +V   ++  M +GL+  TH  A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K + +E     Y+IP + M G G ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI+     D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +NMEWGAFG++GCLD FRTE+D+ +DE SL+  +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      + +  L        D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  474 LEPLKLSREQLLEVKRRMKVEMERGLSKETHAIAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKRRGVEMHNKIYSIPQEVMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNSLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE---GRMCVNMEWGAFGDNGCLDDFRTEFDAAVDELSLNAGKQRFEKMISGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALLQVRAILHHLGLESTC---GDSIIVKEVCTVVARRAAQLCGAGMAAVVDKIRENRGLDTLKVTVGVDGTLYKLHPHFAKIMHETVKDLAPKCDVSFL--ESEDGSGKGAALITAVA 908          

HSP 2 Score: 341.658 bits (875), Expect = 1.814e-106
Identity = 193/448 (43.08%), Postives = 274/448 (61.16%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            KVD Y   M L +E+           M KGL   TH TASVKM P++V   P G E G+FLALDLGGTN+RVL V +  N   K ++    YAIP D M G G +LFD+IA+ L +F+    +    + LGFTFSFPC Q  L+ + LV WTKGF ++  EG++V  L+++AI    + D+  VAVVNDTVGT+ +C   D  C +G+IVGTG+NA Y+E++  ++   GD+     + INMEWGAFG+DG LD  RTE+D ++D  SL+P +Q+FEKM SG+Y+GELVR+ILV +  + LLF G++   L   G F TK +S++E +   +      ++   L+       D      VC+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   + +L  + DI+F+   SEDGSGKGAA + A++
Sbjct:   21 KVDQYLYHMRLSDETLLEIAKRFRKEMEKGLGATTHPTASVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVRVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCIQTKLDESFLVSWTKGFKSSGVEGKDVVTLIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDQNCEIGLIVGTGSNACYMEEMRHIDMVEGDE---GRMCINMEWGAFGDDGALDDIRTEFDQEIDMGSLNPGKQLFEKMISGLYMGELVRLILVKMAKEELLFGGKLSPELLATGHFETKDVSDIEGEKDGIRKAREVLVRLGLDPTQ---EDCVATHRVCQIVSTRSASLCAATLAAVLRRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLHKTLRRLVPDCDIRFL--RSEDGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. UniProt/SwissProt
Match: sp|A2PYL6|HXK2_HORSE (Hexokinase-2 OS=Equus caballus OX=9796 GN=HK2 PE=2 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 5.518e-118
Identity = 205/447 (45.86%), Postives = 289/447 (64.65%), Query Frame = 2
Query:   74 VEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            ++ LEP  L  +   +V   ++  M +GL+  TH +A VKM P+YV   P G E+G FLALDLGGTN+RVLLV ++ N K + +E     Y+IP D M G G ELFD+I Q + DF++   +    + LGFTFSFPC Q  L+ + L++WTKGF A+ CEGE+V  LL++AI+     D+  VAVVNDTVGT+ +C  +D  C VG+IVGTG+NA Y+E++  VE   G++     + +N EWGAFG++GCLD F TE+D  +DE SL+P +Q FEKM SGMYLGE+VR IL+D   + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  VA RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F + M + V  L  + D+ F+   SEDGSGKGAA I A++
Sbjct:  471 LKTLEPLKLSREQLLEVKRRMKVEMERGLSKETHASAPVKMLPTYVCATPDGTEKGDFLALDLGGTNFRVLLVRVR-NGKRRGVEMHNKIYSIPQDIMHGTGDELFDHIVQCIADFLEYMGMKGVSLPLGFTFSFPCQQNRLDESILLKWTKGFKASGCEGEDVVTLLKEAIHRREEFDLDVVAVVNDTVGTMMTCGYEDPHCEVGLIVGTGSNACYMEEMRNVELVEGEE---GRMCVNTEWGAFGDNGCLDDFCTEFDVAVDELSLNPGKQRFEKMMSGMYLGEIVRNILIDFTKRGLLFRGRISERLKTRGIFETKFLSQIESDCLALQQVRAIL--QHLGLESTCD-DSIIVKEVCTVVAQRAAQLCGAGMAAVVDKIRENRGLDTLKVTVGVDGTLYKLHPHFAKVMRETVKDLAPKCDVSFL--ESEDGSGKGAALITAVA 908          

HSP 2 Score: 347.821 bits (891), Expect = 8.932e-109
Identity = 197/448 (43.97%), Postives = 273/448 (60.94%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEES-----------MNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNC--KPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKKE----ITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            KVD Y   M L +E+           M KGLA  TH TASVKM P++V   P G E G+FLALDLGGTN+RVL V +  N   K ++    YAIP D M G G +LFD+IA  L +F+    +    + LGFTFSFPC Q  L+ + LV WTKGF +   EG +V  L+++AI    + D+  VA+VNDTV T+ +C   D  C +G+IVG G+NA Y+E++  ++T  GD+     + INMEWGAFG+DG LD  RTE+D ++D  SL+P QQ+FEKM SGMY+GELVR+ILV +  + LLFRG++   L T G F TK +SE+E +   +      ++   ++       D      +C+ V+TR+A    + +A +L RI  NK E     T+G+DGS++K H  F +R+   V +L  N DI+F+   SEDGSGKGAA + A++
Sbjct:   21 KVDQYLYHMRLSDETLLEISKRFRKEMEKGLAATTHPTASVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLRVRVTDNGLQKVEMENQIYAIPEDIMQGSGTQLFDHIAGCLANFMDKLQIKDKKLPLGFTFSFPCIQTKLDESFLVSWTKGFKSRGVEGRDVVTLIRKAIQRRGDFDIDIVAMVNDTVATMMTCGYDDQNCEIGLIVGMGSNACYMEEMRYIDTVEGDE---GRMCINMEWGAFGDDGTLDDIRTEFDQEIDMGSLNPGQQLFEKMISGMYMGELVRLILVKMAKEELLFRGKLSPELLTTGRFETKDVSEIEGEKDGIQKAREVLVRLGMDPTQ---EDCVATHRICQIVSTRSASLCAATLAAVLQRIKENKGEERLRSTIGVDGSVYKKHPHFAKRLQKTVRRLVPNCDIRFL--CSEDGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. TrEMBL
Match: G7YJ23 (Phosphotransferase OS=Clonorchis sinensis OX=79923 GN=CLF_109217 PE=3 SV=1)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 263/431 (61.02%), Postives = 326/431 (75.64%), Query Frame = 2
Query:   68 EVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLK-QNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKG 1357
            +V+EI++PFDL V+ Y +  H + E+M++GL  +TH  +S+KM+P+YV+K+P G E G +LALDLGGTNYRVLLV L  +   PKI E TYAIP  KM G G++LFDYIA TL DFV+ H + + P NLGFTFSFPC Q GL NA LVRWTKGF A D EG NVA +LQ AI+   + +KCVAVVNDTVGTL SCAL+D KC VG+IVGTGTNA+Y+EK ++VE    ++ G  YVVIN EWGAFGE+G  D  RT++D  +D +SL+P +Q+FEKM SGMYLGE+VR +LV LV + LLFRGE+P+ L+   + HTKYL+E ERDPPHLFY THYML EDL V   E  D  IVR VCE V+ RAAY  GSGIA LL R+ + E+T+GIDGSL+KFH KF ERMTDI+ +LK ++  F L+LSEDGSGKG
Sbjct:   11 QVLEIMKPFDLSVEAYEKFCHTMYETMSRGLQRSTHAESSIKMYPTYVSKIPNGSESGCYLALDLGGTNYRVLLVHLPGKKAPPKIEERTYAIPHSKMTGSGEQLFDYIANTLADFVRGHDMGEAPCNLGFTFSFPCIQKGLTNATLVRWTKGFKAVDVEGANVALMLQNAIDKTGIKIKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNAAYIEKRERVELM--EEEGAPYVVINTEWGAFGENGEFDDIRTQFDKSVDAESLYPGKQVFEKMVSGMYLGEIVRHVLVHLVREGLLFRGEMPEKLQIKDAVHTKYLTEAERDPPHLFYSTHYMLTEDLAVPIVEPLDDRIVRYVCEMVSKRAAYLAGSGIASLLRRMKRSEVTIGIDGSLYKFHPKFRERMTDIIDKLKPKNTYFRLRLSEDGSGKG 439          
BLAST of Phosphotransferase vs. TrEMBL
Match: A0A419PQ80 (Phosphotransferase OS=Clonorchis sinensis OX=79923 GN=CSKR_2690s PE=3 SV=1)

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 263/431 (61.02%), Postives = 325/431 (75.41%), Query Frame = 2
Query:   68 EVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLK-QNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKG 1357
            +V+EI++PFDL V+ Y +  H + E+M+ GL  +TH  +S+KM+P+YV+K+P G E G +LALDLGGTNYRVLLV L  +   PKI E TYAIP  KM G G++LFDYIA TL DFV+ H + + P NLGFTFSFPC Q GL NA LVRWTKGF A D EG NVA +LQ AI+   + +KCVAVVNDTVGTL SCAL+D KC VG+IVGTGTNA+Y+EK ++VE    ++ G  YVVIN EWGAFGE+G  D  RT++D  +D +SL+P +Q+FEKM SGMYLGE+VR +LV LV + LLFRGE+P+ L+   + HTKYL+E ERDPPHLFY THYML EDL V   E  D  IVR VCE V+ RAAY  GSGIA LL R+ + E+T+GIDGSL+KFH KF ERMTDI+ +LK ++  F L+LSEDGSGKG
Sbjct:   11 QVLEIMKPFDLSVEAYEKFCHTMYETMSHGLQRSTHAESSIKMYPTYVSKIPNGSESGCYLALDLGGTNYRVLLVHLPGKKAPPKIEERTYAIPHSKMTGSGEQLFDYIANTLADFVRGHDMGEAPCNLGFTFSFPCIQKGLTNATLVRWTKGFKAVDVEGANVALMLQNAIDKTGIKIKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNAAYIEKRERVELM--EEEGAPYVVINTEWGAFGENGEFDDIRTQFDKSVDAESLYPGKQVFEKMVSGMYLGEIVRHVLVHLVREGLLFRGEMPEKLQIKDAVHTKYLTEAERDPPHLFYSTHYMLTEDLAVPIVEPLDDRIVRYVCEMVSKRAAYLAGSGIASLLRRMKRSEVTIGIDGSLYKFHPKFRERMTDIIDKLKPKNTYFRLRLSEDGSGKG 439          
BLAST of Phosphotransferase vs. TrEMBL
Match: A0A4S2LB68 (Phosphotransferase OS=Opisthorchis felineus OX=147828 GN=CRM22_009838 PE=3 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 264/432 (61.11%), Postives = 326/432 (75.46%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLK-QNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKG 1357
            ++VVEI++PFDL V+ Y +  H + E+M++GL  +THD +S+KM+P+YV+K+P G E G +LALDLGGTNYRVLLV L  +   PKI E TYAIP  KM G G++LFDYIA TL DFV+ H + + P +LGFTFSFPC Q GL NA LVRWTKGF A D EG NVA +LQ+AI+   + VKCVAVVNDTVGTL SCAL+D KC VG+IVGTGTNA+Y+EK ++VE   G+     YVVIN EWGAFGE+G  D  RT++D  +D +SL+P +Q+FEKM SGMYLGE+VR +LV L+ + LLFRGE+P+ L+     HTKYL+E ERDPPHLFY THYML EDL V   E  D  IVR VCE V+ RAAY  G+GIA LL R+ + E+TVGIDGSL+KFH KF ERMTDI+ +LK  +  F L+LSEDGSGKG
Sbjct:   35 EQVVEIMKPFDLSVEAYEKFCHTMYETMDRGLQRSTHDESSIKMYPTYVSKIPDGSESGCYLALDLGGTNYRVLLVHLPGKKAPPKIEERTYAIPHSKMTGSGEQLFDYIANTLADFVRNHDMGETPCSLGFTFSFPCIQKGLTNATLVRWTKGFKAEDVEGANVALMLQKAIDKTGIKVKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNAAYIEKRERVELMEGESA--PYVVINTEWGAFGENGEFDDIRTQFDKSVDAESLYPGKQVFEKMVSGMYLGEIVRHVLVHLIREGLLFRGEMPEKLQIRDVVHTKYLTETERDPPHLFYSTHYMLTEDLAVPIVEPLDDRIVRYVCEMVSKRAAYLAGAGIASLLRRMKRSEVTVGIDGSLYKFHPKFRERMTDIIDKLKPRNTYFRLRLSEDGSGKG 464          
BLAST of Phosphotransferase vs. TrEMBL
Match: G4VIV9 (Phosphotransferase OS=Schistosoma mansoni OX=6183 GN=Smp_043030 PE=3 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 267/442 (60.41%), Postives = 328/442 (74.21%), Query Frame = 2
Query:   53 NRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCK-PKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
             +L ++VVEIL+PFDL V DY ++   + ESM  GL  +T++ +S+KMFPSYVTK P G E G FLALDLGGTNYRVL V+L+   K P+I E TY IPA+KM G G ELF YIA+TL DF++ + +     +LGFTFSFPC Q GL +A LVRWTKGFSA   EG NVAELLQ  ++   L+VKCVAVVNDTVGTL SCAL+D KC VG+IVGTGTN +Y+E   KVE   G K     VVIN EWGAFGE G LD +RT++D  +D  SLHP +Q++EKM SGMYLGELVR I+V LV + +LFRG++P+ L+   S  T+YL++VERDP HL Y THYML +DL+V   E  D  IVR  CE V  RAAY  G+GIAC+L RIN+ E+TVG+DGSL+KFH KF ERMTD+V +LK ++ +F L+LSEDGSGKGAAAIAA
Sbjct:    6 QQLFEKVVEILKPFDLSVVDYEEICDRMGESMRLGLQKSTNEKSSIKMFPSYVTKTPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYCIPAEKMSGSGTELFKYIAETLADFLENNGMKDKKFDLGFTFSFPCVQKGLTHATLVRWTKGFSADGVEGHNVAELLQTELDKRELNVKCVAVVNDTVGTLASCALEDPKCAVGLIVGTGTNVAYIEDSSKVELMDGVKE--PEVVINTEWGAFGEKGELDCWRTQFDKSMDIDSLHPGKQLYEKMVSGMYLGELVRHIIVYLVEQKILFRGDLPERLKVRNSLLTRYLTDVERDPAHLLYNTHYMLTDDLHVPVVEPIDNRIVRYACEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLYKFHPKFCERMTDMVDKLKPKNTRFCLRLSEDGSGKGAAAIAA 445          
BLAST of Phosphotransferase vs. TrEMBL
Match: C1L5D0 (Phosphotransferase OS=Schistosoma japonicum OX=6182 GN=Hex-A PE=2 SV=1)

HSP 1 Score: 528.094 bits (1359), Expect = 0.000e+0
Identity = 263/441 (59.64%), Postives = 328/441 (74.38%), Query Frame = 2
Query:   56 RLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCK-PKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
            +L ++VVE+L PFDL V DY +    ++E+M  GL  +T+  +S+KMFPSYVTK+P G E G FLALDLGGTNYRVL V+L+   K P+I E TY+IPA+KM G G ELF YIA+TL DF+  + +     +LGFTFSFPC Q GL +A LVRWTKGF+A   EG NVAELLQ A++   L V+CVAVVNDTVGTL SCAL+D KC VG+IVGTGTN +Y+E   KVE    D      V++N EWGAFGE+G LD +RT++D  +D +SLHP +Q+FEKM SGMYLGELVR ILV LV + +LFRG++P+ L+   S  T+YL++VERDP HL Y T+YML EDL+V   E  D  IVR  CE V  RAAY  G+GIAC+L RIN+ E+TVG+DGSLFKFH KF ERMTD++ +LK ++ +F L+LSEDGSGKGAAAIAA
Sbjct:    7 QLFEKVVEVLRPFDLSVADYEEFCDKMDEAMRLGLQKSTNGKSSIKMFPSYVTKVPNGTETGNFLALDLGGTNYRVLSVTLEGKGKSPRIQERTYSIPAEKMSGTGTELFRYIAETLSDFLDNNGMRDKKFDLGFTFSFPCEQKGLTHATLVRWTKGFTADGVEGNNVAELLQNALDEHGLHVRCVAVVNDTVGTLASCALEDSKCAVGLIVGTGTNVAYIEDSSKVEMV--DNIFEPEVIVNTEWGAFGENGELDCWRTQFDKAMDIESLHPGKQLFEKMVSGMYLGELVRHILVYLVEQKVLFRGKLPERLKVRNSLLTRYLTDVERDPAHLLYSTYYMLTEDLSVPVVEPVDNRIVRYTCEMVVKRAAYLAGAGIACILRRINRSEVTVGVDGSLFKFHLKFCERMTDMIDKLKPKNTRFCLRLSEDGSGKGAAAIAA 445          
BLAST of Phosphotransferase vs. Ensembl Cavefish
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:103028521])

HSP 1 Score: 385.956 bits (990), Expect = 3.177e-124
Identity = 207/449 (46.10%), Postives = 287/449 (63.92%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ EIL  F L  D   +V   +   +  GL+  T D A+VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I      D+  VAVVNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  GD+     + +NMEWGAFG++GCLD  RT+YD  +D+ SL+P +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   M   V +L  + D+ F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIAEILAEFRLTQDQLLEVKKRMLTEIQTGLSKKTQDKATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIEVMQGTGEELFDHIVACISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVDGDQ---GRMCVNMEWGAFGDNGCLDDIRTQYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQICGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCDVNFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 329.331 bits (843), Expect = 1.029e-102
Identity = 183/446 (41.03%), Postives = 266/446 (59.64%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEESMN-----------KGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAA 1375
            K+D Y   M   +E++            KGL+  T+ TA++KM P++V  +P G E+G F+ALDLGG+N+R+L V +    K  + +E+  Y  P D + G G  LFD++A+ L DF++   +    + +GFTFSFPC Q  L+ A L+ WTK F     EG +V +LL +AI    + D   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G F TK++S +E+    L      +    L V    D D   V+ VC  V+ R+A  I + +  +LNR+       +   TVGIDGSL+K H ++  R+   V +L  E D++F+  LSE GSGKGAA + A
Sbjct:   21 KIDKYLYSMRFSDETLRDIKARFRMELEKGLSRDTNPTATIKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQNYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHISAIEKTKEGLTKAKEILTR--LGVEPSAD-DCIAVQHVCAIVSFRSANLIAATLGAILNRLKDNKNVPRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLVPECDVRFL--LSESGSGKGAALVTA 458          
BLAST of Phosphotransferase vs. Ensembl Cavefish
Match: hk1 (hexokinase 1 [Source:NCBI gene;Acc:103028521])

HSP 1 Score: 384.8 bits (987), Expect = 9.843e-124
Identity = 207/449 (46.10%), Postives = 287/449 (63.92%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ EIL  F L  D   +V   +   +  GL+  T D A+VKM P+YV   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++ I      D+  VAVVNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  GD+     + +NMEWGAFG++GCLD  RT+YD  +D+ SL+P +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   M   V +L  + D+ F+  LSEDGSGKGAA I A+
Sbjct:  482 RQIAEILAEFRLTQDQLLEVKKRMLTEIQTGLSKKTQDKATVKMLPTYVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRTVEMHNKIYAIPIEVMQGTGEELFDHIVACISDFLDYMGMKNARLPLGFTFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVDGDQ---GRMCVNMEWGAFGDNGCLDDIRTQYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQICGAGMAAVVDKIRENRGLDHLDITVGVDGTLYKLHPHFSRIMHQTVKELAPKCDVNFL--LSEDGSGKGAALITAV 921          

HSP 2 Score: 328.561 bits (841), Expect = 2.702e-102
Identity = 183/446 (41.03%), Postives = 266/446 (59.64%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEESMN-----------KGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAA 1375
            K+D Y   M   +E++            KGL+  T+ TA++KM P++V  +P G E+G F+ALDLGG+N+R+L V +    K  + +E+  Y  P D + G G  LFD++A+ L DF++   +    + +GFTFSFPC Q  L+ A L+ WTK F     EG +V +LL +AI    + D   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G F TK++S +E+    L      +    L V    D D   V+ VC  V+ R+A  I + +  +LNR+       +   TVGIDGSL+K H ++  R+   V +L  E D++F+  LSE GSGKGAA + A
Sbjct:   35 KIDKYLYSMRFSDETLRDIKARFRMELEKGLSRDTNPTATIKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQNYETPEDIIHGSGSRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCVQTKLDEAVLLTWTKRFKVNGVEGMDVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHISAIEKTKEGLTKAKEILTR--LGVEPSAD-DCIAVQHVCAIVSFRSANLIAATLGAILNRLKDNKNVPRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLVPECDVRFL--LSESGSGKGAALVTA 472          
BLAST of Phosphotransferase vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 375.17 bits (962), Expect = 3.595e-120
Identity = 201/467 (43.04%), Postives = 293/467 (62.74%), Query Frame = 2
Query:   14 KYIANITLSVKMPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP--KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K  A +T   +      +E+ + L  F L     +QV   +   + +GL   +HD+ASVKM PSYV + P G E G+FLALDLGGTN+RVL+V ++   +   ++    YAIP + M G G+ELFD+I Q + DF+    +    + LGFTFSFPCSQ G++   LV WTKGF AT+CEG +V ++L++AI   N  D+  VAVVNDTVGT+ +CA +D +C +G+I GTG+N  Y+E +  VE   GD+  +    IN EWG FG++  ++  RT +D ++DE SL+  +Q FEKM SGMYLGE+VR IL+DL  + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   + + V +L  + +++F+  LSEDGSGKGAA I A++ 
Sbjct:  451 KGAAMVTAVAQRRASQREEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVEGDEGQM---CINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELAPQCEVEFI--LSEDGSGKGAALITAVAR 909          

HSP 2 Score: 318.161 bits (814), Expect = 1.986e-98
Identity = 181/450 (40.22%), Postives = 282/450 (62.67%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQ--NCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKK----EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K+V   L    L  +   ++ H   + M KGL+  ++  A++KM P++V   P G E+G+FLALDLGG+ ++VL V + +  N K ++    + IP + + G+G +LFD++A +L++F++ + +++    LGFTFSFPC Q  L+   L+ W+K + A   +G NV + L+QAIN    +DV  +A+VNDTVGT+ +C   D  C VGVI+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L  F T +DS++D  S++P +Q+FEKM SGMY+GELVR+IL+ +  + LLF+G V  +L T G F T+++S +E     L   T  +L E L +   ED D   V+ VC  V+ R+A    + +A +L RI  NKK      TVG+DG++++ H ++ +R+  +V +L  E  ++FV  LSE GSGKGAA + A+++
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGL-RNTREILTE-LGLTPTED-DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLVPECHVRFV--LSESGSGKGAAMVTAVAQ 461          
BLAST of Phosphotransferase vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 374.785 bits (961), Expect = 4.226e-120
Identity = 201/467 (43.04%), Postives = 293/467 (62.74%), Query Frame = 2
Query:   14 KYIANITLSVKMPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP--KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K  A +T   +      +E+ + L  F L     +QV   +   + +GL   +HD+ASVKM PSYV + P G E G+FLALDLGGTN+RVL+V ++   +   ++    YAIP + M G G+ELFD+I Q + DF+    +    + LGFTFSFPCSQ G++   LV WTKGF AT+CEG +V ++L++AI   N  D+  VAVVNDTVGT+ +CA +D +C +G+I GTG+N  Y+E +  VE   GD+  +    IN EWG FG++  ++  RT +D ++DE SL+  +Q FEKM SGMYLGE+VR IL+DL  + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   + + V +L  + +++F+  LSEDGSGKGAA I A++ 
Sbjct:  451 KGAAMVTAVAQRRASQREEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVEGDEGQM---CINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELAPQCEVEFI--LSEDGSGKGAALITAVAR 909          

HSP 2 Score: 317.775 bits (813), Expect = 2.304e-98
Identity = 181/450 (40.22%), Postives = 282/450 (62.67%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQ--NCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKK----EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K+V   L    L  +   ++ H   + M KGL+  ++  A++KM P++V   P G E+G+FLALDLGG+ ++VL V + +  N K ++    + IP + + G+G +LFD++A +L++F++ + +++    LGFTFSFPC Q  L+   L+ W+K + A   +G NV + L+QAIN    +DV  +A+VNDTVGT+ +C   D  C VGVI+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L  F T +DS++D  S++P +Q+FEKM SGMY+GELVR+IL+ +  + LLF+G V  +L T G F T+++S +E     L   T  +L E L +   ED D   V+ VC  V+ R+A    + +A +L RI  NKK      TVG+DG++++ H ++ +R+  +V +L  E  ++FV  LSE GSGKGAA + A+++
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGL-RNTREILTE-LGLTPTED-DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLVPECHVRFV--LSESGSGKGAAMVTAVAQ 461          
BLAST of Phosphotransferase vs. Ensembl Cavefish
Match: hkdc1 (hexokinase domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9801])

HSP 1 Score: 374.4 bits (960), Expect = 5.692e-120
Identity = 201/465 (43.23%), Postives = 292/465 (62.80%), Query Frame = 2
Query:   14 KYIANITLSVKMPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP--KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            K  A +T   +      +E+ + L  F L     +QV   +   + +GL   +HD+ASVKM PSYV + P G E G+FLALDLGGTN+RVL+V ++   +   ++    YAIP + M G G+ELFD+I Q + DF+    +    + LGFTFSFPCSQ G++   LV WTKGF AT+CEG +V ++L++AI   N  D+  VAVVNDTVGT+ +CA +D +C +G+I GTG+N  Y+E +  VE   GD+  +    IN EWG FG++  ++  RT +D ++DE SL+  +Q FEKM SGMYLGE+VR IL+DL  + LLFRG + + L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       +ITVG+DG+L+K H  F   + + V +L  + +++F+  LSEDGSGKGAA I A+
Sbjct:  451 KGAAMVTAVAQRRASQREEINDTLADFTLSSTQLQQVKEKMRVELERGLRKDSHDSASVKMLPSYVYRTPDGTERGKFLALDLGGTNFRVLVVKIRSGIRKSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGFTFSFPCSQTGIDKGSLVSWTKGFKATECEGHDVVDMLREAIKRRNEFDLDIVAVVNDTVGTMMTCAYEDPRCEIGLIAGTGSNVCYMEDMKNVEVVEGDEGQM---CINTEWGGFGDNDNIEDIRTRFDHEVDEGSLNVGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITEPLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGAVSRRAAQLCGAGMAAIVDKIRENRGLDNLDITVGVDGTLYKLHPHFSRILKETVKELAPQCEVEFI--LSEDGSGKGAALITAV 907          

HSP 2 Score: 317.775 bits (813), Expect = 2.397e-98
Identity = 181/450 (40.22%), Postives = 282/450 (62.67%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQ--NCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI--NKK----EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            K+V   L    L  +   ++ H   + M KGL+  ++  A++KM P++V   P G E+G+FLALDLGG+ ++VL V + +  N K ++    + IP + + G+G +LFD++A +L++F++ + +++    LGFTFSFPC Q  L+   L+ W+K + A   +G NV + L+QAIN    +DV  +A+VNDTVGT+ +C   D  C VGVI+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L  F T +DS++D  S++P +Q+FEKM SGMY+GELVR+IL+ +  + LLF+G V  +L T G F T+++S +E     L   T  +L E L +   ED D   V+ VC  V+ R+A    + +A +L RI  NKK      TVG+DG++++ H ++ +R+  +V +L  E  ++FV  LSE GSGKGAA + A+++
Sbjct:   20 KKVDRFLYAMRLSDEQLLEISHRFRDEMEKGLSRESNAAAALKMLPTHVFSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGNRKVQMESEIFPIPEEVINGRGTDLFDHVADSLKNFMQKNNINQKKKPLGFTFSFPCLQSKLDEGVLLSWSKNYKARGVQGTNVVQALRQAINKTGGIDVDVLALVNDTVGTMMTCGYDDQHCEVGVIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGALHDFITGFDSEIDAASINPGKQLFEKMVSGMYMGELVRLILLKMAKRGLLFKGRVSDALRTKGKFQTQHVSMIEEYKDGL-RNTREILTE-LGLTPTED-DCIAVQHVCTIVSFRSANLCAAALAAILTRIRENKKLKSLRTTVGMDGTVYRTHPQYSKRLHKVVRRLVPECHVRFV--LSESGSGKGAAMVTAVAQ 461          
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008354.1 (pep scaffold:Pmarinus_7.0:GL478372:35293:41413:-1 gene:ENSPMAG00000007525.1 transcript:ENSPMAT00000008354.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 354.369 bits (908), Expect = 3.871e-116
Identity = 190/444 (42.79%), Postives = 278/444 (62.61%), Query Frame = 2
Query:   83 LEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKII---ETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            L+   L  D   QV   +  +M+ GL   THD AS+KM PS+V   P G E G++LALDLGGTN+RVL V +      + +      Y IP + M G  ++LFD IA+ L DF++   +    + L FTFSFPC Q  L+ + LV WTKGF  +  EG ++ +LL++AI    + D+  VAVVNDTVGT+ +C   D +C VG+IVGTGTN  Y+E++  VE   GD+     + +N EWGAFG+DG LD   TE+D +LD  SL+P +Q++EKM SGMYLGE+VR++LV L  + LLF G+V  +L T GSF T+++S +E++   L      + +  L V S +D +AA +  +C  V+TR+A+   +G+A ++ RI      ++ + TVG+DGS++K H +F +R+ D +  L  E ++ F+  LSEDGSGKGAA + A++
Sbjct:   26 LQSLVLSNDILCQVRVRMRAAMDAGLGQQTHDAASIKMLPSFVRSTPDGTERGEYLALDLGGTNFRVLRVKIADESGQQKVFMENEIYVIPKEAMAGTAEQLFDLIAKCLSDFLEKRNIKSQKLPLAFTFSFPCKQTKLDESTLVTWTKGFKTSGVEGRDIVQLLREAIKRRGDFDIDVVAVVNDTVGTMMTCGYDDQRCEVGLIVGTGTNVCYMEELSNVELVEGDE---GRMCVNTEWGAFGDDGALDDVLTEFDRELDHNSLNPGKQLYEKMISGMYLGEIVRLVLVKLTEEGLLFGGKVSSALGTKGSFETRFVSAMEKENVGLEKAEKILKDLGLQV-SVQDCEAACL--ICCLVSTRSAHLCAAGLAAVVTRIRQNQAKDRLQTTVGVDGSVYKLHPQFSQRLQDALKLLVPECEVHFI--LSEDGSGKGAAMVTAVA 461          

HSP 2 Score: 104.375 bits (259), Expect = 5.046e-24
Identity = 54/149 (36.24%), Postives = 80/149 (53.69%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCK--PKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKL 505
            +++ E L P  L     + V   L E M +GL   +H  ASVKM PSYV  +P G EEG+FL LDLGG N+ V+LV L    +    I +  Y++P +   G  ++LFD++A+   + ++        I++G  FSFPC Q  L    +
Sbjct:  469 RQIDEKLAPLKLDHKVLKDVKRHLREEMERGLKCESHKEASVKMLPSYVRTIPNGNEEGEFLTLDLGGGNFIVMLVKLPGGGRREASIFKKIYSVPENIQRGTAEKLFDHLAECAGELLQESGRSGRSIHVGLIFSFPCRQGSLGEVTM 617          
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Match: gck (glucokinase (hexokinase 4) [Source:ZFIN;Acc:ZDB-GENE-060825-204])

HSP 1 Score: 318.161 bits (814), Expect = 1.323e-104
Identity = 176/417 (42.21%), Postives = 253/417 (60.67%), Query Frame = 2
Query:   47 MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT---YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVER--DPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFH 1258
            +  R  ++V ++L  F L   +  +VMH +   M +GL + TH  ASVKM P+YV   P G E G FLALDLGGTN+RV+LV + QN + +  +ET    Y IP D M G  + LFDYIA+ + +++    +    + LGFTFSFP     L+   L+ WTKGF+AT  EG NV ELL++AI    + D+  VA+VNDTV T+ SC  +D    +G+IVGTG N  Y+E++  V+   GD+     + INMEWGAFG+ G L+  R EYD K+DE S +  QQ+FEK+ SG Y+GELVR++++ L ++ LLF G+  + L+T   F TKY+S++E   D   +    + +L   L     E R   +VR  C+ V+ RAA    +G+A ++N+I +       EITVG+DGS++K H
Sbjct:    2 VSGRAGQQVEQLLLEFVLDQQELEEVMHRMRREMERGLRLETHQEASVKMLPTYVRSTPDGSEVGDFLALDLGGTNFRVILVKVGQNEEGEWRVETKNELYCIPEDVMTGTAEMLFDYIAECIANYLDKLNMKHKKLPLGFTFSFPVKHVDLDKGILINWTKGFTATGAEGNNVVELLREAIKRRGDFDMDVVAMVNDTVATMISCYYEDHNTEIGMIVGTGCNTCYMEEMRNVDLVEGDEG----MCINMEWGAFGDSGELEDLRLEYDRKVDETSNNRGQQLFEKIISGKYMGELVRLLVMKLTNQGLLFGGKASEKLQTHFKFETKYVSQIESSDDGAEMKQTLNVLLGLGLQPTEAECR---LVRRSCQAVSRRAASLCAAGMAAVVNKIRENRSLEQLEITVGVDGSVYKLH 411          
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000091.1 (pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 3.790e-66
Identity = 118/265 (44.53%), Postives = 172/265 (64.91%), Query Frame = 2
Query:  503 LVRWTKGFSATDCEGENVAELLQQAI---NNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVG-TGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLS-EVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNR------INKKEITVGIDGSLFKFHTK 1264
            LV WTKGF A+ CEG++V  LL++AI   N   LDV  VAVVNDTVGT+ +CA +D KC +G+IVG TG+N  Y+E +  +E   GD+     + INMEWGAFG+DG LD  RTEYD ++D  SL+P QQIFEKM SG+YLGELVR+ILV +  + LLF G+    L T G F T+++   V+R    +      +L++  ++   E+ D A ++ +C  V+TR+AY + + +  +++R      + K + TVG+DG+++K H +
Sbjct:    4 LVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDV--VAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEGDE---GRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQFMCVPVQRSKEGVLK-ARELLSDHFSLRPSEE-DCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTHPQ 261          
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000092.1 (pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000092.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.075 bits (536), Expect = 2.836e-65
Identity = 117/264 (44.32%), Postives = 168/264 (63.64%), Query Frame = 2
Query:  503 LVRWTKGFSATDCEGENVAELLQQAI---NNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVG-TGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNR------INKKEITVGIDGSLFKFHTK 1264
            LV WTKGF A+ CEG++V  LL++AI   N   LDV  VAVVNDTVGT+ +CA +D KC +G+IVG TG+N  Y+E +  +E   GD+     + INMEWGAFG+DG LD  RTEYD ++D  SL+P QQIFEKM SG+YLGELVR+ILV +  + LLF G+    L T G F T+      R    +      +L++  ++   E+ D A ++ +C  V+TR+AY + + +  +++R      + K + TVG+DG+++K H +
Sbjct:    4 LVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDV--VAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEGDE---GRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQNPRVCRRSKEGVLK-ARELLSDHFSLRPSEE-DCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTHPQ 260          
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000094.1 (pep scaffold:Pmarinus_7.0:GL478056:170806:181090:-1 gene:ENSPMAG00000000082.1 transcript:ENSPMAT00000000094.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 210.69 bits (535), Expect = 4.654e-65
Identity = 114/264 (43.18%), Postives = 168/264 (63.64%), Query Frame = 2
Query:  503 LVRWTKGFSATDCEGENVAELLQQAINNLN-LDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVG-TGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERD----PPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNR------INKKEITVGIDGSLFKFH 1258
            LV WTKGF A+ CEG++V  LL++AI   N  ++  VAVVNDTVGT+ +CA +D KC +G+IVG TG+N  Y+E +  +E   GD+     + INMEWGAFG+DG LD  RTEYD ++D  SL+P QQIFEKM SG+YLGELVR+ILV +  + LLF G+    L T G F T++   ++ D              +L++  ++   E+ D A ++ +C  V+TR+AY + + +  +++R      + K + TVG+DG+++K H
Sbjct:    4 LVNWTKGFKASGCEGKDVVMLLREAIQRRNEFELDVVAVVNDTVGTMMTCAYEDPKCEIGLIVGGTGSNCCYMEDLRNIEQVEGDE---GRMCINMEWGAFGDDGSLDDIRTEYDLEVDAGSLNPGQQIFEKMISGLYLGELVRLILVKMTTQALLFNGKATPELLTRGHFQTQFSLAIDVDILMRSKEGVLKARELLSDHFSLRPSEE-DCAALQQICAIVSTRSAYLVAAALGAVVSRLRLNKAVKKLQTTVGVDGTVYKTH 263          
BLAST of Phosphotransferase vs. Ensembl Yeast
Match: HXK1 (Hexokinase isoenzyme 1; a cytosolic protein that catalyzes phosphorylation of glucose during glucose metabolism; expression is highest during growth on non-glucose carbon sources; glucose-induced repression involves hexokinase Hxk2p; HXK1 has a paralog, HXK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001949])

HSP 1 Score: 246.128 bits (627), Expect = 4.213e-76
Identity = 171/463 (36.93%), Postives = 252/463 (54.43%), Query Frame = 2
Query:   47 MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKE-LFDYIAQTLQDFVK----IHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIG----DKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNV-ASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPER----MTDI---VHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE 1384
            +P  L  E+ ++ + F +  +  R+V+    + +NKGL   T    ++ M P +V + PTGKE G +LA+DLGGTN RV+LV L  N      ++ Y +P D    K +E L+ +IA +L+DF+     ++T D  P  LGFTFS+P SQ  +N   L RWTKGF   + EG +V  LLQ  I+   L ++ VA++NDTVGTL +    D +  +GVI GTG N ++ + +  +E   G    D      + IN E+G+F ++  L   RT+YD  +DEQS  P QQ FEKM SG YLGEL+R++L++L  K L+ + +    L+ P    T Y + +E DP      T  +  +D  V  +  +R   ++R +CE + TRAA     GIA +  +   K   +  DGS++  +  F E     + DI         + I  V   +EDGSG GAA IAALSE
Sbjct:   19 VPKELMDEIHQLEDMFTVDSETLRKVVKHFIDELNKGL---TKKGGNIPMIPGWVMEFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFDTTQSKYKLPHDMRTTKHQEELWSFIADSLKDFMVEQELLNTKDTLP--LGFTFSYPASQNKINEGILQRWTKGFDIPNVEGHDVVPLLQNEISKRELPIEIVALINDTVGTLIASYYTDPETKMGVIFGTGVNGAFYDVVSDIEKLEGKLADDIPSNSPMAINCEYGSF-DNEHLVLPRTKYDVAVDEQSPRPGQQAFEKMTSGYYLGELLRLVLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIEDDPFENLEDTDDIFQKDFGVKTTLPER--KLIRRLCELIGTRAARLAVCGIAAICQKRGYKTGHIAADGSVYNKYPGFKEAAAKGLRDIYGWTGDASKDPITIV--PAEDGSGAGAAVIAALSE 471          
BLAST of Phosphotransferase vs. Ensembl Yeast
Match: HXK2 (Hexokinase isoenzyme 2; phosphorylates glucose in cytosol; predominant hexokinase during growth on glucose; represses expression of HXK1, GLK1, induces expression of its own gene; antiapoptotic; phosphorylation/dephosphorylation at Ser14 by kinase Snf1p, phosphatase Glc7p-Reg1p regulates nucleocytoplasmic shuttling of Hxk2p; functions downstream of Sit4p in control of cell cycle, mitochondrial function, oxidative stress resistance, chronological lifespan; has paralog HXK1 [Source:SGD;Acc:S000003222])

HSP 1 Score: 228.794 bits (582), Expect = 1.499e-69
Identity = 138/426 (32.39%), Postives = 222/426 (52.11%), Query Frame = 2
Query:   59 LPKEVVEILEPFD----LKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIP-ADKMCGKGKELFDYIAQTLQDFV--KIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIG----DKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNV-ASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQL 1300
            +PKE+++ +E F+    +  +  + V       + KGL   +    ++ M P +V   PTGKE G FLA+DLGGTN RV+LV L  +      ++ Y +P A +      EL+++IA +L+ F+  +       PI LGFTFSFP SQ  +N   L RWTKGF   + E  +V  +LQ+ I   N+ ++ VA++NDT GTL +    D +  +GVI GTG N +Y +    +E   G    D      + IN E+G+F  +  +   RT+YD  +DE+S  P QQ FEKM SG YLGE++R+ L+D+  +  +F+ +     + P    T Y + +E DP      T  +   +  +  + ++R   ++R + E +  RAA     GIA +  +   K   +  DGS++  +  F E+  + +  +
Sbjct:   19 VPKELMQQIENFEKIFTVPTETLQAVTKHFISELEKGL---SKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKLQGKLSDDIPPSAPMAINCEYGSFDNEHVV-LPRTKYDITIDEESPRPGQQTFEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARIEEDPFENLEDTDDLFQNEFGINTTVQER--KLIRRLSELIGARAARLSVCGIAAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDI 438          
BLAST of Phosphotransferase vs. Ensembl Yeast
Match: GLK1 (Glucokinase; catalyzes the phosphorylation of glucose at C6 in the first irreversible step of glucose metabolism; one of three glucose phosphorylating enzymes; expression regulated by non-fermentable carbon sources; GLK1 has a paralog, EMI2, that arose from the whole genome duplication [Source:SGD;Acc:S000000545])

HSP 1 Score: 212.616 bits (540), Expect = 2.578e-63
Identity = 161/488 (32.99%), Postives = 253/488 (51.84%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVAT--HDTASVK---MFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGK---GKELFDYIAQTLQDFVKIHTVDKW-------PINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLD-VKCVAVVNDTVGT-LTSCALQD----------CKCGVGVIVGTGTNASYVEKIDKVETFIGD------KTGLDYVVINMEWGAFGEDGCLDRF-RTEYDSKLDEQ-SLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLF-----RGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLL---NRINKK---EITVGIDGSLFKFHTKFPE--RMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            + V +I + F++  +   ++     E M KGLA     H  AS K   M P++VT  P G E G  LA DLGGTN+R+  V+L  +    + +    IP D +  +     +LF ++A+    F+K +  D+        P+ LGFTFS+P  Q  LN+  L+RWTKGF   D  G++V +L Q+ ++   +  +K VA+ NDTVGT L+ C   D           +  +G I GTGTN  Y+E+I+K+     +      K G  +++IN+EWG+F  D  L     T+YD  +D++ S +P   +FEK  SGM+LGE++R ILVDL  + LL      + ++P+ L TP    ++ LS +E D       T   L + L + +       I + V   ++ R+AY     +A +L   N +NK+   E+ +G DGS+ +++  F    R    +  L  E + K  LK+++DGSG GAA  A ++
Sbjct:   16 QAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDKGLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDDENVTSDDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRWTKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGEISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSF--DNELKHLPTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPRHLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLV-RAISRRSAYLAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKVHLKIAKDGSGVGAALCALVA 500          
BLAST of Phosphotransferase vs. Ensembl Yeast
Match: EMI2 (Non-essential protein of unknown function; required for transcriptional induction of the early meiotic-specific transcription factor IME1; required for sporulation; expression regulated by glucose-repression transcription factors Mig1/2p; EMI2 has a paralog, GLK1, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002924])

HSP 1 Score: 206.453 bits (524), Expect = 5.587e-61
Identity = 160/494 (32.39%), Postives = 244/494 (49.39%), Query Frame = 2
Query:   59 LPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGL---AVATHDTA--SVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGK---GKELFDYIAQTLQDFVKIHTVDKW--------PINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLD-VKCVAVVNDTVGT-LTSCALQDCKCG---------VGVIVGTGTNASYVEKIDKVETFIGD------KTGLDYVVINMEWGAFGEDGCLDRFR-TEYDSKLDEQ-SLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLL---FRG--EVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNV-ASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLL---NRINKK---EITVGIDGSLFKFHTKFPERMTDIVHQLKNEDI------KFVLKLSEDGSGKGAAAIAALS 1381
            L   VVEI     +      ++     E M KGL   +V    T    + M P+YVT LP G E G  LA DLGGT++RV  V+L  +    + +    IP + +  K    +ELF Y+ +  + FV+ H  +          P+ +GFTFS+P  Q  L++  L+RWTK F   D  G++V  L Q+ ++   L  +  VA+ NDTVGT L+ C     +           +G I GTGTN  Y+E I+ ++    +        G   + IN+EWG+F  D  L     T+YD  +D++ S +P   +FEK  SGMYLGEL+R ILVDL  + L+   +R   ++P  L+TP    ++ LS +E D       T     + L +  +FE+R A  ++ +   +  R+AY     IA +L   N +NK+   E+ +G DG + +++  F   +    H L    I      K  L+L++DGSG GAA  A ++
Sbjct:   14 LEDAVVEICSSLQVDAAKLDELTAYFIECMEKGLNNTSVGEEKTVDKGLPMIPTYVTSLPNGTERGVLLAADLGGTHFRVCSVTLNGDGTFDMQQLKSKIPEEYLNDKDVTSEELFSYLGRRTRAFVRKHHPELLKSTGENIKPLKMGFTFSYPVDQTSLSSGTLIRWTKSFKIEDTVGKDVVRLYQEQLDIQGLSMINVVALTNDTVGTFLSHCYTSGSRPSSAGEISEPVIGCIFGTGTNGCYMEDIENIKKLPDELRTRLLHEGKTQMCINIEWGSF--DNELKHLSATKYDIDIDQKFSPNPGYHLFEKRISGMYLGELLRNILVDLHARGLILGQYRNYDQLPHRLKTPFQLCSEVLSRIEIDDSTNLRETELSFLQSLRLPTTFEERKA--IQNLVRSITRRSAYLAAVPIAAILIKTNALNKRYHGEVEIGFDGYVIEYYPGFRSMLR---HALALSPIGTEGERKIHLRLAKDGSGVGAALCALVA 500          
BLAST of Phosphotransferase vs. Ensembl Nematostella
Match: EDO43108 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ9])

HSP 1 Score: 315.849 bits (808), Expect = 1.785e-103
Identity = 176/407 (43.24%), Postives = 245/407 (60.20%), Query Frame = 2
Query:  146 MNKGLAV--ATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNL-DVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKG 1357
            M+ GL+      + + +KM P+YV ++P G E G FLALDLGGTN+RVLLV +  N K  +    + +    M      LFDYIA  +  FVK  ++    + LGFTFSFP  Q  L +  L+RWTKGFSA   EGE+V  LL+ A++  N   V  VA+VNDT GT+ +C   D     G+I+GTGTNA Y+E +D V+ +  ++   + V+IN EWGAFG+ G L+   TE+D K+D +S++P QQ+FEKM SGMYLGEL R I +DL+H+ LL  G     L+T GSF TK++S++E    +       +L E L+V +   RD  I+R +C  V+ RAA    +G+A ++ +      T+ IDG+LFK H KF   M + + +L   D    L LSEDGSGKG
Sbjct:    1 MDNGLSADPKARENSPIKMLPTYVRRMPDGSESGDFLALDLGGTNFRVLLVQV-LNGKVHMESEIFPLDQTLMTSDSITLFDYIADCITLFVKKKSLQDKTLPLGFTFSFPVQQLSLTSGLLIRWTKGFSAGGVEGEDVVRLLKDALHRKNSHSVDVVALVNDTTGTMMACGFDDRNVIAGLILGTGTNACYMESLDNVKKWNEERGCSNEVIINTEWGAFGDSGVLNWIITEHDKKIDVESINPGQQVFEKMISGMYLGELARHICMDLIHRGLLLNGIASNKLKTKGSFLTKFVSDIESGDENKL---QQVLKE-LDVKATA-RDQEILRHICTAVSKRAARLASAGLATIVKKTKAYNSTIAIDGTLFKKHPKFKPYMQEALKELL-PDSHLKLMLSEDGSGKG 400          
BLAST of Phosphotransferase vs. Ensembl Nematostella
Match: EDO26338 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC96])

HSP 1 Score: 53.5286 bits (127), Expect = 1.277e-9
Identity = 24/49 (48.98%), Postives = 32/49 (65.31%), Query Frame = 2
Query:  119 QVMHLLEESMNKGLAV--ATHDTASVKMFPSYVTKLPTGKEEGQFLALD 259
            QVM LLEE M+ GL+      + + +KM P+YV ++P G E G FLALD
Sbjct:    8 QVMKLLEEDMDNGLSADPKARENSPIKMLPTYVRRMPDGSESGDFLALD 56          
BLAST of Phosphotransferase vs. Ensembl Medaka
Match: hk1 (hexokinase-1 [Source:NCBI gene;Acc:101156878])

HSP 1 Score: 385.956 bits (990), Expect = 2.994e-124
Identity = 211/455 (46.37%), Postives = 292/455 (64.18%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINN---LNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKE------ITVGIDGSLFKFHTKFPERMTDIVHQLKNE-----DIKFVLKLSEDGSGKGAAAIAAL 1378
            K++V+IL  F L  +   +V + +   +  GL+  THD+A+VKM P++V   P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V  LL++AI       LDV  VA+VNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  VE   GD+     + +NMEWGAFG++GCLD  RTEYD  +D+ SL+P +Q +EKMCSGMYLGE+VR IL+D+  K  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +        ITVG+DG+L+K H  F    + I+HQ  NE      + F+  LSEDGSGKGAA I A+
Sbjct:  468 KQIVQILSEFRLTTEQLLEVKNRMRVEIQNGLSKRTHDSATVKMLPTFVQSTPNGTEHGDFLALDLGGTNFRVLLVKIRSG-KKRSVEMHNKIYAIPLEVMQGTGEELFDHIVHCISDFLDYMGMKNARLPLGFTFSFPCKQTSLDAGTLVTWTKGFKATDCEGEDVVGLLREAIKRREEFELDV--VAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNVEMVDGDE---GQMCVNMEWGAFGDNGCLDDMRTEYDRAVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKKGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRSIL--QHLGLDSTCD-DSIIVKEVCGIVSRRAAQLCGAGMAAVVDKIRENRGVDHLNITVGVDGTLYKLHPHF----SGIMHQTVNELAPKCSVNFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 315.464 bits (807), Expect = 1.600e-97
Identity = 174/448 (38.84%), Postives = 267/448 (59.60%), Query Frame = 2
Query:  101 KVDDYRQVMHLLEESM-----------NKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNR------INKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            K+D Y   M   +E++            KGL   T+ TAS+KM P++V  +P G E+G F+ALDLGG+ +R+L V +    K  + +E+  +  P D + G G +LFD++A+ L  F++ H +    + +GFTFSFPC Q  L+   L+ WTK F A+  EG +V  LL +AI    + +   +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + +N EWGAFG+DG L+  RTE+D ++D  SL+P +Q+FEKM SG+Y+GELVR+ILV +  + LLF G++   + T G F TK++S +E+    L      +    L V    D D   V+ +C  V+ R+A  + + +A +L R      + +   TVGIDGSL+K H ++  R+   V +L  + D++F+  LS  GSGKGAA + A++
Sbjct:   21 KIDKYLYSMRFSDETLLDITNRFRMELVKGLGRDTNATASLKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIFDTPEDIIHGTGTQLFDHVAECLGTFMEKHNIKDKKLPVGFTFSFPCQQAKLDEGYLITWTKSFKASGVEGMDVVNLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDE---GRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAREGLLFEGQITPEMLTKGKFETKHVSAIEKSKEGLTKARDVL--SKLGVEPSAD-DCVAVQHICSIVSHRSANLVAAVLAGILMRLKENKGVGRLRTTVGIDGSLYKMHPQYSRRLHKTVRRLVPDCDVRFL--LSNSGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Medaka
Match: HK1 (hexokinase-1 [Source:NCBI gene;Acc:101157032])

HSP 1 Score: 374.785 bits (961), Expect = 6.530e-120
Identity = 203/451 (45.01%), Postives = 287/451 (63.64%), Query Frame = 2
Query:   65 KEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIET---TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINN---LNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAAL 1378
            +++ + L  F L      +V   ++  + +GL   TH  A+VKM P++V + P G E G FLALDLGGTN+RVLLV ++   K + +E     YAIP + M G G+ELFD+I   + DF+    +    + LGFTFSFPC Q  L+   LV WTKGF ATDCEGE+V ELL++AI       LDV  VA+VNDTVGT+ +CA ++  C VG+I GTG+NA Y+E++  +ET  G +     + +NMEWGAFG++GCLD  RT+YD  +DE SL+  +Q +EKMCSGMYLGE+VR IL+DL  +  LFRG++ ++L+T G F TK+LS++E D   L      +  + L + S  D D+ IV+ VC  V+ RAA   G+G+A ++++I +       ++TVG+DG+L+K H  F       V +L  + D+ F+  LSEDGSGKGAA I A+
Sbjct:  468 RQIQQTLAEFRLNKSQLLEVKKRMKVEIERGLRKETHKEATVKMLPTFVRRTPDGTENGDFLALDLGGTNFRVLLVKIRSG-KRRSVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGFTFSFPCHQTSLDAGILVNWTKGFKATDCEGEDVVELLREAIKRKEEFELDV--VAIVNDTVGTMMTCAYEEPTCEVGLIAGTGSNACYMEEMKNIETVPGTE---GRMCVNMEWGAFGDNGCLDDIRTKYDQAVDENSLNEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDRLALLQVRAIL--QQLGLDSTCD-DSIIVKEVCGTVSRRAAQICGAGMAAVVDKIRENRGLDHLDVTVGVDGTLYKLHPHFSRIFLQTVKELAPKCDVNFL--LSEDGSGKGAALITAV 907          

HSP 2 Score: 334.339 bits (856), Expect = 1.573e-104
Identity = 180/435 (41.38%), Postives = 267/435 (61.38%), Query Frame = 2
Query:  107 DDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCK-PKIIET-TYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRIN------KKEITVGIDGSLFKFHTKFPERMTDIVHQL-KNEDIKFVLKLSEDGSGKGAAAIAALS 1381
            D  + +M+     M  GL   T+ TA+VKM P++V  +P G E+G F+ALDLGG+N+R+L V + Q+ K P  +E+  Y  P D + G G +LFD++A+ L DF++   +    + +GFTFSFPC+Q  L+ A L+ WTK F A+  EG +V +LL +AI    +     +AVVNDTVGT+ +C   D +C VG+I+GTGTNA Y+E++  ++   GD+     + IN EWGAFG+DG L+  RTE+D ++D  S++P +Q+FEKM SGMY+GELVR+ILV +  + LLF G +   L T G   TK++S +E+    L  C   +    L V    D D   V+ VC  V+ R+A  I + +  +L R+       +   TVGIDGSL+K H ++  R+   V +L  + D++F+  LSE GSGKGAA + A++
Sbjct:   34 DTLKDIMNRYRREMESGLGRDTNATATVKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVTQDKKQPVQMESQAYDTPDDIIHGSGTQLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKKFKASGVEGMDVVKLLNKAIKKRGDYQADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYMEELRHIDLVEGDE---GRMCINTEWGAFGDDGSLEDLRTEFDREIDRGSMNPGKQLFEKMVSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKIETKHVSAIEKSKEGLKKCMEILTR--LGVEP-SDEDCLAVQHVCTIVSFRSANLISATLGAILCRLKDNKGVARLRTTVGIDGSLYKMHPQYARRLHKTVRRLVPDSDVRFL--LSESGSGKGAAMVTAVA 460          
BLAST of Phosphotransferase vs. Ensembl Medaka
Match: gck (glucokinase [Source:NCBI gene;Acc:101168372])

HSP 1 Score: 352.443 bits (903), Expect = 2.348e-116
Identity = 198/449 (44.10%), Postives = 284/449 (63.25%), Query Frame = 2
Query:   71 VVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT---YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            V +IL  F L  ++ ++VM  ++  M++GL + +H+ ASVKM P+YV   P G E G FLALDLGGTN+RV+LV + ++ +    +ETT   Y+IP D M G  + LFDYIA+ + DF+  H +    + LGFTFSFP     ++   L+ WTKGF A+  EG NV  LL+ AI    + ++  VA+VNDTV T+ SC  +D  C VG+IVGTG NA Y+E++  VE   G++  +    +N EWGAFG+ G L+ FR EYD  +DE S++P QQ+FEK+ SG Y+GELVR++L+ LV +NLLF GE  + L T GSF T+++S+VE D         Y +   L V   E  D  IVR VCE V+TR+A   G+G+A ++NR+ ++      +ITVG+DGS++K H  F +R   +V  L    +I F+   SE+GSG+G A I+A++
Sbjct:   28 VEQILSEFRLNKEELKEVMKRMQREMDRGLRLESHEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGKDEERGFKVETTNQMYSIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGCNACYMEEMRTVELVEGEEGRM---CVNTEWGAFGDKGELEEFRLEYDRVVDEFSINPGQQLFEKLISGKYMGELVRLVLMKLVKENLLFNGEASEQLRTRGSFETRFVSQVESDSGDRKQI--YNILSSLGVLPSE-LDCDIVRLVCESVSTRSAQMCGAGLAGVINRMRERRCEEELKITVGVDGSVYKLHPWFRDRFHKVVWDLSPHCEITFI--QSEEGSGRGVALISAVA 468          
BLAST of Phosphotransferase vs. Ensembl Medaka
Match: gck (glucokinase [Source:NCBI gene;Acc:101168372])

HSP 1 Score: 348.206 bits (892), Expect = 5.034e-115
Identity = 195/442 (44.12%), Postives = 280/442 (63.35%), Query Frame = 2
Query:   92 FDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKI-IETT---YAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKK------EITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALS 1381
            F L  ++ ++VM  ++  M++GL + +H+ ASVKM P+YV   P G E G FLALDLGGTN+RV+LV + ++ +    +ETT   Y+IP D M G  + LFDYIA+ + DF+  H +    + LGFTFSFP     ++   L+ WTKGF A+  EG NV  LL+ AI    + ++  VA+VNDTV T+ SC  +D  C VG+IVGTG NA Y+E++  VE   G++  +    +N EWGAFG+ G L+ FR EYD  +DE S++P QQ+FEK+ SG Y+GELVR++L+ LV +NLLF GE  + L T GSF T+++S+VE D         Y +   L V   E  D  IVR VCE V+TR+A   G+G+A ++NR+ ++      +ITVG+DGS++K H  F +R   +V  L    +I F+   SE+GSG+G A I+A++
Sbjct:   12 FRLNKEELKEVMKRMQREMDRGLRLESHEEASVKMLPTYVCSTPEGSEVGDFLALDLGGTNFRVMLVKVGKDEERGFKVETTNQMYSIPEDAMTGTAEMLFDYIAECMSDFLDKHHIKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIKRRGDFEMDVVAMVNDTVATMISCYYEDRSCEVGMIVGTGCNACYMEEMRTVELVEGEEGRM---CVNTEWGAFGDKGELEEFRLEYDRVVDEFSINPGQQLFEKLISGKYMGELVRLVLMKLVKENLLFNGEASEQLRTRGSFETRFVSQVESDSGDRKQI--YNILSSLGVLPSE-LDCDIVRLVCESVSTRSAQMCGAGLAGVINRMRERRCEEELKITVGVDGSVYKLHPWFRDRFHKVVWDLSPHCEITFI--QSEEGSGRGVALISAVA 445          
BLAST of Phosphotransferase vs. Ensembl Medaka
Match: ENSORLT00000028896.1 (hexokinase-2 [Source:NCBI gene;Acc:101165960])

HSP 1 Score: 340.887 bits (873), Expect = 5.435e-112
Identity = 190/454 (41.85%), Postives = 285/454 (62.78%), Query Frame = 2
Query:   53 NRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKP--KIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNL-NLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRI------NKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNE-DIKFVLKLSEDGSGKGAAAIAALSE 1384
            NRL  +V + LEPF L ++  + V   L + M +GL   +H  ASVKM P++V   P G E+G FLALDLGGTN+RVL V + +  +   K+     AIP D M G G++LFD+IA  L +F+    +    + LGFTFSFPC Q  ++ + L+RWTKGF+ +  EGE+V  LL++AI+   + D+  VA+VNDTVGT+ SC  +D  C +G+I+GTGTNA Y+E++  V+   G+      + IN EWG FG+DGCL    TE+D ++D+ S++P    FEKM SGMYLGE+VR++L+ L  + LLFRG   ++L TPGSF T+++SE+E     L      +   DL+   ++  DA + R VC+ V++R+A    + +A ++NRI      +  + TVG+DG++++ H  F + +   V  L  + D+ F+  +SEDGSGKGAA + A+++
Sbjct:    4 NRLHLKVQKHLEPFRLSLEKLQDVSARLRKDMIRGLGKHSHHRASVKMLPTFVRATPDGTEKGDFLALDLGGTNFRVLHVRVLEEEQRVLKMDSQICAIPQDIMLGTGEKLFDHIAACLAEFLDSQKLRGQTLPLGFTFSFPCEQKEIDKSILIRWTKGFNCSGVEGEDVVNLLKEAIHRRGDYDISSVAMVNDTVGTMMSCGYRDQSCEIGMIIGTGTNACYMEEMKNVKRVEGED---GRMCINTEWGGFGDDGCLKDVLTEFDEEVDKTSINPGVHTFEKMISGMYLGEIVRLVLLKLTEEKLLFRGCPSEALLTPGSFETRFISEIEEPDSGLENAKKILTKLDLD---WDLVDACVARLVCDTVSSRSARLCAAALATIVNRIRINRGLDHLKTTVGVDGTVYRKHPNFSDELQAAVRLLAPKCDVTFL--ISEDGSGKGAAMVTAVAQ 449          
BLAST of Phosphotransferase vs. Planmine SMEST
Match: SMESG000043559.1 (SMESG000043559.1)

HSP 1 Score: 925.235 bits (2390), Expect = 0.000e+0
Identity = 446/446 (100.00%), Postives = 446/446 (100.00%), Query Frame = 2
Query:   47 MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE 1384
            MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE
Sbjct:    1 MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE 446          
BLAST of Phosphotransferase vs. Planmine SMEST
Match: SMESG000034286.1 (SMESG000034286.1)

HSP 1 Score: 514.612 bits (1324), Expect = 3.192e-179
Identity = 250/445 (56.18%), Postives = 322/445 (72.36%), Query Frame = 2
Query:   56 RLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKMFPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLK-QNCKPKIIETTYAIPADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNNAKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTSCALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGL----DYVVINMEWGAFGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDLVHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNVASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSLFKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAA 1375
            ++P+EV+E+++PF     +YR V   LE  MN GL  A  D A VKMFPSYV+K+P+GKE+GQF+ALDLGGTNYR+LLV+LK  N  P+IIE+TYAIP  KM G G+ LFD+IA+T+ DF+K   +    I+LGFTFSFPC+Q GL+   L RWTKGFSAT+ EG+NV ELL  A+  LNL V C A+VNDTVGTL SC+ +   C +G+IVGTG+NA Y+E + KV T   DKT L     +++IN EWGAFGE+G L+  RT+YD  +D+ SLHP +QIFEK+ SGMYLGE+VR++LV+L+ K LLF+G +P ++  P SF TKY+S+ ERDPPHL Y T YML  +L V + +  D  I+R  CE VA RAAY  GS IA L+N++N+  +T+G+DGSLF+ H  F   M  I+ Q KN   +F LKLSEDGSGKGAAAI A
Sbjct:   86 QIPEEVMEMMKPFRPSESNYRNVTKRLELDMNMGLDPAHRDKACVKMFPSYVSKVPSGKEKGQFMALDLGGTNYRILLVTLKGNNAPPEIIESTYAIPEIKMSGPGEALFDFIAETINDFLKSKKIPDKTISLGFTFSFPCNQKGLDVGILTRWTKGFSATNVEGKNVVELLGVALKKLNLKVSCKALVNDTVGTLASCSFEHPDCAIGLIVGTGSNACYIEDLSKVLTV--DKTALMKNAKFIIINTEWGAFGENGTLEDIRTKYDRAMDKNSLHPGKQIFEKLISGMYLGEIVRLVLVELIEKKLLFKGNLPDAMRKPYSFLTKYMSDCERDPPHLHYSTEYMLRNELLVNTIDSLDCKIIRYCCEIVARRAAYLAGSAIAVLINKMNRPTVTIGVDGSLFRHHPSFAANMNAIIKQFKNPKCEFRLKLSEDGSGKGAAAIVA 528          
The following BLAST results are available for this feature:
BLAST of Phosphotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HK25.978e-12146.85hexokinase 2 [Source:HGNC Symbol;Acc:HGNC:4923][more]
HK21.287e-12046.85hexokinase 2 [Source:HGNC Symbol;Acc:HGNC:4923][more]
HK15.828e-11744.99hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK17.137e-11744.99hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
HK17.137e-11744.99hexokinase 1 [Source:HGNC Symbol;Acc:HGNC:4922][more]
back to top
BLAST of Phosphotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hxk-12.379e-12544.79Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-12.379e-12544.79Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-14.339e-12545.83Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-23.246e-9738.24Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
hxk-34.662e-8434.23Phosphotransferase [Source:UniProtKB/TrEMBL;Acc:U... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hex-A3.571e-12944.75gene:FBgn0001186 transcript:FBtr0333335[more]
Hex-A3.571e-12944.75gene:FBgn0001186 transcript:FBtr0071362[more]
Hex-A1.234e-12844.77gene:FBgn0001186 transcript:FBtr0071361[more]
Hex-t26.708e-12141.93gene:FBgn0042710 transcript:FBtr0085011[more]
Hex-C1.153e-11944.32gene:FBgn0001187 transcript:FBtr0087399[more]
back to top
BLAST of Phosphotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk11.151e-12245.21hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hk17.081e-12245.21hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hk17.081e-12245.21hexokinase 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2848... [more]
hkdc12.380e-11743.56hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
hk25.110e-11744.62hexokinase 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2017... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk13.839e-12244.54hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk11.613e-12144.54hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
hk16.364e-12144.54hexokinase 1 [Source:NCBI gene;Acc:100124752][more]
HK26.892e-12044.59hexokinase domain containing 1 [Source:NCBI gene;A... [more]
HK21.247e-11944.59hexokinase domain containing 1 [Source:NCBI gene;A... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hk22.059e-11845.72hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197][more]
Hk24.977e-11845.72hexokinase 2 [Source:MGI Symbol;Acc:MGI:1315197][more]
Hkdc11.661e-11742.41hexokinase domain containing 1 [Source:MGI Symbol;... [more]
Hk11.413e-11444.32hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103][more]
Hk11.782e-11444.32hexokinase 1 [Source:MGI Symbol;Acc:MGI:96103][more]
back to top
BLAST of Phosphotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q26609|HXK_SCHMA0.000e+060.41Hexokinase OS=Schistosoma mansoni OX=6183 PE=1 SV=... [more]
sp|P52789|HXK2_HUMAN6.182e-12046.85Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 S... [more]
sp|Q9NFT7|HXK2_DROME6.724e-12041.93Hexokinase type 2 OS=Drosophila melanogaster OX=72... [more]
sp|Q1W674|HXK2_PIG1.874e-11845.72Hexokinase-2 OS=Sus scrofa OX=9823 GN=HK2 PE=2 SV=... [more]
sp|A2PYL6|HXK2_HORSE5.518e-11845.86Hexokinase-2 OS=Equus caballus OX=9796 GN=HK2 PE=2... [more]
back to top
BLAST of Phosphotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YJ230.000e+061.02Phosphotransferase OS=Clonorchis sinensis OX=79923... [more]
A0A419PQ800.000e+061.02Phosphotransferase OS=Clonorchis sinensis OX=79923... [more]
A0A4S2LB680.000e+061.11Phosphotransferase OS=Opisthorchis felineus OX=147... [more]
G4VIV90.000e+060.41Phosphotransferase OS=Schistosoma mansoni OX=6183 ... [more]
C1L5D00.000e+059.64Phosphotransferase OS=Schistosoma japonicum OX=618... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk13.177e-12446.10hexokinase 1 [Source:NCBI gene;Acc:103028521][more]
hk19.843e-12446.10hexokinase 1 [Source:NCBI gene;Acc:103028521][more]
hkdc13.595e-12043.04hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
hkdc14.226e-12043.04hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
hkdc15.692e-12043.23hexokinase domain containing 1 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008354.13.871e-11642.79pep scaffold:Pmarinus_7.0:GL478372:35293:41413:-1 ... [more]
gck1.323e-10442.21glucokinase (hexokinase 4) [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000000091.13.790e-6644.53pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-... [more]
ENSPMAT00000000092.12.836e-6544.32pep scaffold:Pmarinus_7.0:GL478056:170800:181090:-... [more]
ENSPMAT00000000094.14.654e-6543.18pep scaffold:Pmarinus_7.0:GL478056:170806:181090:-... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
HXK14.213e-7636.93Hexokinase isoenzyme 1; a cytosolic protein that c... [more]
HXK21.499e-6932.39Hexokinase isoenzyme 2; phosphorylates glucose in ... [more]
GLK12.578e-6332.99Glucokinase; catalyzes the phosphorylation of gluc... [more]
EMI25.587e-6132.39Non-essential protein of unknown function; require... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO431081.785e-10343.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263381.277e-948.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hk12.994e-12446.37hexokinase-1 [Source:NCBI gene;Acc:101156878][more]
HK16.530e-12045.01hexokinase-1 [Source:NCBI gene;Acc:101157032][more]
gck2.348e-11644.10glucokinase [Source:NCBI gene;Acc:101168372][more]
gck5.034e-11544.12glucokinase [Source:NCBI gene;Acc:101168372][more]
ENSORLT00000028896.15.435e-11241.85hexokinase-2 [Source:NCBI gene;Acc:101165960][more]
back to top
BLAST of Phosphotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000043559.10.000e+0100.00SMESG000043559.1[more]
SMESG000034286.13.192e-17956.18SMESG000034286.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033551 ID=SMED30033551|Name=Phosphotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1533bp
TTAATTTGTATTTAAATACATTGCTAATATAACACTGTCAGTAAAAATGC
CAAACCGATTGCCAAAAGAAGTTGTAGAAATTTTGGAACCATTCGACTTG
AAAGTCGATGATTACAGACAGGTAATGCATTTATTAGAGGAAAGTATGAA
TAAAGGTCTGGCGGTCGCTACTCACGATACAGCCAGTGTAAAAATGTTCC
CATCTTATGTCACAAAGTTACCCACGGGAAAAGAAGAGGGCCAATTTCTA
GCTTTAGATCTCGGAGGCACAAACTACCGAGTTTTGCTGGTTTCATTGAA
ACAAAACTGCAAACCAAAAATTATCGAAACGACTTATGCGATTCCGGCTG
ACAAAATGTGCGGTAAAGGAAAAGAACTTTTCGATTATATTGCTCAAACC
CTGCAGGATTTCGTTAAGATACATACGGTAGATAAATGGCCGATCAATCT
CGGCTTTACCTTTTCTTTTCCCTGCTCACAATTCGGCTTGAATAACGCGA
AATTAGTTCGTTGGACGAAAGGTTTTTCAGCGACAGATTGTGAAGGTGAA
AATGTCGCTGAACTACTTCAACAAGCAATAAACAATTTAAACTTAGACGT
GAAATGCGTAGCGGTTGTCAATGATACGGTTGGCACTCTCACTTCGTGTG
CTTTGCAAGACTGCAAATGTGGGGTTGGAGTAATTGTTGGAACCGGAACC
AATGCTTCGTATGTGGAAAAAATCGATAAGGTTGAAACGTTTATTGGAGA
TAAAACCGGACTCGATTACGTTGTGATTAACATGGAATGGGGGGCATTTG
GAGAAGATGGTTGTCTTGATAGATTTCGAACGGAATATGACAGTAAGCTT
GATGAGCAATCTCTTCATCCAAAGCAACAAATATTTGAGAAAATGTGTTC
CGGTATGTATCTCGGTGAATTGGTGAGGATTATCTTGGTTGATCTCGTGC
ATAAAAATCTCCTATTTCGAGGGGAAGTTCCGCAGTCATTAGAAACACCT
GGCAGTTTCCATACGAAATATTTATCAGAAGTGGAAAGAGATCCACCACA
TCTGTTCTACTGTACACATTATATGCTCAATGAAGATCTTAACGTGGCCA
GCTTTGAGGACAGAGACGCTGCAATTGTGAGAGCTGTTTGTGAGAAAGTT
GCAACAAGAGCAGCGTATTTTATTGGCTCCGGAATCGCTTGTCTATTGAA
TCGAATTAACAAAAAGGAAATCACAGTTGGAATTGACGGATCTCTATTTA
AATTTCATACCAAATTTCCAGAAAGAATGACTGATATAGTTCATCAATTG
AAAAATGAAGACATTAAGTTTGTTCTAAAATTATCCGAAGATGGAAGCGG
CAAAGGAGCGGCAGCTATAGCAGCTCTATCAGAATAATATCTATTTTTTA
ATTAGATACCGTTATATATTTAGATTAAATGACATTAGTGAATATTTCGT
AAACTTTTAGATCAGTGATATTATTTCTTATTAATCTATTATTTGTTAAT
AATGTTATCTATTTGAATAAAATAAACATTTAT
back to top

protein sequence of SMED30033551-orf-1

>SMED30033551-orf-1 ID=SMED30033551-orf-1|Name=SMED30033551-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MPNRLPKEVVEILEPFDLKVDDYRQVMHLLEESMNKGLAVATHDTASVKM
FPSYVTKLPTGKEEGQFLALDLGGTNYRVLLVSLKQNCKPKIIETTYAIP
ADKMCGKGKELFDYIAQTLQDFVKIHTVDKWPINLGFTFSFPCSQFGLNN
AKLVRWTKGFSATDCEGENVAELLQQAINNLNLDVKCVAVVNDTVGTLTS
CALQDCKCGVGVIVGTGTNASYVEKIDKVETFIGDKTGLDYVVINMEWGA
FGEDGCLDRFRTEYDSKLDEQSLHPKQQIFEKMCSGMYLGELVRIILVDL
VHKNLLFRGEVPQSLETPGSFHTKYLSEVERDPPHLFYCTHYMLNEDLNV
ASFEDRDAAIVRAVCEKVATRAAYFIGSGIACLLNRINKKEITVGIDGSL
FKFHTKFPERMTDIVHQLKNEDIKFVLKLSEDGSGKGAAAIAALSE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR022672Hexokinase_N
IPR022673Hexokinase_C
IPR019807Hexokinase_BS
IPR001312Hexokinase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0016773phosphotransferase activity, alcohol group as acceptor
GO:0004396hexokinase activity
GO:0005536glucose binding
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0006096glycolytic process
GO:0046835carbohydrate phosphorylation
GO:0001678cellular glucose homeostasis
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00475HEXOKINASEcoord: 428..444
score: 63.61
coord: 210..224
score: 67.44
coord: 135..160
score: 60.2
coord: 68..84
score: 73.19
coord: 187..203
score: 58.41
coord: 361..383
score: 39.84
coord: 278..300
score: 62.18
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 53..442
e-value: 3.6E-165
score: 551.5
NoneNo IPR availableGENE3DG3DSA:3.40.367.20coord: 26..431
e-value: 3.6E-165
score: 551.5
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 68..225
e-value: 8.52977E-9
score: 52.9763
IPR022672Hexokinase, N-terminalPFAMPF00349Hexokinase_1coord: 9..202
e-value: 1.3E-64
score: 217.8
IPR022673Hexokinase, C-terminalPFAMPF03727Hexokinase_2coord: 210..443
e-value: 1.4E-80
score: 270.2
IPR001312HexokinasePANTHERPTHR19443HEXOKINASEcoord: 11..445
IPR001312HexokinasePROSITEPS51748HEXOKINASE_2coord: 3..443
score: 48.069
IPR019807Hexokinase, binding sitePROSITEPS00378HEXOKINASE_1coord: 135..160
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 208..444
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 4..204