Structure-specific endonuclease subunit SLX1 homolog

Overview
NameStructure-specific endonuclease subunit SLX1 homolog
Smed IDSMED30033540
Length (bp)863
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Structure-specific endonuclease subunit SLX1 homolog (SMED30033540) t-SNE clustered cells

Violin plots show distribution of expression levels for Structure-specific endonuclease subunit SLX1 homolog (SMED30033540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Structure-specific endonuclease subunit SLX1 homolog (SMED30033540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Structure-specific endonuclease subunit SLX1 homolog (SMED30033540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Match: SLX1A (SLX1 homolog A, structure-specific endonuclease subunit [Source:HGNC Symbol;Acc:HGNC:20922])

HSP 1 Score: 176.792 bits (447), Expect = 1.461e-53
Identity = 96/245 (39.18%), Postives = 139/245 (56.73%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDL------PVKSDFHS-CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+   NP+ + + Y+GFT +   R+++HN    KGGA  T G+GPW+M+LV+HGFP+ + ALRFEWAWQ P  SRRL H+    +G     F + VLAH LR  PW RL L +RW+ P   Q   L L PP H+P+ +G    +  + +            P + D  + C +C   I   EG + C +  C  + H++C+A  FL +   Q  LLP+EG+CPCC+ +L+W  L+
Sbjct:    8 ARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQ--DLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQ--LLPLEGQCPCCEKSLLWGDLI 248          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Match: SLX1B (SLX1 homolog B, structure-specific endonuclease subunit [Source:HGNC Symbol;Acc:HGNC:28748])

HSP 1 Score: 176.792 bits (447), Expect = 1.461e-53
Identity = 96/245 (39.18%), Postives = 139/245 (56.73%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDL------PVKSDFHS-CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+   NP+ + + Y+GFT +   R+++HN    KGGA  T G+GPW+M+LV+HGFP+ + ALRFEWAWQ P  SRRL H+    +G     F + VLAH LR  PW RL L +RW+ P   Q   L L PP H+P+ +G    +  + +            P + D  + C +C   I   EG + C +  C  + H++C+A  FL +   Q  LLP+EG+CPCC+ +L+W  L+
Sbjct:    8 ARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQ--DLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQ--LLPLEGQCPCCEKSLLWGDLI 248          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Match: SLX1B (SLX1 homolog B, structure-specific endonuclease subunit [Source:HGNC Symbol;Acc:HGNC:28748])

HSP 1 Score: 91.6633 bits (226), Expect = 6.296e-23
Identity = 45/89 (50.56%), Postives = 56/89 (62.92%), Query Frame = 1
Query:  244 MILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPI 510
            M+LV+HGFP+ + ALRFEWAWQ P  SRRL H+    +G     F + VLAH LR  PW RL L +RW+ P   Q   L L PP H+P+
Sbjct:    1 MVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQ--DLCLPPPPHVPL 87          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Match: SLX1A (SLX1 homolog A, structure-specific endonuclease subunit [Source:HGNC Symbol;Acc:HGNC:20922])

HSP 1 Score: 79.337 bits (194), Expect = 2.407e-18
Identity = 33/69 (47.83%), Postives = 49/69 (71.01%), Query Frame = 1
Query:   97 FYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRF 294
            F+GVYL+   NP+ + + Y+GFT +   R+++HN    KGGA  T G+GPW+M+LV+HGFP+ + ALR 
Sbjct:   13 FFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRL 81          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Match: SLX1A (SLX1 homolog A, structure-specific endonuclease subunit [Source:HGNC Symbol;Acc:HGNC:20922])

HSP 1 Score: 77.7962 bits (190), Expect = 6.932e-17
Identity = 34/72 (47.22%), Postives = 50/72 (69.44%), Query Frame = 1
Query:   91 SNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWKMILVIHGFPNELYALRFE 297
              F+GVYL+   NP+ + + Y+GFT +   R+++HN    KGGA  T G+GPW+M+LV+HGFP+ + ALR E
Sbjct:   11 GRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRDE 82          

HSP 2 Score: 46.9802 bits (110), Expect = 5.484e-6
Identity = 22/54 (40.74%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  619 EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            EG + C +  C  + H++C+A  FL +   Q  LLP+EG+CPCC+ +L+W  L+
Sbjct:   83 EGPLCCPHPGCLLRAHVICLAEEFLQEEPGQ--LLPLEGQCPCCEKSLLWGDLI 134          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Celegans
Match: slx-1 (Structure-specific endonuclease subunit SLX1 homolog [Source:UniProtKB/Swiss-Prot;Acc:P91351])

HSP 1 Score: 147.517 bits (371), Expect = 4.168e-41
Identity = 80/239 (33.47%), Postives = 128/239 (53.56%), Query Frame = 1
Query:   91 SNFYGVYLMIS--ENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKK-LEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLIVE--GLVSCLNDACNAKWHLVCIAGCFLA-QSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            + FYGVY +IS  + P  KN+ YIG+T DP  R+ +HN   +KGGA+ T  +GPW M+ V+HGFPN + AL FEWAWQ+P +S+ LK  +L  +  +    F++ +    + +  +CR  L  RWL    E PFP +  PP+H  + +G +   K     + S      +   C IC   I +   LV C++  C + +H  C++   L  ++    ++ P++  CP C    +W  ++
Sbjct:  170 NEFYGVYCLISRSDRPCYKNRCYIGYTVDPNRRIMQHNGGRDKGGAKKTDSRGPWDMVCVVHGFPNHVAALHFEWAWQNPLVSKSLKEKQLRKERKETPFAFQLRIACELMNSSAFCRFALTFRWLITTEELPFPTSCVPPDHTKLRFGKV---KKEMSLVPSKREDYLEMGECRICGKDIEKLWSLVRCISATCPSHFHSKCLSENGLKLKNEHVDHVYPLKANCPTCGQFYLWGDII 405          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Fly
Match: slx1 (gene:FBgn0037263 transcript:FBtr0301296)

HSP 1 Score: 162.155 bits (409), Expect = 6.553e-48
Identity = 92/266 (34.59%), Postives = 143/266 (53.76%), Query Frame = 1
Query:   40 SDFESNDFPKTQEKVNS--SNFYGVYLMISE--NPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKL------EFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDF-----KKFSSKTIKSDLPVKSDFHSCGICQDLIVEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVE 783
            + ++  D    QE+  +   +FYGVYL+ S+  +P+ + K Y+GFT +P+ R+++HN   + GGAR T  KGPW M++++HGFPN   AL+FEWAWQ P LS RLK   + P+  +KL      ++   +L++ L  GPW RL L +RWL   YE+PF   L  P HM I+ G +       ++         +   S+ H C    +   +  + C N  C    H+VC+A   L    +  + +P+ G CP C+  L W  L++
Sbjct:    2 NSYDPQDTASQQEESVALKGHFYGVYLLCSQSLDPRYRGKCYVGFTVNPKRRIRQHNLGCDFGGARKTSRKGPWLMVMIVHGFPNNTVALQFEWAWQQPSLSTRLK---MYPELKRKLPRETFFDYNFRILSNMLGVGPWNRLPLTVRWLETDYERPFSKAL--PKHMEIVSGKVSISASQRRRPDDAVPPPPVAWASECHLCMQEMEQPEKSRLGCTNQMCRLTCHMVCLANYLLGD--EPGHYIPVGGECPLCETRLSWAALLQ 260          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Zebrafish
Match: slx1b (SLX1 homolog B, structure-specific endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-130530-826])

HSP 1 Score: 196.823 bits (499), Expect = 1.167e-61
Identity = 97/258 (37.60%), Postives = 152/258 (58.91%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV-------ENLAFQSSRIKNKL 822
            V   +FYGVY++   NPK K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+M+L+IHGFP+++ ALRFEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL + +RWL  +Y   F  +L PP H+P+ +G +  K+      K     + +   C +C + I     +SC + +C    HL+C+AG FL       +L+P+EG+CP C  +++W  L+       E +   SS++ + +
Sbjct:    3 VEVESFYGVYMLYCTNPKFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGFPSDIAALRFEWAWQHPHISRRLSHVSRRSRKESGLQFHWRVVSNMLRVAPWSRLPITVRWLKQEYRMDFAPDLQPPLHIPLTFGCVRAKRKPQHVSKEQEERQVEL--CVLCGEFIKTVDRLSCFHPSCQMVCHLICLAGHFLKAD--PFHLIPVEGKCPGCHHSVLWGSLILYKNADLEEMNIPSSQVSSDM 256          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Zebrafish
Match: slx1b (SLX1 homolog B, structure-specific endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-130530-826])

HSP 1 Score: 196.052 bits (497), Expect = 2.400e-61
Identity = 94/237 (39.66%), Postives = 144/237 (60.76%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            V   +FYGVY++   NPK K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+M+L+IHGFP+++ ALRFEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL + +RWL  +Y   F  +L PP H+P+ +G +  K+      K     + +   C +C + I     +SC + +C    HL+C+AG FL       +L+P+EG+CP C  +++W  L+
Sbjct:    3 VEVESFYGVYMLYCTNPKFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGFPSDIAALRFEWAWQHPHISRRLSHVSRRSRKESGLQFHWRVVSNMLRVAPWSRLPITVRWLKQEYRMDFAPDLQPPLHIPLTFGCVRAKRKPQHVSKEQEERQVEL--CVLCGEFIKTVDRLSCFHPSCQMVCHLICLAGHFLKAD--PFHLIPVEGKCPGCHHSVLWGSLI 235          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Zebrafish
Match: slx1b (SLX1 homolog B, structure-specific endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-130530-826])

HSP 1 Score: 135.191 bits (339), Expect = 1.355e-38
Identity = 66/180 (36.67%), Postives = 104/180 (57.78%), Query Frame = 1
Query:  244 MILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            M+L+IHGFP+++ ALRFEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL + +RWL  +Y   F  +L PP H+P+ +G +  K+      K     + +   C +C + I     +SC + +C    HL+C+AG FL       +L+P+EG+CP C  +++W  L+
Sbjct:    1 MVLIIHGFPSDIAALRFEWAWQHPHISRRLSHVSRRSRKESGLQFHWRVVSNMLRVAPWSRLPITVRWLKQEYRMDFAPDLQPPLHIPLTFGCVRAKRKPQHVSKEQEERQVEL--CVLCGEFIKTVDRLSCFHPSCQMVCHLICLAGHFLKAD--PFHLIPVEGKCPGCHHSVLWGSLI 176          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Zebrafish
Match: slx1b (SLX1 homolog B, structure-specific endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-130530-826])

HSP 1 Score: 111.309 bits (277), Expect = 1.812e-29
Identity = 56/164 (34.15%), Postives = 89/164 (54.27%), Query Frame = 1
Query:  292 FEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            FEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL + +RWL  +Y   F  +L PP H+P+ +G +  K+      K     + +   C +C + I     +SC + +C    HL+C+AG FL       +L+P+EG+CP C  +++W  L+
Sbjct:    1 FEWAWQHPHISRRLSHVSRRSRKESGLQFHWRVVSNMLRVAPWSRLPITVRWLKQEYRMDFAPDLQPPLHIPLTFGCVRAKRKPQHVSKEQEERQVEL--CVLCGEFIKTVDRLSCFHPSCQMVCHLICLAGHFLKAD--PFHLIPVEGKCPGCHHSVLWGSLI 160          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Xenopus
Match: bank1 (B cell scaffold protein with ankyrin repeats 1 [Source:Xenbase;Acc:XB-GENE-952296])

HSP 1 Score: 177.563 bits (449), Expect = 7.507e-54
Identity = 102/249 (40.96%), Postives = 144/249 (57.83%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHS-----------CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            V    FYGVYL+   NPK K + YIGFT +PE R+++HN   +KGGA  T G+GPW M+L++HGFPN++ ALRFEWAWQ P +SRRL H+   PK     +F ++VL+H LR  PW RL L +RWL  +Y +  PL L PP HMP+ +G +  +   SK  K  L    +  S           C +C + +   +  + C    C    H++C+A  FL +  Q   L+P+EG CP C  +++W  L+
Sbjct:    3 VEVEGFYGVYLLFCTNPKYKGRIYIGFTVNPERRIQQHNGGKHKGGAWKTSGRGPWDMVLIVHGFPNDIAALRFEWAWQHPHVSRRLTHVPRKPKKQSSFDFHLLVLSHMLRVAPWNRLPLTLRWLRQEYRRELPLLLQPPLHMPLAFGQVRARPI-SKGQKGRLGETGEGESARGVMPPAPQRCRVCYERVQDKDDALCCFQPGCTLTAHILCLAKLFLLKEPQS--LIPVEGLCPSCGHSVLWGDLI 248          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Mouse
Match: Slx1b (SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1915220])

HSP 1 Score: 182.185 bits (461), Expect = 7.038e-56
Identity = 98/244 (40.16%), Postives = 137/244 (56.15%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSK---TIKSDLPVKSDFHS---CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+  +NP+ + + Y+GFT +P  R+++HN    KGGA  T G+GPW M+L+IHGFP+ + ALRFEWAWQ P  SRRL H+    +      F + VLAH LR  PW RL L +RWL P +     L   PP HMPI +G    +    K     ++D   + D  +   C +C  L+   EG + C +  C  + H++C+A  FL +   Q  LLP+EG CP C  +L+W  LV
Sbjct:    5 ARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRH--ELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQ--LLPLEGHCPSCKKSLLWGNLV 244          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Mouse
Match: Slx1b (SLX1 structure-specific endonuclease subunit homolog B (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1915220])

HSP 1 Score: 55.8398 bits (133), Expect = 5.491e-10
Identity = 23/50 (46.00%), Postives = 35/50 (70.00%), Query Frame = 1
Query:   97 FYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGP 237
            F+GVYL+  +NP+ + + Y+GFT +P  R+++HN    KGGA  T G+GP
Sbjct:   10 FFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGP 59          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Match: sp|A7STV9|SLX1_NEMVE (Structure-specific endonuclease subunit SLX1 homolog OS=Nematostella vectensis OX=45351 GN=v1g174298 PE=3 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.990e-55
Identity = 98/244 (40.16%), Postives = 139/244 (56.97%), Query Frame = 1
Query:   73 QEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKK-LEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFL-AQSLQQTYLLPIEGRCPCCDATLVWTRLVE 783
             + +  S F+GVYL+   NPK K  +YIG+T +P  R+K+HN   +KGGA  T  K PW MIL++HGFPN++ AL+FEWAWQ P +SRRLK      K  ++ +++   +L+  LR GPW RL L IRWL  +YE  F     PP HM ++YG +  +K   K + S+         C  C D+I   E L+ C    C    H+ C+A  FL   +    + LP++G CP C  +L+W  LV+
Sbjct:    2 DDNIAGSGFHGVYLLYCVNPKFKGHTYIGYTVNPNRRIKQHNGGVDKGGAYKTSRKKPWNMILIVHGFPNDIIALQFEWAWQKPTVSRRLKSAATKKKPRERPVQYCFRILSELLRVGPWNRLPLHIRWLMREYEMEFDPRCLPPFHMTVVYGPLVSRKAKQKAVSSEDQRPDHKEKCIKCLDVIKIDEKLIRCPKSGCTMTAHMFCLARDFLHCGNEGGLFCLPVDGNCPQCKGSLLWGDLVK 245          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Match: sp|Q8BX32|SLX1_MOUSE (Structure-specific endonuclease subunit SLX1 OS=Mus musculus OX=10090 GN=Slx1b PE=2 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 4.923e-55
Identity = 98/244 (40.16%), Postives = 137/244 (56.15%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSK---TIKSDLPVKSDFHS---CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+  +NP+ + + Y+GFT +P  R+++HN    KGGA  T G+GPW M+L+IHGFP+ + ALRFEWAWQ P  SRRL H+    +      F + VLAH LR  PW RL L +RWL P +     L   PP HMPI +G    +    K     ++D   + D  +   C +C  L+   EG + C +  C  + H++C+A  FL +   Q  LLP+EG CP C  +L+W  LV
Sbjct:    5 ARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLIIHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEAAFAFHLRVLAHMLRVPPWVRLPLTLRWLRPDFRH--ELCPAPPAHMPIAFGPPPPQPLVPKRPAVSEADSERQLDLGTKARCSLCARLLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQ--LLPLEGHCPSCKKSLLWGNLV 244          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Match: sp|Q5PQP5|SLX1_RAT (Structure-specific endonuclease subunit SLX1 OS=Rattus norvegicus OX=10116 GN=Slx1b PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 6.853e-55
Identity = 97/244 (39.75%), Postives = 137/244 (56.15%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSK---TIKSDLPVKSDF---HSCGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+  +NP+ + + Y+GFT +P  R+++HN    KGGA  T G+GPW M+L++HGFP+ + ALRFEWAWQ P  SRRL H+    +      F + VLAH LR  PW RL L +RWL P +     L   PP HMPI +G    +    K     ++D   + D     SC +C  ++   EG + C +  C  + H++C+A  FL +   Q  LLP+EG CP C  +L+W  LV
Sbjct:    5 ARPGRFFGVYLLYCQNPRHRGRVYVGFTVNPARRVRQHNAGRKKGGAWRTSGRGPWDMVLILHGFPSAVAALRFEWAWQHPQASRRLTHVGPRLRSEASFTFHLRVLAHMLRVPPWVRLPLTVRWLRPDFRH--ELCPAPPPHMPIAFGPPPPQPLVPKRPAASEADSERRLDLGAKASCTLCARMLQDEEGPLCCPHPGCPLRAHIICLAEEFLQEEPGQ--LLPLEGHCPSCKKSLLWGNLV 244          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Match: sp|Q9BQ83|SLX1_HUMAN (Structure-specific endonuclease subunit SLX1 OS=Homo sapiens OX=9606 GN=SLX1A PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 7.017e-53
Identity = 96/245 (39.18%), Postives = 139/245 (56.73%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDL------PVKSDFHS-CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
                 F+GVYL+   NP+ + + Y+GFT +   R+++HN    KGGA  T G+GPW+M+LV+HGFP+ + ALRFEWAWQ P  SRRL H+    +G     F + VLAH LR  PW RL L +RW+ P   Q   L L PP H+P+ +G    +  + +            P + D  + C +C   I   EG + C +  C  + H++C+A  FL +   Q  LLP+EG+CPCC+ +L+W  L+
Sbjct:    8 ARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRFEWAWQHPHASRRLAHVGPRLRGETAFAFHLRVLAHMLRAPPWARLPLTLRWVRPDLRQ--DLCLPPPPHVPLAFGPPPPQAPAPRRRAGPFDDAEPEPDQGDPGACCSLCAQTIQDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQ--LLPLEGQCPCCEKSLLWGDLI 248          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Match: sp|Q0IH86|SLX1_XENLA (Structure-specific endonuclease subunit slx1 OS=Xenopus laevis OX=8355 GN=slx1a PE=2 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 8.077e-51
Identity = 98/255 (38.43%), Postives = 144/255 (56.47%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKF-------------SSKTIKSDLPVKSD--FHSCGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V    FYGVYL+   NPK K + YIGFT +PE R+++HN   +KGGA  T G+GPW M+L++HGFPN++ ALRFEWAWQ P +SRRL H+    K     +F ++VL H LR  PW RL L +RWL  +Y +  PL L PP HMP+ +G +  +                ++  + ++ +  D     C +C + +   +  + C +  C    H++C+A  FL    Q   L+P+EG CP C  +L+W  L+ +
Sbjct:    3 VEVEGFYGVYLLFCTNPKYKGRIYIGFTVNPERRIQQHNGGKHKGGAWKTSGRGPWDMVLIVHGFPNDIAALRFEWAWQHPHVSRRLTHVPRKTKKQSSFDFHLLVLCHMLRVAPWNRLPLTLRWLRQEYRRELPLLLQPPLHMPLAFGQVRARPIPKGEKEKGRLGENRAEETEQEVILLGDAVVQRCRVCYERVQDKDDSLHCFHPGCTLTAHIMCLAKLFLLNEPQN--LIPVEGLCPSCGHSLLWGDLIRH 255          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Match: A0A2B4SMM5 (Structure-specific endonuclease subunit SLX1 homolog OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene4093 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.350e-66
Identity = 112/241 (46.47%), Postives = 154/241 (63.90%), Query Frame = 1
Query:   88 SSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKK--FSSKTIKSDLPVKSDFH-SCGICQDLI--VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
             + F+GVYL+   NP+ K +SYIGFT DP  R+K+HN    KGGA  T G+GPW+MIL+IHGFP+++ AL+FEWAWQ+P  SRRL+H+       K +EFR  VL+  L  GPW RL L IRWL  +Y+  F     PP HMPI YG ++ +K   S K  K +L   S  H +C +C + I   +  +SC++++C  K HL+C+A  FL +S   +YL+PIEG CP C  T +W  L++N
Sbjct:    9 EAGFFGVYLLYCLNPRYKGRSYIGFTVDPNRRIKQHNGGVQKGGASKTSGRGPWEMILIIHGFPSDIIALQFEWAWQNPGKSRRLRHISNKKTKEKDIEFRFRVLSEMLNVGPWNRLPLTIRWLKQEYKMEF--EKQPPTHMPIAYGPLNKRKPEKSKKGAKEELKDVSISHFTCVVCSEKIKDADDCLSCISESCPMKAHLICLAKRFLIESEDNSYLVPIEGDCPICYHTFLWRDLLKN 247          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Match: A0A0L8HJC1 (Structure-specific endonuclease subunit SLX1 homolog OS=Octopus bimaculoides OX=37653 GN=OCBIM_22013273mg PE=3 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 5.759e-65
Identity = 104/240 (43.33%), Postives = 150/240 (62.50%), Query Frame = 1
Query:   91 SNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKS-----DFHSCGICQDLIVEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYL--LPIEGRCPCCDATLVWTRLV 780
             +F+GVYL+ + NP  K++ YIG+T DP  R+++HN+    GGA  T G+GPW+M+L++HGFPN + ALRFEWAWQ P  SRRLKH            +R+ VL   LR GPW RL L IRWL  +Y++ FP  L PP HMPI+YG +  KK  S   K+  P  +     + ++C +C++LIV+ L      +C A+ H++C+A  FL+++L +  L  LP++G CP C   L+W  L+
Sbjct:    9 EDFFGVYLLYNINPVYKDRVYIGYTVDPNRRVRQHNSGKQAGGAWKTSGRGPWEMVLIVHGFPNNISALRFEWAWQHPTKSRRLKHFPAKKSSELMYSYRLRVLGEMLRVGPWKRLPLTIRWLKQEYQREFPPKLLPPTHMPIVYGPVQSKKIPSS--KTSAPADTAALDVELNTCSVCRELIVDNLAELKCLSCRARSHIICLAKHFLSKNLLEDTLSILPVDGNCPVCHQELLWGDLI 246          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Match: A0A3P8SS82 (Structure-specific endonuclease subunit SLX1 OS=Amphiprion percula OX=161767 GN=SLX1 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.947e-62
Identity = 103/243 (42.39%), Postives = 151/243 (62.14%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKS----DFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NPK K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+MIL++HGFP+++ ALRFEWAWQ P  SRRL H+    +    L+F   V+++ LR  PW RL L +RWL  +Y   F  +L PP H+PI +GS+  KK         LP++S    D   C +C+ L+ V   +SC + +C    HL+CIA CFL    + ++LLP+EG CP C  +++W  L+ +
Sbjct:    3 VEVESFFGVYMLYCINPKFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMILILHGFPSDIAALRFEWAWQHPHSSRRLSHVSRRSRKESSLQFHWRVVSNMLRVAPWSRLPLTVRWLKQEYRMDFEPSLQPPLHIPITFGSVRAKK--------KLPLQSAGEEDTSRCFLCKGLVKVSEKLSCFHPSCGMSSHLICIARCFLRS--EPSHLLPVEGECPSCHRSVLWGSLIRH 235          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Match: A0A3Q1BE41 (Structure-specific endonuclease subunit SLX1 OS=Amphiprion ocellaris OX=80972 GN=SLX1 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.947e-62
Identity = 103/243 (42.39%), Postives = 151/243 (62.14%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKS----DFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NPK K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+MIL++HGFP+++ ALRFEWAWQ P  SRRL H+    +    L+F   V+++ LR  PW RL L +RWL  +Y   F  +L PP H+PI +GS+  KK         LP++S    D   C +C+ L+ V   +SC + +C    HL+CIA CFL    + ++LLP+EG CP C  +++W  L+ +
Sbjct:    3 VEVESFFGVYMLYCINPKFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMILILHGFPSDIAALRFEWAWQHPHSSRRLSHVSRRSRKESSLQFHWRVVSNMLRVAPWSRLPLTVRWLKQEYRMDFEPSLQPPLHIPITFGSVRAKK--------KLPLQSAGEEDTSRCFLCKGLVKVSEKLSCFHPSCGMSSHLICIARCFLRS--EPSHLLPVEGECPSCHRSVLWGSLIRH 235          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Match: A0A433U7M1 (Structure-specific endonuclease subunit SLX1 homolog OS=Elysia chlorotica OX=188477 GN=EGW08_002370 PE=3 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 2.002e-62
Identity = 106/250 (42.40%), Postives = 153/250 (61.20%), Query Frame = 1
Query:   94 NFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFS-----------SKTIKSDLPVKSDFHS--CGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVENL 789
            +FYGVYL++  NPK K ++YIG+T +P  R+K+HN   + GGA  T G+GPW+M+L++HGFPN++  LRFEWAWQ PD SRRL+ +    +     + R  V+ + LRT PWC LGL +RWL  +Y+  FP  L PP HMP++YG +  KK +           S+    D  V+++  S  C +C   ++  + ++SCL  +C  K H+ C+A  FL     +T LLPIEG+CP C  TL+W  L+  L
Sbjct:    7 DFYGVYLLLCLNPKFKGRTYIGYTVNPNRRIKQHNTGTHAGGAYRTSGRGPWEMVLIVHGFPNDVSGLRFEWAWQHPDKSRRLRGVPGKSRKESAFQHRWRVVCNMLRTAPWCGLGLSVRWLKQEYKLDFPDGLEPPLHMPVVYGPVLSKKVTKSQKGTSRIAPSQVSLDDANVQTEMESSVCAVCHMPVMAEDTVLSCLRPSCPMKAHITCLAKHFLE---DETRLLPIEGKCPDCCVTLLWGELIRQL 253          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Cavefish
Match: slx1b (structure-specific endonuclease subunit slx1-like [Source:NCBI gene;Acc:103041687])

HSP 1 Score: 197.593 bits (501), Expect = 4.881e-62
Identity = 98/239 (41.00%), Postives = 148/239 (61.92%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NPK K + YIGFT +PE R+ +HN   +KGGA+ T G+GPW+M+L++HGFP+++ ALRFEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL L +RWL  +Y   F   L PP H+P+ +G +  KK   +    +L  +S +  C +C+D++  E  +SC    C    HL+C+A  FL    + T+L+P+EG CP C  +++W  LV +
Sbjct:    3 VEVESFFGVYMLYCTNPKFKGRIYIGFTVNPERRIGQHNAGRHKGGAKRTSGRGPWEMVLIVHGFPSDIAALRFEWAWQHPHISRRLSHVTRRSRKESSLQFHWRVVSNMLRVAPWSRLPLTVRWLRQEYRMDFEPGLQPPLHIPLTFGCVRAKKKKQQQEDKELE-ESRWERCLLCRDIVKAEDRLSCFLPLCKMVCHLICLAKHFLKS--EPTHLIPVEGECPGCHHSVLWGNLVRH 238          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Cavefish
Match: slx1b (structure-specific endonuclease subunit slx1-like [Source:NCBI gene;Acc:103041687])

HSP 1 Score: 197.978 bits (502), Expect = 4.925e-62
Identity = 98/239 (41.00%), Postives = 148/239 (61.92%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NPK K + YIGFT +PE R+ +HN   +KGGA+ T G+GPW+M+L++HGFP+++ ALRFEWAWQ P +SRRL H+    +    L+F   V+++ LR  PW RL L +RWL  +Y   F   L PP H+P+ +G +  KK   +    +L  +S +  C +C+D++  E  +SC    C    HL+C+A  FL    + T+L+P+EG CP C  +++W  LV +
Sbjct:    3 VEVESFFGVYMLYCTNPKFKGRIYIGFTVNPERRIGQHNAGRHKGGAKRTSGRGPWEMVLIVHGFPSDIAALRFEWAWQHPHISRRLSHVTRRSRKESSLQFHWRVVSNMLRVAPWSRLPLTVRWLRQEYRMDFEPGLQPPLHIPLTFGCVRAKKKKQQQEDKELE-ESRWERCLLCRDIVKAEDRLSCFLPLCKMVCHLICLAKHFLKS--EPTHLIPVEGECPGCHHSVLWGNLVRH 238          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Sea Lamprey
Match: slx1b (SLX1 homolog B, structure-specific endonuclease subunit [Source:ZFIN;Acc:ZDB-GENE-130530-826])

HSP 1 Score: 194.126 bits (492), Expect = 3.663e-61
Identity = 99/251 (39.44%), Postives = 145/251 (57.77%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNN---KGGARATQGKGPWK-MILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKK-----FSSKTIKSDLPVKS-------DFHSCGICQDLIVE--GLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV 780
            V   NF+GVY++   NPK K + Y+G+T DPE R+ +HN    KGGA  T G+GPW+ M+L++HGFP+++ ALRFEWAWQ P  SRRL H+    +    L+  + VL H +R  PWCRL L +RWL P+Y + FP+ + PP HMP+ +G +  K        ++  + ++ V+S           C +C   I +    +SC +  C  + H+ C+A  FL      T LLP+EG+CP C   ++W  LV
Sbjct:    3 VEVENFFGVYMLYCTNPKFKGRIYVGYTVDPERRIGQHNGGRRKGGALRTSGRGPWQDMVLIVHGFPSDIAALRFEWAWQHPQRSRRLTHVARKHRSENSLQLHLRVLWHMVRVPPWCRLPLTLRWLRPEYREDFPVGMEPPLHMPVAFGPVRAKARPCGGSRTQQQQGEVAVQSVNPSQATGAARCVLCHQRIQQEDERMSCFHPGCRMEAHITCLARDFL--KTDPTQLLPVEGQCPGCKNAVLWGDLV 251          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Yeast
Match: SLX1 (Endonuclease involved in DNA recombination and repair; subunit of a complex, with Slx4p, that hydrolyzes 5' branches from duplex DNA in response to stalled or converging replication forks; function overlaps with that of Sgs1p-Top3p [Source:SGD;Acc:S000000432])

HSP 1 Score: 77.0258 bits (188), Expect = 9.133e-17
Identity = 77/288 (26.74%), Postives = 127/288 (44.10%), Query Frame = 1
Query:   94 NFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNNK---GGARATQ--GKGPWKMILVIHGFPNELYALRFEWAWQS-------PDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIR---------WLCPQY---EQPFPLN-------LNPPNH--MPIIYGSID-----FKKFSSKTIKSDLPVKSDFHS--------CGICQDLI--------VEGLVS-CLNDACNAKWHLVCIAGCFLAQS---LQQTYLLPIEGRCPCCDATLVWTRLVE 783
            +FY  YL+ S N ++    Y+G T +P  RL++HN K   GGA  T+  G  PW+MI+++ GFP+++ AL+FE AWQ         +  R +KH      G + L  ++ ++   L+   + R+ LI+          W   ++      FP+N       L  P    + ++    D      +   +K I+++  +   F          C IC+  I        ++  V+ C N  C    HL C+   FL      + +  L+P  G+CP CD    WT LV+
Sbjct:   12 DFYCCYLLQSINKRQS--FYVGSTPNPVRRLRQHNGKLAVGGAYRTKRDGSRPWEMIMIVRGFPSKIAALQFEHAWQHGYQTHYIAEKDRVVKH----KAGGRTLHHKVALMKLLLKHEFFQRMNLIVEVFNIKAWEVWKQDKFFIERDRFPINIQINENALEEPKEKTVDVLMDHSDENLKVVEAVYTKVIENERNIFETFEKKLTTGVVRCEICEKEIDYTSEEQNLKPFVALCNNKDCGCVNHLKCLHRYFLDDEQLMVGRRNLIPRGGKCPKCDMFCDWTTLVK 293          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Nematostella
Match: EDO32838 (Structure-specific endonuclease subunit SLX1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7STV9])

HSP 1 Score: 183.341 bits (464), Expect = 8.155e-57
Identity = 98/244 (40.16%), Postives = 139/244 (56.97%), Query Frame = 1
Query:   73 QEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKK-LEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLIV--EGLVSCLNDACNAKWHLVCIAGCFL-AQSLQQTYLLPIEGRCPCCDATLVWTRLVE 783
             + +  S F+GVYL+   NPK K  +YIG+T +P  R+K+HN   +KGGA  T  K PW MIL++HGFPN++ AL+FEWAWQ P +SRRLK      K  ++ +++   +L+  LR GPW RL L IRWL  +YE  F     PP HM ++YG +  +K   K + S+         C  C D+I   E L+ C    C    H+ C+A  FL   +    + LP++G CP C  +L+W  LV+
Sbjct:    2 DDNIAGSGFHGVYLLYCVNPKFKGHTYIGYTVNPNRRIKQHNGGVDKGGAYKTSRKKPWNMILIVHGFPNDIIALQFEWAWQKPTVSRRLKSAATKKKPRERPVQYCFRILSELLRVGPWNRLPLHIRWLMREYEMEFDPRCLPPFHMTVVYGPLVSRKAKQKAVSSEDQRPDHKEKCIKCLDVIKIDEKLIRCPKSGCTMTAHMFCLARDFLHCGNEGGLFCLPVDGNCPQCKGSLLWGDLVK 245          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Medaka
Match: slx1b (structure-specific endonuclease subunit slx1 [Source:NCBI gene;Acc:101173980])

HSP 1 Score: 194.897 bits (494), Expect = 6.097e-61
Identity = 98/239 (41.00%), Postives = 143/239 (59.83%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NP+ K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+M+L+IHGFP+++ ALRFEWAWQ P  SRRL H+    +    L+F   V+++ LR  PW RL L  RWL  +Y   F   L PP H+PI +GS+  KK      +++   +     C +C+  + V   VSCL+ +C    HL+C+   FL     Q  LLP+EG CP C  +L+W  L+ +
Sbjct:    3 VEVESFFGVYMLYCRNPRFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGFPSDIAALRFEWAWQHPHSSRRLPHVARRSRKESSLQFHWRVVSNMLRVAPWNRLPLTARWLKQEYRMDFGPALQPPLHVPIAFGSVRAKKTLQPQTRAEEEEEETT-DCFVCRRPVKVSEKVSCLHASCGMSSHLICLGRRFLQSEPSQ--LLPVEGECPSCRRSLLWGSLIRH 238          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Medaka
Match: slx1b (structure-specific endonuclease subunit slx1 [Source:NCBI gene;Acc:101173980])

HSP 1 Score: 194.897 bits (494), Expect = 6.097e-61
Identity = 98/239 (41.00%), Postives = 143/239 (59.83%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NP+ K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+M+L+IHGFP+++ ALRFEWAWQ P  SRRL H+    +    L+F   V+++ LR  PW RL L  RWL  +Y   F   L PP H+PI +GS+  KK      +++   +     C +C+  + V   VSCL+ +C    HL+C+   FL     Q  LLP+EG CP C  +L+W  L+ +
Sbjct:    3 VEVESFFGVYMLYCRNPRFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGFPSDIAALRFEWAWQHPHSSRRLPHVARRSRKESSLQFHWRVVSNMLRVAPWNRLPLTARWLKQEYRMDFGPALQPPLHVPIAFGSVRAKKTLQPQTRAEEEEEETT-DCFVCRRPVKVSEKVSCLHASCGMSSHLICLGRRFLQSEPSQ--LLPVEGECPSCRRSLLWGSLIRH 238          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Medaka
Match: slx1b (structure-specific endonuclease subunit slx1 [Source:NCBI gene;Acc:101173980])

HSP 1 Score: 194.897 bits (494), Expect = 7.309e-61
Identity = 98/239 (41.00%), Postives = 143/239 (59.83%), Query Frame = 1
Query:   82 VNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHN---NKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLI-VEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVEN 786
            V   +F+GVY++   NP+ K + YIGFT +PE R+ +HN   ++GGA+ T G+GPW+M+L+IHGFP+++ ALRFEWAWQ P  SRRL H+    +    L+F   V+++ LR  PW RL L  RWL  +Y   F   L PP H+PI +GS+  KK      +++   +     C +C+  + V   VSCL+ +C    HL+C+   FL     Q  LLP+EG CP C  +L+W  L+ +
Sbjct:    3 VEVESFFGVYMLYCRNPRFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPWEMVLIIHGFPSDIAALRFEWAWQHPHSSRRLPHVARRSRKESSLQFHWRVVSNMLRVAPWNRLPLTARWLKQEYRMDFGPALQPPLHVPIAFGSVRAKKTLQPQTRAEEEEEETT-DCFVCRRPVKVSEKVSCLHASCGMSSHLICLGRRFLQSEPSQ--LLPVEGECPSCRRSLLWGSLIRH 238          
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Planmine SMEST
Match: SMESG000028724.1 (SMESG000028724.1)

HSP 1 Score: 551.592 bits (1420), Expect = 0.000e+0
Identity = 264/266 (99.25%), Postives = 265/266 (99.62%), Query Frame = 1
Query:   31 MSDSDFESNDFPKTQEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNNKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLIVEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVENLAFQSSRIKNKLIN 828
            MSDSDFESNDFPKTQEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNNKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKK SSKTIKSD+PVKSDFHSCGICQDLIVEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVENLAFQSSRIKNKLIN
Sbjct:    1 MSDSDFESNDFPKTQEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPENRLKRHNNKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRRLKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPLNLNPPNHMPIIYGSIDFKKLSSKTIKSDIPVKSDFHSCGICQDLIVEGLVSCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLVENLAFQSSRIKNKLIN 266          
The following BLAST results are available for this feature:
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLX1A1.461e-5339.18SLX1 homolog A, structure-specific endonuclease su... [more]
SLX1B1.461e-5339.18SLX1 homolog B, structure-specific endonuclease su... [more]
SLX1B6.296e-2350.56SLX1 homolog B, structure-specific endonuclease su... [more]
SLX1A2.407e-1847.83SLX1 homolog A, structure-specific endonuclease su... [more]
SLX1A6.932e-1747.22SLX1 homolog A, structure-specific endonuclease su... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slx-14.168e-4133.47Structure-specific endonuclease subunit SLX1 homol... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slx16.553e-4834.59gene:FBgn0037263 transcript:FBtr0301296[more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slx1b1.167e-6137.60SLX1 homolog B, structure-specific endonuclease su... [more]
slx1b2.400e-6139.66SLX1 homolog B, structure-specific endonuclease su... [more]
slx1b1.355e-3836.67SLX1 homolog B, structure-specific endonuclease su... [more]
slx1b1.812e-2934.15SLX1 homolog B, structure-specific endonuclease su... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
bank17.507e-5440.96B cell scaffold protein with ankyrin repeats 1 [So... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Slx1b7.038e-5640.16SLX1 structure-specific endonuclease subunit homol... [more]
Slx1b5.491e-1046.00SLX1 structure-specific endonuclease subunit homol... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7STV9|SLX1_NEMVE1.990e-5540.16Structure-specific endonuclease subunit SLX1 homol... [more]
sp|Q8BX32|SLX1_MOUSE4.923e-5540.16Structure-specific endonuclease subunit SLX1 OS=Mu... [more]
sp|Q5PQP5|SLX1_RAT6.853e-5539.75Structure-specific endonuclease subunit SLX1 OS=Ra... [more]
sp|Q9BQ83|SLX1_HUMAN7.017e-5339.18Structure-specific endonuclease subunit SLX1 OS=Ho... [more]
sp|Q0IH86|SLX1_XENLA8.077e-5138.43Structure-specific endonuclease subunit slx1 OS=Xe... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4SMM54.350e-6646.47Structure-specific endonuclease subunit SLX1 homol... [more]
A0A0L8HJC15.759e-6543.33Structure-specific endonuclease subunit SLX1 homol... [more]
A0A3P8SS821.947e-6242.39Structure-specific endonuclease subunit SLX1 OS=Am... [more]
A0A3Q1BE411.947e-6242.39Structure-specific endonuclease subunit SLX1 OS=Am... [more]
A0A433U7M12.002e-6242.40Structure-specific endonuclease subunit SLX1 homol... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slx1b4.881e-6241.00structure-specific endonuclease subunit slx1-like ... [more]
slx1b4.925e-6241.00structure-specific endonuclease subunit slx1-like ... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slx1b3.663e-6139.44SLX1 homolog B, structure-specific endonuclease su... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SLX19.133e-1726.74Endonuclease involved in DNA recombination and rep... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO328388.155e-5740.16Structure-specific endonuclease subunit SLX1 homol... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slx1b6.097e-6141.00structure-specific endonuclease subunit slx1 [Sour... [more]
slx1b6.097e-6141.00structure-specific endonuclease subunit slx1 [Sour... [more]
slx1b7.309e-6141.00structure-specific endonuclease subunit slx1 [Sour... [more]
back to top
BLAST of Structure-specific endonuclease subunit SLX1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000028724.10.000e+099.25SMESG000028724.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033540 ID=SMED30033540|Name=Structure-specific endonuclease subunit SLX1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=863bp
TGATCTTAGTATATTTAAATTTAGTTCTTGATGTCAGATTCTGATTTCGA
ATCTAATGATTTCCCTAAAACTCAGGAAAAAGTTAATTCTTCGAACTTTT
ATGGAGTTTATTTAATGATTAGTGAAAATCCAAAGGAAAAAAATAAGTCA
TATATAGGTTTCACCAATGATCCAGAAAATCGATTGAAAAGACATAACAA
TAAAGGAGGTGCCAGAGCTACACAAGGAAAAGGGCCATGGAAAATGATTT
TAGTAATTCACGGGTTTCCCAATGAATTATATGCATTACGATTTGAATGG
GCATGGCAAAGTCCAGATTTATCTAGAAGATTGAAACATTTAGAATTAAA
TCCGAAAGGATTTAAAAAGCTCGAATTTAGGATGATTGTATTGGCTCATT
GTTTACGAACTGGACCTTGGTGTAGACTAGGATTGATTATTAGATGGCTG
TGTCCTCAGTATGAACAGCCATTTCCATTAAATTTAAATCCACCAAATCA
TATGCCGATTATTTATGGTTCAATCGATTTTAAAAAATTCTCTTCTAAAA
CAATAAAATCTGACCTTCCTGTTAAAAGTGATTTTCATTCCTGTGGAATT
TGTCAGGATTTAATTGTAGAAGGTTTAGTTAGTTGTTTAAATGATGCTTG
TAATGCCAAATGGCATTTGGTTTGCATTGCAGGATGTTTTCTTGCTCAAT
CATTGCAACAAACGTATTTGTTGCCCATTGAAGGCCGTTGTCCATGTTGT
GATGCAACTCTGGTTTGGACTCGTCTCGTGGAGAATCTCGCCTTTCAATC
ATCCAGAATTAAAAATAAATTGATTAATTGATTTTTATAAATATAATTGT
CCTCTAAAAAAAA
back to top

protein sequence of SMED30033540-orf-1

>SMED30033540-orf-1 ID=SMED30033540-orf-1|Name=SMED30033540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=267bp
MSDSDFESNDFPKTQEKVNSSNFYGVYLMISENPKEKNKSYIGFTNDPEN
RLKRHNNKGGARATQGKGPWKMILVIHGFPNELYALRFEWAWQSPDLSRR
LKHLELNPKGFKKLEFRMIVLAHCLRTGPWCRLGLIIRWLCPQYEQPFPL
NLNPPNHMPIIYGSIDFKKFSSKTIKSDLPVKSDFHSCGICQDLIVEGLV
SCLNDACNAKWHLVCIAGCFLAQSLQQTYLLPIEGRCPCCDATLVWTRLV
ENLAFQSSRIKNKLIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR035901GIY-YIG_endonuc_sf
IPR013083Znf_RING/FYVE/PHD
IPR000305GIY-YIG_endonuc
Vocabulary: molecular function
TermDefinition
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0004520endodeoxyribonuclease activity
GO:0016787hydrolase activity
GO:00171085'-flap endonuclease activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0033557Slx1-Slx4 complex
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000305GIY-YIG endonucleaseSMARTSM00465uri_9coord: 23..117
e-value: 3.0E-4
score: 30.1
IPR000305GIY-YIG endonucleasePFAMPF01541GIY-YIGcoord: 24..95
e-value: 6.0E-17
score: 61.7
IPR000305GIY-YIG endonucleasePROSITEPS50164GIY_YIGcoord: 22..104
score: 18.949
IPR035901GIY-YIG endonuclease superfamilyGENE3DG3DSA:3.40.1440.10coord: 19..123
e-value: 1.0E-17
score: 65.8
IPR035901GIY-YIG endonuclease superfamilySUPERFAMILYSSF82771GIY-YIG endonucleasecoord: 23..94
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 184..255
e-value: 2.7E-12
score: 48.5
NoneNo IPR availablePANTHERPTHR20208FAMILY NOT NAMEDcoord: 197..256
NoneNo IPR availablePANTHERPTHR20208:SF10STRUCTURE-SPECIFIC ENDONUCLEASE SUBUNIT SLX1coord: 197..256
NoneNo IPR availablePANTHERPTHR20208:SF10STRUCTURE-SPECIFIC ENDONUCLEASE SUBUNIT SLX1coord: 14..170
NoneNo IPR availablePANTHERPTHR20208FAMILY NOT NAMEDcoord: 14..170
NoneNo IPR availableCDDcd10455GIY-YIG_SLX1coord: 23..95
e-value: 5.98902E-40
score: 131.201