GCR366

Overview
NameGCR366
Smed IDSMED30033539
Length (bp)1139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR366 (SMED30033539) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR366 (SMED30033539) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR366 (SMED30033539) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR366 (SMED30033539) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033539

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033539SMESG000028611.1 SmedASXL_000610SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033539SMESG000028611.1 dd_Smed_v6_25657_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033539SMESG000028611.1 OX_Smed_1.0.14302ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR366 vs. Ensembl Human
Match: SSTR4 (somatostatin receptor 4 [Source:HGNC Symbol;Acc:HGNC:11333])

HSP 1 Score: 128.257 bits (321), Expect = 6.267e-33
Identity = 91/266 (34.21%), Postives = 147/266 (55.26%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQ---LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+T TNIYLL L++ D   ++S+ FV S+  L  + FG+VLCR  L+++G+N F   F LT LS+DR++AV HP RA ++R    A ++ + ++L  +++  P+A++A+ +      +V         C L  P      +F +  F +GF +PVL + + Y +I  K++ ++    A     R+S K ITR   +++V++VL W+P++V Q   LFV S   T   V L        L Y NS  NP+ Y F+S  FR  +  V
Sbjct:   77 KMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVA--------CNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR--AGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSL-------ILSYANSCANPILYGFLSDNFRRFFQRV 325          
BLAST of GCR366 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 115.546 bits (288), Expect = 5.721e-29
Identity = 81/265 (30.57%), Postives = 143/265 (53.96%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR-LFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IPT       +F + +F   F VPVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV+++ L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:    4 KMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 253          
BLAST of GCR366 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 115.546 bits (288), Expect = 5.721e-29
Identity = 81/265 (30.57%), Postives = 143/265 (53.96%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR-LFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IPT       +F + +F   F VPVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV+++ L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:    4 KMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 253          
BLAST of GCR366 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 115.546 bits (288), Expect = 5.721e-29
Identity = 81/265 (30.57%), Postives = 143/265 (53.96%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR-LFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IPT       +F + +F   F VPVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV+++ L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:    4 KMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 253          
BLAST of GCR366 vs. Ensembl Human
Match: OPRL1 (opioid related nociceptin receptor 1 [Source:HGNC Symbol;Acc:HGNC:8155])

HSP 1 Score: 116.701 bits (291), Expect = 8.115e-29
Identity = 82/272 (30.15%), Postives = 146/272 (53.68%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR-LFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            Y++    +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IPT       +F + +F   F VPVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV+++ L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:   74 YVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 330          
BLAST of GCR366 vs. Ensembl Celegans
Match: npr-16 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQQ4])

HSP 1 Score: 94.7449 bits (234), Expect = 3.200e-21
Identity = 73/268 (27.24%), Postives = 137/268 (51.12%), Query Frame = 3
Query:  186 RFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVV-LEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYA-EIKIDLK-NHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIG-FAVPVLCMIIFYTMIYRKLQFISHHNTALSVN--SRKSMKSITRFAFLLIVIYVLFWLPYWVNQLF-VISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMY 968
            R  +R++TN+Y++ L + D  +L  +I V +T +  + + FG  +C +    E    +A    +  L+ DR+IA+C       +RT +TA+ +  + ++   +   PL VYA EIK+ ++  +  +  E     C    P+     + +S+ S+  F +P L +   Y  ++ KL+  +  +  L  N  SR S + +TR    +++ ++L W P+W+  LF  I R+    ++M  I  +     Y+N ALNP+ YA+ ++ FRT +
Sbjct:   36 RPYLRSITNVYMIGLCLADFIYLADLILVAATSLNGKSWPFGPTICHLFHGTEATGKYASVLFVVLLAADRYIAMCKSDLCGRYRTYRTAIFLSGLAWIAAFICSLPLYVYADEIKVRMRPKNGTDSIENNHTLCIAHWPSPPHAQWYISVCSVMIFILPGLVIFYCYYHVFCKLREAAKGSRRLHRNKRSRSSYQRVTRSVQRVVLFHLLCWSPFWLFNLFSAIFRVRITTQLMRIIVNIIHLFPYVNCALNPVLYAYRAENFRTAF 303          
BLAST of GCR366 vs. Ensembl Celegans
Match: npr-16 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQQ4])

HSP 1 Score: 94.3597 bits (233), Expect = 3.855e-21
Identity = 73/268 (27.24%), Postives = 137/268 (51.12%), Query Frame = 3
Query:  186 RFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVV-LEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYA-EIKIDLK-NHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIG-FAVPVLCMIIFYTMIYRKLQFISHHNTALSVN--SRKSMKSITRFAFLLIVIYVLFWLPYWVNQLF-VISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMY 968
            R  +R++TN+Y++ L + D  +L  +I V +T +  + + FG  +C +    E    +A    +  L+ DR+IA+C       +RT +TA+ +  + ++   +   PL VYA EIK+ ++  +  +  E     C    P+     + +S+ S+  F +P L +   Y  ++ KL+  +  +  L  N  SR S + +TR    +++ ++L W P+W+  LF  I R+    ++M  I  +     Y+N ALNP+ YA+ ++ FRT +
Sbjct:   36 RPYLRSITNVYMIGLCLADFIYLADLILVAATSLNGKSWPFGPTICHLFHGTEATGKYASVLFVVLLAADRYIAMCKSDLCGRYRTYRTAIFLSGLAWIAAFICSLPLYVYADEIKVRMRPKNGTDSIENNHTLCIAHWPSPPHAQWYISVCSVMIFILPGLVIFYCYYHVFCKLREAAKGSRRLHRNKRSRSSYQRVTRSVQRVVLFHLLCWSPFWLFNLFSAIFRVRITTQLMRIIVNIIHLFPYVNCALNPVLYAYRAENFRTAF 303          
BLAST of GCR366 vs. Ensembl Celegans
Match: npr-16 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQQ4])

HSP 1 Score: 94.3597 bits (233), Expect = 4.197e-21
Identity = 73/268 (27.24%), Postives = 137/268 (51.12%), Query Frame = 3
Query:  186 RFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVV-LEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYA-EIKIDLK-NHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIG-FAVPVLCMIIFYTMIYRKLQFISHHNTALSVN--SRKSMKSITRFAFLLIVIYVLFWLPYWVNQLF-VISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMY 968
            R  +R++TN+Y++ L + D  +L  +I V +T +  + + FG  +C +    E    +A    +  L+ DR+IA+C       +RT +TA+ +  + ++   +   PL VYA EIK+ ++  +  +  E     C    P+     + +S+ S+  F +P L +   Y  ++ KL+  +  +  L  N  SR S + +TR    +++ ++L W P+W+  LF  I R+    ++M  I  +     Y+N ALNP+ YA+ ++ FRT +
Sbjct:   46 RPYLRSITNVYMIGLCLADFIYLADLILVAATSLNGKSWPFGPTICHLFHGTEATGKYASVLFVVLLAADRYIAMCKSDLCGRYRTYRTAIFLSGLAWIAAFICSLPLYVYADEIKVRMRPKNGTDSIENNHTLCIAHWPSPPHAQWYISVCSVMIFILPGLVIFYCYYHVFCKLREAAKGSRRLHRNKRSRSSYQRVTRSVQRVVLFHLLCWSPFWLFNLFSAIFRVRITTQLMRIIVNIIHLFPYVNCALNPVLYAYRAENFRTAF 313          
BLAST of GCR366 vs. Ensembl Celegans
Match: npr-16 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQQ4])

HSP 1 Score: 94.3597 bits (233), Expect = 4.714e-21
Identity = 73/268 (27.24%), Postives = 137/268 (51.12%), Query Frame = 3
Query:  186 RFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVV-LEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYA-EIKIDLK-NHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIG-FAVPVLCMIIFYTMIYRKLQFISHHNTALSVN--SRKSMKSITRFAFLLIVIYVLFWLPYWVNQLF-VISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMY 968
            R  +R++TN+Y++ L + D  +L  +I V +T +  + + FG  +C +    E    +A    +  L+ DR+IA+C       +RT +TA+ +  + ++   +   PL VYA EIK+ ++  +  +  E     C    P+     + +S+ S+  F +P L +   Y  ++ KL+  +  +  L  N  SR S + +TR    +++ ++L W P+W+  LF  I R+    ++M  I  +     Y+N ALNP+ YA+ ++ FRT +
Sbjct:   46 RPYLRSITNVYMIGLCLADFIYLADLILVAATSLNGKSWPFGPTICHLFHGTEATGKYASVLFVVLLAADRYIAMCKSDLCGRYRTYRTAIFLSGLAWIAAFICSLPLYVYADEIKVRMRPKNGTDSIENNHTLCIAHWPSPPHAQWYISVCSVMIFILPGLVIFYCYYHVFCKLREAAKGSRRLHRNKRSRSSYQRVTRSVQRVVLFHLLCWSPFWLFNLFSAIFRVRITTQLMRIIVNIIHLFPYVNCALNPVLYAYRAENFRTAF 313          
BLAST of GCR366 vs. Ensembl Celegans
Match: npr-32 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:O62403])

HSP 1 Score: 93.2041 bits (230), Expect = 1.164e-20
Identity = 84/288 (29.17%), Postives = 140/288 (48.61%), Query Frame = 3
Query:  177 VSGRFRMRTVTN---IYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEI-KIDLKNHSVNQTEYAKHYCTLMIPT--------ENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHH-----NTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYW----VNQ--LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYL 971
            V    RM + TN   IY+L LSIVD+  ++ + F+   ++  Q++FG  +C++    E +N    +F++T LS DR++AVC P +++  R+  TAL V++   +   VLL P+   A + KID K   V   E  +      +          +    FTL  F IGFA P   +IIFY  +   LQ  S +       +    S   +K +T+    +I+ Y L W P W    ++Q  L  +S +      M ++      L   NSA NP+ YA+++++ R+ ++
Sbjct:   64 VQAGKRMMSSTNHVFIYVLGLSIVDLLVILHLPFLVVDLLKGQWLFGVAMCKVYWFGESVNKLLSSFLMTVLSWDRYMAVCSPVKSMKMRSNATALKVLLACTIFATVLLLPVLYEAAVFKID-KMRMVPLLEGTEELAASDLAGTTMSKCMFDADATFTLYTFVIGFAAPAFLIIIFYVQVIYALQKSSRNIRGARGISKPDGSSNRVKKVTKRIVAVILFYFLCWTPQWTLNIMSQFNLIAVSWMTPALSAMFFVA---HLLVCFNSAANPVLYAYINRELRSQHV 347          
BLAST of GCR366 vs. Ensembl Fly
Match: AstC-R1 (gene:FBgn0036790 transcript:FBtr0089578)

HSP 1 Score: 130.183 bits (326), Expect = 2.143e-33
Identity = 90/286 (31.47%), Postives = 152/286 (53.15%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRN----LFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVI-----SRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND 1001
            Y+V    +M+TVTNIY+L L++ D   LI I F+  T+ +  + FG  +C+  +    I  F  +  L  +S DR+IAVCHP  +  +RT+  A VV  I +    VL+ P+ +YA         +V Q +   + C +M P   +      F L  F +GFA P+  ++ FY ++ RKL+ +       S   R++ + +TR    +I +Y+L WLP+W++Q+ +I      R  +   ++++  ++   L Y NSA+NP+ YAF+S+ FR  + +  TC +  D
Sbjct:  100 YVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLLYTMRICSWRFGEFMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYAS--------TVEQEDGINYSCNIMWPDAYKKHSGTTFILYTFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEKRRAHRKVTRLVLTVISVYILCWLPHWISQVALIHSNPAQRDLSRLEILIF--LLLGALVYSNSAVNPILYAFLSENFRKSFFKAFTCMNKQD 375          
BLAST of GCR366 vs. Ensembl Fly
Match: AstC-R2 (gene:FBgn0036789 transcript:FBtr0089387)

HSP 1 Score: 120.939 bits (302), Expect = 7.439e-30
Identity = 89/301 (29.57%), Postives = 153/301 (50.83%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMF-----SIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNW--RVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND---------SFLKLFGE 1025
            Y+V    +M+TVTNIY+L L+I D   LI I F+  T+ +  + FG  +C+  +    I  F  +  L  +S DR+IAVCHP  +  +RT   + +V    ++  ++L+ P+ ++A         S  Q+      C +  P + +N  T S F      +GFA P+  +++FY ++ RKL  +   +   S   ++S + +T+    +I  Y+  WLP+W++Q+ +IS        R+ L + +    L Y NSA+NP+ YAF+S  F+  +++  TC +  D         SF   FG+
Sbjct:  168 YVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFA---------STVQSSNGNVSCNIEWP-DTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHK--SKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPKFGK 456          
BLAST of GCR366 vs. Ensembl Fly
Match: AstC-R2 (gene:FBgn0036789 transcript:FBtr0332867)

HSP 1 Score: 120.939 bits (302), Expect = 7.439e-30
Identity = 89/301 (29.57%), Postives = 153/301 (50.83%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMF-----SIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNW--RVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND---------SFLKLFGE 1025
            Y+V    +M+TVTNIY+L L+I D   LI I F+  T+ +  + FG  +C+  +    I  F  +  L  +S DR+IAVCHP  +  +RT   + +V    ++  ++L+ P+ ++A         S  Q+      C +  P + +N  T S F      +GFA P+  +++FY ++ RKL  +   +   S   ++S + +T+    +I  Y+  WLP+W++Q+ +IS        R+ L + +    L Y NSA+NP+ YAF+S  F+  +++  TC +  D         SF   FG+
Sbjct:  168 YVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFA---------STVQSSNGNVSCNIEWP-DTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHK--SKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPKFGK 456          
BLAST of GCR366 vs. Ensembl Fly
Match: AstC-R2 (gene:FBgn0036789 transcript:FBtr0330088)

HSP 1 Score: 120.939 bits (302), Expect = 8.962e-30
Identity = 89/301 (29.57%), Postives = 153/301 (50.83%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMF-----SIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNW--RVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND---------SFLKLFGE 1025
            Y+V    +M+TVTNIY+L L+I D   LI I F+  T+ +  + FG  +C+  +    I  F  +  L  +S DR+IAVCHP  +  +RT   + +V    ++  ++L+ P+ ++A         S  Q+      C +  P + +N  T S F      +GFA P+  +++FY ++ RKL  +   +   S   ++S + +T+    +I  Y+  WLP+W++Q+ +IS        R+ L + +    L Y NSA+NP+ YAF+S  F+  +++  TC +  D         SF   FG+
Sbjct:  168 YVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFA---------STVQSSNGNVSCNIEWP-DTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHK--SKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPKFGK 456          
BLAST of GCR366 vs. Ensembl Fly
Match: AstC-R2 (gene:FBgn0036789 transcript:FBtr0346968)

HSP 1 Score: 120.939 bits (302), Expect = 1.005e-29
Identity = 89/301 (29.57%), Postives = 153/301 (50.83%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMF-----SIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNW--RVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND---------SFLKLFGE 1025
            Y+V    +M+TVTNIY+L L+I D   LI I F+  T+ +  + FG  +C+  +    I  F  +  L  +S DR+IAVCHP  +  +RT   + +V    ++  ++L+ P+ ++A         S  Q+      C +  P + +N  T S F      +GFA P+  +++FY ++ RKL  +   +   S   ++S + +T+    +I  Y+  WLP+W++Q+ +IS        R+ L + +    L Y NSA+NP+ YAF+S  F+  +++  TC +  D         SF   FG+
Sbjct:  168 YVVMRFSKMQTVTNIYILNLAIADECFLIGIPFLLYTMQVGNWPFGNYMCKAYMVSTSITSFTSSIFLLIMSADRYIAVCHPISSPRYRTPFVSKLVSAFAWMTSVLLMLPVILFA---------STVQSSNGNVSCNIEWP-DTQNSHTDSTFILYSLVLGFATPLTFILVFYCLVIRKLHTVGPKHK--SKEKKRSHRKVTKLVLTVISAYIFCWLPHWISQVALISSAPQRCASRLELAVFLACGCLSYSNSAMNPILYAFLSDNFKKSFMKACTCAARKDVNAQLQLENSFFPKFGK 456          
BLAST of GCR366 vs. Ensembl Zebrafish
Match: sstr1b (somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-120410-2])

HSP 1 Score: 118.627 bits (296), Expect = 1.126e-29
Identity = 82/267 (30.71%), Postives = 148/267 (55.43%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFR 959
            Y++    +M+T TNIY+L L+I D   ++S+ F+ ++  +  + FG+++CR+ L+++GIN F   F LT LS+DR+IAV HP +A  +R    A VV V ++ + ++++ P+ ++A+  +  ++  V+        C  M P  +    F +  F +GF +PV  + + Y +I  +++ +      L    R+S K ITR   L++ ++VL W+P+++ QL  + R   +        ++TQ    L Y NS  NP+ Y F+S  FR
Sbjct:   61 YVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAVHHWPFGSLMCRLVLSVDGINMFTSIFCLTVLSVDRYIAVVHPIKAARYRRPTVAKVVNVCVWGLSLLVILPIIIFAD-TVPAQDGGVD--------CNFMWPESSWSEAFVVYTFLLGFLLPVGAICLCYCLIVVRMRAVGLKAGWL--QRRRSEKKITRMVLLVVAVFVLCWMPFYIVQLISVFRKPPD-------PMVTQLFVILSYANSGANPILYGFVSDNFR 309          
BLAST of GCR366 vs. Ensembl Zebrafish
Match: sstr1b (somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-120410-2])

HSP 1 Score: 118.627 bits (296), Expect = 1.191e-29
Identity = 82/267 (30.71%), Postives = 148/267 (55.43%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFR 959
            Y++    +M+T TNIY+L L+I D   ++S+ F+ ++  +  + FG+++CR+ L+++GIN F   F LT LS+DR+IAV HP +A  +R    A VV V ++ + ++++ P+ ++A+  +  ++  V+        C  M P  +    F +  F +GF +PV  + + Y +I  +++ +      L    R+S K ITR   L++ ++VL W+P+++ QL  + R   +        ++TQ    L Y NS  NP+ Y F+S  FR
Sbjct:   62 YVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAVHHWPFGSLMCRLVLSVDGINMFTSIFCLTVLSVDRYIAVVHPIKAARYRRPTVAKVVNVCVWGLSLLVILPIIIFAD-TVPAQDGGVD--------CNFMWPESSWSEAFVVYTFLLGFLLPVGAICLCYCLIVVRMRAVGLKAGWL--QRRRSEKKITRMVLLVVAVFVLCWMPFYIVQLISVFRKPPD-------PMVTQLFVILSYANSGANPILYGFVSDNFR 310          
BLAST of GCR366 vs. Ensembl Zebrafish
Match: sstr2a (somatostatin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-140130-1])

HSP 1 Score: 117.857 bits (294), Expect = 2.402e-29
Identity = 75/272 (27.57%), Postives = 145/272 (53.31%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFS---IGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+TVTNIY+L L++ D+  ++S+ F+   + L  + FG+ +CR+ L ++ +N F   F LT +S DR++AV HP ++  WR  + A  + + ++ + +++  P+ +Y+          VN  +     CT++ P      +T  +F    +GF +P++ + + Y +I  K++  S      S   ++S + +TR   +++V++VL WLP++V  +  ++       V+         LGY NS  NP+ YAF+S  F+  +  V
Sbjct:   73 YVILRYAKMKTVTNIYILNLAVADVLCMLSLPFIAIQLSLLHWPFGSAICRVVLTVDSMNQFTSIFFLTVMSFDRYLAVVHPIKSTKWRKPRMAKTISLGMWSVALLVNLPIMIYS---------GVNAKKNEARTCTMLWPEPQNTYYTAFIFYTFFLGFFLPLIVISMCYLLIVIKVK--SSGMRVGSTKRKRSERKVTRMVSIVVVVFVLCWLPFYVFNVTSVTGTVPTTPVLKSTFDFVVVLGYANSCANPILYAFLSDNFKKSFQNV 333          
BLAST of GCR366 vs. Ensembl Zebrafish
Match: sstr2b (somatostatin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-130530-727])

HSP 1 Score: 113.62 bits (283), Expect = 7.915e-28
Identity = 72/275 (26.18%), Postives = 150/275 (54.55%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRK---SMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+TVTNIY+L L++ DI  ++S+ F+   + +  + FG  +C + + ++ +N F   F L  +SIDR++AV HP ++I WR  + A    V ++++ ++++ P+  Y+ +           T+    +C+++ P      +  F +  F +GF +P++ + + Y +I  K++     ++ + V+S K   S K +TR   ++++++V  WLP+++  +  ++   ++   +  +      LGY NS  NP+ YAF+S+ FR  +  V
Sbjct:   71 YVILRYAKMKTVTNIYILNLAVADILFMLSLPFIAIQLAMVHWPFGATMCHVVITIDSLNQFTSIFCLMVMSIDRYLAVVHPMKSIKWRKPQVAKATNVAVWVVSLLVILPVVFYSGLI----------TKAEGCFCSIVWPDPQGAYQTAFMIYTFLLGFFLPLMVICLCYLLIIIKVK-----SSGIKVSSSKRRYSEKKVTRLVSVVVLVFVFCWLPFYIFNMTSVTGTISDTPFLRSVFAFVVVLGYANSCANPILYAFLSENFRKSFQNV 330          
BLAST of GCR366 vs. Ensembl Zebrafish
Match: sstr5 (somatostatin receptor 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2502])

HSP 1 Score: 113.235 bits (282), Expect = 1.104e-27
Identity = 83/266 (31.20%), Postives = 144/266 (54.14%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNL----FTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+TVTN+Y+L L++ D  +++ + F+ +  VL  + FG  LCRI +  + I+ F  TF LT +SIDR++AV HP R+  WR    A V+  +++ +  +L  P+ +Y +++  L              C L  P E R++    F L    +GF  P+L + + Y +I  K++  S     LS   RKS K +TR   +++V++V+ WLP+++  +F +        ++  +  +T  L Y+NS  NPL Y F+S  F+  + +V
Sbjct:   64 KMKTVTNMYILNLAVADELYILGLPFLTTHNVLSYWPFGNFLCRILMWADSISQFTSTFCLTVMSIDRYMAVVHPIRSARWRRPSVAKVINSMVWALSCLLTLPVIIYCDVQPGLNT------------CNLSWP-EPRDVWSTAFILYTAILGFFCPLLVICLCYLLIVIKVKSASAR-AGLS-KRRKSEKKVTRMVVIIVVVFVICWLPFFMLNIFNLVVTLPENNIITGVYFLTVILTYVNSCANPLLYGFLSDNFKRSFQKV 314          
BLAST of GCR366 vs. Ensembl Xenopus
Match: ENSXETT00000030515.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:10:22925282:22927025:1 gene:ENSXETG00000003540.1 transcript:ENSXETT00000030515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 2.758e-32
Identity = 78/272 (28.68%), Postives = 144/272 (52.94%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFT---LSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+T+TNIY+L L+I D   ++ + F+   V L  + FG  +CRI + ++GIN F   F LT +SIDR++AV HP ++  WR  +TA +V   ++ + ++++ P+  YA +          Q+ + +  CT++ P  +   +T   +  F +GF VP+  + + Y  I  K++  S      S   ++S K +TR   +++ +++  WLP+++  +  +S L      +  +      L Y NS  NP+ YAF+S  F+  +  V
Sbjct:   58 YVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRIVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNAAVWTVSLLVIMPIMTYAGV----------QSYHGRGSCTIIWPGNSSAWYTGFIIYAFILGFLVPLSIICLCYLFIIIKVK--SSGIRVGSSKRKRSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSLLIVPTPGLKAMWDFVVVLSYANSCANPILYAFLSDNFKKSFQNV 317          
BLAST of GCR366 vs. Ensembl Xenopus
Match: ap5b1 (adaptor related protein complex 5 subunit beta 1 [Source:Xenbase;Acc:XB-GENE-6464234])

HSP 1 Score: 122.865 bits (307), Expect = 4.088e-31
Identity = 81/257 (31.52%), Postives = 147/257 (57.20%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFR 959
            +M+T TNIY+L L+I D   ++S+ F+ ++  L+ + FG+ +CR  L+++GIN F   F LT LS+DR++AV HP RA  +R    A ++ + ++++ ++++SP+ ++A+  +  KN  V         C LM P +    +F +  F +GF +PV+ + + Y +I  K++ ++    A     +KS K ITR   +++ ++V+ W+P+++ QL     LF    +   I  ++  L Y NS  NP+ Y F S  F+
Sbjct:   61 KMKTATNIYILNLAIADELFMLSVPFLAASAALQHWPFGSGMCRTVLSVDGINMFTSVFCLTVLSVDRYVAVVHPLRAARYRRPTVAKMINICVWIVSLLVISPILIFAD-TMPSKNGVV--------VCNLMWPHQTWSAVFVIYTFLLGFFLPVVAICLCYILIIIKMRAVALK--AGWQQRKKSEKKITRMVLMVVTVFVICWMPFYIVQLL---NLFLP-HMDATINHISLILSYANSCANPILYGFFSDNFK 302          
BLAST of GCR366 vs. Ensembl Xenopus
Match: SSTR5 (somatostatin receptor 5 [Source:NCBI gene;Acc:100486456])

HSP 1 Score: 109.768 bits (273), Expect = 2.455e-26
Identity = 72/275 (26.18%), Postives = 140/275 (50.91%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNS---RKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y+V    +M+TVTNIY+L L++ D+  ++ + F+ +   +  + FGT LCR+ + ++G+N F   F LT +SIDR++AV HP ++  WR  + A ++   ++ +  ++  P+ +++E++ D             H C +  P         F +    +GF  P+  + + Y +I  K++     ++ L V S   R+S + +TR   +++ ++V  WLP+++  +  +S           +      L Y NS  NP+ Y F+S  F+  + +V
Sbjct:   66 YVVLRYAKMKTVTNIYILNLAVADVLFMLGLPFLATQNAISYWPFGTFLCRLVMTVDGVNQFTSIFCLTVMSIDRYLAVVHPIKSTKWRRPRVAKLISATVWTLSFLVTLPVIIFSEVQPDY------------HTCNISWPDPVSVWAAAFIIYTSVLGFFGPLSVICLCYLLIVIKVK-----SSGLRVGSTRRRRSERKVTRMVVIIVAVFVFCWLPFYILNIVNLSFFVPEEPAFAGVYFFVVVLSYANSCANPILYGFLSDNFKQSFQKV 323          
BLAST of GCR366 vs. Ensembl Xenopus
Match: OPRD1 (opioid receptor delta 1 [Source:NCBI gene;Acc:100490669])

HSP 1 Score: 108.227 bits (269), Expect = 8.322e-26
Identity = 79/268 (29.48%), Postives = 138/268 (51.49%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTN-WRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TNIY+  L++ D     ++ F  +  ++E + FG  LC++ L+++  N F   F LT +S+DR+IAVCHP RA+ +RT   A  + V I+++  V+  P+ V A  K          T+     CTL  P  +     +  + +F   F VPVL + + Y ++  +L+  S    + S    ++++ ITR   +++  +++ W P     +FVI     +  +   Y+     F   LGY NS+LNP+ YAF+ + F+  + E
Sbjct:   78 KMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGEALCKVVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALDFRTPSKAKAINVCIWILSSVIGVPIMVMAVTK---------TTKAGTITCTLQFPRPDWYWDTVTKICVFIFAFVVPVLVITMCYGLMILRLR--SVRLLSGSREKDRNLRRITRMVLVVVAAFIICWTPI---HIFVIVWTMVDIDKRNPYVVASWHFCIALGYTNSSLNPVLYAFLDENFKRCFRE 331          
BLAST of GCR366 vs. Ensembl Xenopus
Match: OPRD1 (opioid receptor delta 1 [Source:NCBI gene;Acc:100490669])

HSP 1 Score: 108.227 bits (269), Expect = 9.044e-26
Identity = 79/268 (29.48%), Postives = 138/268 (51.49%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTN-WRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TNIY+  L++ D     ++ F  +  ++E + FG  LC++ L+++  N F   F LT +S+DR+IAVCHP RA+ +RT   A  + V I+++  V+  P+ V A  K          T+     CTL  P  +     +  + +F   F VPVL + + Y ++  +L+  S    + S    ++++ ITR   +++  +++ W P     +FVI     +  +   Y+     F   LGY NS+LNP+ YAF+ + F+  + E
Sbjct:   89 KMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGEALCKVVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALDFRTPSKAKAINVCIWILSSVIGVPIMVMAVTK---------TTKAGTITCTLQFPRPDWYWDTVTKICVFIFAFVVPVLVITMCYGLMILRLR--SVRLLSGSREKDRNLRRITRMVLVVVAAFIICWTPI---HIFVIVWTMVDIDKRNPYVVASWHFCIALGYTNSSLNPVLYAFLDENFKRCFRE 342          
BLAST of GCR366 vs. Ensembl Mouse
Match: Sstr4 (somatostatin receptor 4 [Source:MGI Symbol;Acc:MGI:105372])

HSP 1 Score: 136.732 bits (343), Expect = 2.992e-36
Identity = 91/266 (34.21%), Postives = 144/266 (54.14%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQ---LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+T TNIYLL L++ D   ++S+ FV S   L  + FG VLCR  L+++G+N F   F LT LS+DR++AV HP RA ++R    A ++ + ++L  +++  P+AV+A+ +      +V         C L  P      +F +  F +GF +PVL + + Y +I  K++ ++    A     R+S K ITR   +++ ++VL W+P++V Q   LFV S   T   V L        L Y NS  NP+ Y F+S  FR  +  V
Sbjct:   74 KMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVFADTRPARGGEAVA--------CNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR--AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSL-------ILSYANSCANPILYGFLSDNFRRSFQRV 322          
BLAST of GCR366 vs. Ensembl Mouse
Match: Sstr2 (somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI:98328])

HSP 1 Score: 116.701 bits (291), Expect = 3.267e-29
Identity = 78/281 (27.76%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFT---LSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDS 1004
            Y++    +M+T+TNIY+L L+I D   ++ + F+   V L  + FG  +CR+ + ++GIN F   F LT +SIDR++AV HP ++  WR  +TA ++ V ++ + ++++ P+ +YA ++           ++ +  CT+  P E+   +T   +  F +GF VP+  + + Y  I  K++  S      S   +KS K +TR   +++ +++  WLP+++  +  +S   +    +  +      L Y NS  NP+ YAF+S  F+  +  V      ++S
Sbjct:   66 YVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIYAGLR---------SNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVK--SSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKADNS 335          
BLAST of GCR366 vs. Ensembl Mouse
Match: Sstr2 (somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI:98328])

HSP 1 Score: 116.701 bits (291), Expect = 3.267e-29
Identity = 78/281 (27.76%), Postives = 149/281 (53.02%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFT---LSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDS 1004
            Y++    +M+T+TNIY+L L+I D   ++ + F+   V L  + FG  +CR+ + ++GIN F   F LT +SIDR++AV HP ++  WR  +TA ++ V ++ + ++++ P+ +YA ++           ++ +  CT+  P E+   +T   +  F +GF VP+  + + Y  I  K++  S      S   +KS K +TR   +++ +++  WLP+++  +  +S   +    +  +      L Y NS  NP+ YAF+S  F+  +  V      ++S
Sbjct:   66 YVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIYAGLR---------SNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVK--SSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNVLCLVKADNS 335          
BLAST of GCR366 vs. Ensembl Mouse
Match: Sstr2 (somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI:98328])

HSP 1 Score: 115.931 bits (289), Expect = 1.064e-28
Identity = 77/272 (28.31%), Postives = 146/272 (53.68%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFT---LSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+T+TNIY+L L+I D   ++ + F+   V L  + FG  +CR+ + ++GIN F   F LT +SIDR++AV HP ++  WR  +TA ++ V ++ + ++++ P+ +YA ++           ++ +  CT+  P E+   +T   +  F +GF VP+  + + Y  I  K++  S      S   +KS K +TR   +++ +++  WLP+++  +  +S   +    +  +      L Y NS  NP+ YAF+S  F+  +  V
Sbjct:   66 YVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIYAGLR---------SNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVK--SSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVILTYANSCANPILYAFLSDNFKKSFQNV 326          
BLAST of GCR366 vs. Ensembl Mouse
Match: Oprl1 (opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:97440])

HSP 1 Score: 112.464 bits (280), Expect = 1.703e-27
Identity = 80/272 (29.41%), Postives = 143/272 (52.57%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFV-ISRLFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            Y++    +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IP        +F + +F   F +PVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV +  L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:   71 YVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLVQGLGVQPGSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 327          
BLAST of GCR366 vs. UniProt/SwissProt
Match: sp|P30937|SSR4_RAT (Somatostatin receptor type 4 OS=Rattus norvegicus OX=10116 GN=Sstr4 PE=1 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.853e-35
Identity = 91/266 (34.21%), Postives = 144/266 (54.14%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQ---LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+T TNIYLL L++ D   ++S+ FV S   L  + FG VLCR  L+++G+N F   F LT LS+DR++AV HP RA ++R    A ++ + ++L  +++  P+AV+A+ +      +V         C L  P      +F +  F +GF +PVL + + Y +I  K++ ++    A     R+S K ITR   +++ ++VL W+P++V Q   LFV S   T   V L        L Y NS  NP+ Y F+S  FR  +  V
Sbjct:   73 KMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVFADTRPARGGEAVA--------CNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR--AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSL-------ILSYANSCANPILYGFLSDNFRRSFQRV 321          
BLAST of GCR366 vs. UniProt/SwissProt
Match: sp|P31391|SSR4_HUMAN (Somatostatin receptor type 4 OS=Homo sapiens OX=9606 GN=SSTR4 PE=2 SV=2)

HSP 1 Score: 128.257 bits (321), Expect = 3.010e-32
Identity = 91/266 (34.21%), Postives = 147/266 (55.26%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQ---LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+T TNIYLL L++ D   ++S+ FV S+  L  + FG+VLCR  L+++G+N F   F LT LS+DR++AV HP RA ++R    A ++ + ++L  +++  P+A++A+ +      +V         C L  P      +F +  F +GF +PVL + + Y +I  K++ ++    A     R+S K ITR   +++V++VL W+P++V Q   LFV S   T   V L        L Y NS  NP+ Y F+S  FR  +  V
Sbjct:   77 KMKTATNIYLLNLAVADELFMLSVPFVASSAALRHWPFGSVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAIFADTRPARGGQAVA--------CNLQWPHPAWSAVFVVYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR--AGWQQRRRSEKKITRLVLMVVVVFVLCWMPFYVVQLLNLFVTSLDATVNHVSL-------ILSYANSCANPILYGFLSDNFRRFFQRV 325          
BLAST of GCR366 vs. UniProt/SwissProt
Match: sp|P49660|SSR4_MOUSE (Somatostatin receptor type 4 OS=Mus musculus OX=10090 GN=Sstr4 PE=1 SV=2)

HSP 1 Score: 127.487 bits (319), Expect = 5.159e-32
Identity = 87/266 (32.71%), Postives = 139/266 (52.26%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQ---LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            +M+T TNIYLL L++ D   ++S+ F  S   L  + FG VLCR  L+++G+N F   F LT LS+DR++AV HP    ++R    A ++ + ++L  +++  P+AV+A+ +      +V         C L  P      +F +  F +GF  PVL + + Y +I  K++ ++          R+S K ITR   +++ ++VL W+P++V Q   LFV S   T   V L        L Y NS  NP+ Y F+S  FR  +  V
Sbjct:   74 KMKTATNIYLLNLAVADELFMLSVPFARSAAALRHWPFGAVLCRAVLSVDGLNMFTSVFCLTVLSVDRYVAVVHPLATATYRRPSVAKLINLGVWLASLLVTLPIAVFADTRPARGGEAV--------ACNLHWPHPAWSAVFVIYTFLLGFLPPVLAIGLCYLLIVGKMRAVALAGG--WQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSL-------ILSYANSCANPILYGFLSDNFRRSFQRV 322          
BLAST of GCR366 vs. UniProt/SwissProt
Match: sp|F1MV99|SSR5_BOVIN (Somatostatin receptor type 5 OS=Bos taurus OX=9913 GN=SSTR5 PE=3 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 1.275e-28
Identity = 77/273 (28.21%), Postives = 141/273 (51.65%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYW----VNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y+V    +M+TVTNIY+L L++ D+  ++ + FV +   +  + FG VLCR+ + L+GIN F   F LT +S+DR++AV HP R+  WR  + A +    ++   +V+  PL V+A+I+      +++  E    +           +F +    +GF  P+L + + Y +I  KL+        +    R+S + +TR   ++++++   WLP++    VN  F +     +     ++ +++    Y NS  NPL Y F+S  FR  + +V
Sbjct:   64 YVVLRHAKMKTVTNIYILNLAVADVLLMLGLPFVATQNAISYWPFGPVLCRLVMTLDGINQFTSIFCLTVMSVDRYLAVVHPIRSARWRRPRVAKLASAAVWAFSLVMSLPLVVFADIQEGWNTCNLSWPEPVGLWGA---------VFIIYTSVLGFFGPLLVICLCYLLIVVKLK---ASGVRVGSTRRRSERKVTRMVVVVVLVFAGCWLPFFIVNIVNLAFALPEEPASAGAYFFVVVLS----YANSCANPLLYGFLSDNFRQSFRKV 320          
BLAST of GCR366 vs. UniProt/SwissProt
Match: sp|P41146|OPRX_HUMAN (Nociceptin receptor OS=Homo sapiens OX=9606 GN=OPRL1 PE=1 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.897e-28
Identity = 82/272 (30.15%), Postives = 146/272 (53.68%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR-LFTNWRVMLYIGIM--TQFLGYLNSALNPLWYAFMSKQFRTMY 968
            Y++    +M+T TNIY+  L++ D   L+++ F  + ++L  + FG  LC+  +A++  N F  TF LTA+S+DR++A+CHP RA+  RT   A  V V I+ +  V+  P+A+              Q E  +  C + IPT       +F + +F   F VPVL + + Y+++ R+L+ +   +   S    ++++ ITR   +++ ++V  W P    Q+FV+++ L         + I+     LGY+NS LNP+ YAF+ + F+  +
Sbjct:   74 YVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSA----------QVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIRRLRGVRLLSG--SREKDRNLRRITRLVLVVVAVFVGCWTPV---QVFVLAQGLGVQPSSETAVAILRFCTALGYVNSCLNPILYAFLDENFKACF 330          
BLAST of GCR366 vs. TrEMBL
Match: A0A193KUG8 (GCR366 OS=Schmidtea mediterranea OX=79327 GN=gcr366 PE=2 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 316/317 (99.68%), Postives = 317/317 (100.00%), Query Frame = 3
Query:   75 MEFKIAVAMKMGCXXXXXXXXXXXXXXXXXXXYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE 1025
            MEFKIAVAMKMGCVTVTVILLIVGLIGNALVIYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTALVVVVIIFLICIVLLSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALS+NSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE
Sbjct:    1 MEFKIAVAMKMGCVTVTVILLIVGLIGNALVIYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTALVVVVIIFLICIVLLSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSINSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE 317          
BLAST of GCR366 vs. TrEMBL
Match: A0A193KUQ1 (GCR320 OS=Schmidtea mediterranea OX=79327 GN=gcr320 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 3.478e-55
Identity = 112/280 (40.00%), Postives = 179/280 (63.93%), Query Frame = 3
Query:  177 VSGRFR-MRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLK 1013
            V GR+  M+T TN+YL+ LSI D+ HL  I+FV + ++ E+F+FG  LC++ L LE  N  A TFILTA S+DR++AVCHP ++ ++R+ K A  ++V+I+LIC+ +L PL +YA I ++ KN+           C + +  E +  F    F +GFA+PV  + +FY ++  KL+ I   N + S + R S++ I +    LI+IY++ W PYW++Q ++I     +  +  Y+G+ TQFLGYLNS++NP+ YAF+S+ FR M++++  C    + FLK
Sbjct:   51 VVGRYSAMQTTTNLYLMSLSIADLLHLAQIVFVVNVILTEKFIFGKWLCKLHLTLEATNSLAVTFILTATSVDRYLAVCHPLKSQTFRSPKVARTIIVLIWLICLFMLCPLFIYANITMNTKNNETTPQ------CMIDL-GEKKLTFVQYTFILGFALPVCSISVFYLLVISKLRNIHRANISRSKDRRDSVQRIIKMILALILIYIVLWFPYWIHQ-WIIQFNDVDPILSFYVGLFTQFLGYLNSSINPILYAFLSQNFRVMFVQILNCQG--NRFLK 320          
BLAST of GCR366 vs. TrEMBL
Match: A0A0P4WDC1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 9.889e-37
Identity = 89/279 (31.90%), Postives = 156/279 (55.91%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFT--NWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND 1001
            Y+V+   +M+TVTN+Y+L L+I D   +I + F+ +T ++E + FG ++C++ +    +N F  +  LT +S DR+IAVCHP  +  +RT   + +V +  + +  +++ P+ +Y+ I     N S  Q      Y    +      +FT+  F + F  PV  + IFYTM+  KL+ +   N +   + ++S + +TR    +I +YVL WLPYW  QL + + +      R M+ + I++  L Y+NSA+NP+ YAF+S  F+  +L+  TC +  D
Sbjct:   74 YVVTRFSKMQTVTNLYILNLAIADELFVIGVPFLMTTTIMEYWPFGFIMCKLYMITTSLNQFTSSLFLTIMSADRYIAVCHPISSPKFRTPMISKLVSLTAWTLSALMIVPVFMYSNI----LNESNGQAS-CNIYWPDSVGVRGYTVFTIYSFVLAFGCPVTFIFIFYTMVILKLKAVGMRNKS---SKKRSHRRVTRLVLTVITVYVLCWLPYWALQLALTNSVDKQVQSRFMVILFIVSSSLSYINSAINPILYAFLSDNFKKSFLKACTCAARRD 344          
BLAST of GCR366 vs. TrEMBL
Match: A0A088AVQ3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Apis mellifera OX=7460 GN=LOC412883 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.043e-36
Identity = 93/282 (32.98%), Postives = 152/282 (53.90%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKH-YCTLMIPTE--NRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIG--IMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND 1001
            Y+V    +M+TVTN+Y++ L+I D   LI I F+ +T+ L  ++FG ++C+  +    IN F  +  L  +S DR+IAVCHP  +   RT   + VV +  +    + + P+ +YA           N  E  K   C +  P +      FTL  F +GFA+P++ ++IFY ++ RKLQ +   N   S   ++S + +T+    +I +YVL WLPYW+ Q+ +I       +  + I   ++  FL Y NSA+NP+ YAF+S  F+  +L+  TC +  D
Sbjct:   63 YVVLRFSKMQTVTNMYIVNLAIADECFLIGIPFLVTTMSLRSWIFGKIMCKAYMTTTSINQFTSSIFLFIMSADRYIAVCHPISSPKIRTPFISKVVSLTAWATSALFMIPIFLYA-----------NAMESEKGINCNIYWPNDRGGHTTFTLYTFILGFAIPLILILIFYFLVIRKLQTVGPKNK--SKEKKRSHRKVTKLVLTVITVYVLCWLPYWLMQVALIYTPPKQCQSKITITSFLLAGFLSYSNSAMNPILYAFLSDNFKKSFLKACTCAAGKD 331          
BLAST of GCR366 vs. TrEMBL
Match: A0A0N7ZC69 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Scylla olivacea OX=85551 PE=3 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 1.219e-36
Identity = 89/279 (31.90%), Postives = 156/279 (55.91%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFT--NWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFND 1001
            Y+V+   +M+TVTN+Y+L L+I D   +I + F+ +T ++E + FG ++C++ +    +N F  +  LT +S DR+IAVCHP  +  +RT   + +V +  + +  +++ P+ +Y+ I     N S  Q      Y    +      +FT+  F + F  PV  + IFYTM+  KL+ +   N +   + ++S + +TR    +I +YVL WLPYW  QL + + +      R M+ + I++  L Y+NSA+NP+ YAF+S  F+  +L+  TC +  D
Sbjct:   89 YVVTRFSKMQTVTNLYILNLAIADELFVIGVPFLMTTTIMEYWPFGFIMCKLYMITTSLNQFTSSLFLTIMSADRYIAVCHPISSPKFRTPMISKLVSLTAWTLSALMIVPVFMYSNI----LNESNGQAS-CNIYWPDSVGVRGYTVFTIYSFVLAFGCPVTFIFIFYTMVILKLKAVGMRNKS---SKKRSHRRVTRLVLTVITVYVLCWLPYWALQLALTNSVDKQVQSRFMVILFIVSSSLSYINSAINPILYAFLSDNFKKSFLKACTCAARRD 359          
BLAST of GCR366 vs. Ensembl Cavefish
Match: sstr1b (somatostatin receptor type 1-like [Source:NCBI gene;Acc:103047747])

HSP 1 Score: 118.627 bits (296), Expect = 9.500e-30
Identity = 81/267 (30.34%), Postives = 150/267 (56.18%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFR 959
            Y++    +M+T TNIY+L L+I D   ++S+ F+ ++  +  + FG+++CR+ L+++GIN F   F LT LS+DR+IAV HP +A  +R    A VV V ++ + ++++ P+ ++A+  +  ++  V+        C  + P  +    F +  F +GF +PV+ + + Y +I  +++ +     A  +  R+S K ITR   L++ ++VL W+P+++ QL  + R   +        ++TQ    L Y NS  NP+ Y F+S  FR
Sbjct:   62 YVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAVRHWPFGSLMCRLVLSVDGINMFTSIFCLTVLSVDRYIAVVHPIKAARYRRPTVAKVVNVCVWGLSLLVILPIIIFAD-TVPAQDGGVD--------CNFLWPESSWSEAFVVYTFLLGFLLPVVAICLCYCLIVVRMRAVGLK--AGWMQRRRSEKKITRMVLLVVAVFVLCWMPFYIVQLISVFRQPPD-------PMVTQLFVILSYANSGANPILYGFVSDNFR 310          
BLAST of GCR366 vs. Ensembl Cavefish
Match: sstr2a (somatostatin receptor type 2-like [Source:NCBI gene;Acc:103031004])

HSP 1 Score: 118.242 bits (295), Expect = 1.432e-29
Identity = 74/272 (27.21%), Postives = 146/272 (53.68%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFS---IGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+TVTNIY+L L++ DI  ++S+ F+   + L  + FG  +CRI L ++ +N F   F LT +SIDR++AV HP ++  WR  + A  + + ++++ +++  P+ +++          +N  +     CT++ P      +T  +F    +GF +P++ + + Y +I  K++  +      S   ++S + +TR   +++V++VL WLP+++  +  ++       V+         LGY NS  NP+ YAF+S  F+  +  V
Sbjct:   73 YVILRYAKMKTVTNIYILNLAVADILCMLSLPFIAIQLALLHWPFGAAICRIVLTMDSLNQFTSIFFLTVMSIDRYLAVVHPIKSTKWRKPRVAKTISLAMWVVSLLVNLPIMIFS---------GLNTNKNEAQTCTMLWPKPQNTYYTAFIFYTFFLGFFLPLIVICLCYLLIVIKVK--TSGMRVCSSKRKRSERKVTRMVSIVVVVFVLCWLPFYMFNVAAVTGTLYPTPVLKSTFDFVVVLGYANSCANPILYAFLSDNFKKSFQNV 333          
BLAST of GCR366 vs. Ensembl Cavefish
Match: oprm1 (delta-type opioid receptor [Source:NCBI gene;Acc:103040064])

HSP 1 Score: 114.775 bits (286), Expect = 2.241e-28
Identity = 79/277 (28.52%), Postives = 145/277 (52.35%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEI---KIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFRTMYLE 974
            Y++    +M+T TNIY+  L++ D     ++ F     ++  + FG VLC+I ++++  N F   F LT +S+DR+IAVCHP +A+ +RT + A +V V  +++   +  P+ V A     ++D + ++++        CTL  P  +    NL  + +F   F +PVL + + Y ++  +L+  S    + S    ++++ ITR   +++ ++++ W P     +FVI +        L   I   F   LGY NS LNP+ YAF+ + F+  + E
Sbjct:   75 YVIIRYTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGDVLCKIVMSIDYYNMFTSIFTLTTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMVMASTTAARVDFRGNTMDID------CTLEFPHPSWYWENLLKICVFIFAFIMPVLIITVCYGLMILRLR--SVRMLSGSKEKDRNLRRITRMVLVVVAVFIICWTPI---HIFVIIKALATIPNSLLQTITWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE 340          
BLAST of GCR366 vs. Ensembl Cavefish
Match: oprd1a (opioid receptor, delta 1a [Source:ZFIN;Acc:ZDB-GENE-990415-199])

HSP 1 Score: 113.235 bits (282), Expect = 5.761e-28
Identity = 78/268 (29.10%), Postives = 139/268 (51.87%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLF--TNWRVMLYIGI--MTQFLGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TNIY+  L++ D     ++ F  +  ++  + FG  LC++ +A++  N F   F LT +S+DR+IAVCHP RA+ +RT   A ++ V I+++   +  P+ + A  ++         TE  K  CTL  P  +     +  + +F   F VPVL + I Y ++  +L+  S    + S    ++M+ ITR   +++  +++ W P     +F+I +     + R    I    +   LGY NS+LNP+ YAF+ + F+  + E
Sbjct:   50 KMKTATNIYIFNLALADALATSTLPFQSAKYLMNTWPFGEPLCKLVIAIDYYNMFTSIFTLTMMSVDRYIAVCHPVRALEFRTPAKAKIINVCIWILSSAIGVPIMIMAVTRV---------TEQGKTVCTLKFPDPDWYWDTVTKICVFIFAFVVPVLVITICYGLMILRLR--SVRLLSGSKEKDRNMRRITRMVLVVVAAFIVCWTPI---HIFIIIKTLVEVDQRNPFVIASWHLCIALGYTNSSLNPVLYAFLDENFKRCFRE 303          
BLAST of GCR366 vs. Ensembl Cavefish
Match: sstr2b (somatostatin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-130530-727])

HSP 1 Score: 113.235 bits (282), Expect = 6.017e-28
Identity = 71/274 (25.91%), Postives = 141/274 (51.46%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMF-----SIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+TVTNIY+L L++ D+  ++S+ F+   + L  + FG  LCR+ + ++ +N F   F L  +SIDR++AV HP ++  WR  + A  + + ++ + +++  P+ +Y+ +           T+    +CT++ P      +T  MF          + V+C+   Y +I  K++  S      S   ++S + +TR   +++ ++V  WLP++V  +  ++   +   ++         LGY NS  NP+ YAF+S+ F+  +  V
Sbjct:   40 YVILRYAKMKTVTNIYILNLAVADVLFMLSLPFIAIQLALVHWPFGLALCRVVMTVDSLNQFTSIFCLMVMSIDRYLAVVHPIKSTKWRKPRVAKTINLAVWGVSLLVNMPIVIYSGL----------ITKPGGCFCTIVWPEPEEAYYTAFMFYTFFLGFFLPLLVICLC--YLLIIVKVK--SSGIRVGSSKRKRSERKVTRMVSIVVAVFVFCWLPFYVFNVTSVTGSISTTPILRSTFAFVVVLGYANSCANPILYAFLSENFKKSFQNV 299          
BLAST of GCR366 vs. Ensembl Sea Lamprey
Match: sstr1a (somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-090429-1])

HSP 1 Score: 127.102 bits (318), Expect = 1.229e-33
Identity = 78/270 (28.89%), Postives = 145/270 (53.70%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIP-TENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+T TNIY+L L++ D   ++S+ F+ ++  L  + FG+ LCR+ L+++GIN F   F LT L+ DR++AV HP +A  +R    A  +   ++ + +V++ P+ VYA+ +++     V         C L+ P  E    F +  F++GF +PV  + + Y +I  K++ ++    A     ++S + +T    +++ ++V  W+P++V QL     +F   +    +  +   LGY NS  NP+ Y F+S  FR  +  V
Sbjct:   36 YVILRYAKMKTATNIYILNLAVADELFMMSVPFLATSTALHHWPFGSSLCRLVLSVDGINMFTSVFCLTVLTFDRYVAVVHPIKAARYRRPSVAKTINAAVWALSMVIILPIVVYADTRVNADGTVV---------CNLLWPRPEWSAAFVVYTFTVGFLLPVAAICLCYALIVAKMRAVALR--AGWQQRKRSERKVTLMVTMVVAVFVACWMPFYVVQLV---NVFEGQQGAT-VNQLAVILGYANSCANPILYGFLSDSFRHSFQRV 290          
BLAST of GCR366 vs. Ensembl Sea Lamprey
Match: oprm1 (opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-010125-1])

HSP 1 Score: 106.301 bits (264), Expect = 1.370e-26
Identity = 81/271 (29.89%), Postives = 138/271 (50.92%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISR----------LFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TNIY+  L++ D     ++ F      +  + FG VLC++ ++++  N F   F LT +SIDR+IAVCHP RA+ +RT   A +V + I+ +   +  P+ + A  K D KN +V+        CTL  P    N+    +F   F +PV  + + Y ++  +L+  S    + S    ++M+ ITR   +++  +V+ W P     L+VI R          +  +W V +        LGY+NS++NP  YAF+ + F+  + E
Sbjct:   11 KMKTATNIYIFNLALADTLATSTLPFQIVNYFMSTWPFGRVLCKLIISIDYYNMFTSIFTLTMMSIDRYIAVCHPVRALDFRTPVKAKLVNICIWSLSSAIGLPVMIIAVTKQD-KNGNVD--------CTLEFPIYWDNMLKTCVFVFAFFIPVCVITVCYGLMITRLR--SVRVLSGSKEKDRTMRRITRMVLVVVAAFVVCWTPI---HLYVIVRAIVRIPESAVVTVSWHVCIA-------LGYVNSSMNPFLYAFLDENFKRCFRE 260          
BLAST of GCR366 vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 105.531 bits (262), Expect = 3.326e-26
Identity = 74/267 (27.72%), Postives = 140/267 (52.43%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVI--SRL-FTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TN Y+  L++ D     ++ F  +  ++  + FG V+C++ ++++  N F   F LT +S+DR+IAVCHP +A+ +RT   A ++ + I+++   +  P+ V    K   K   + +       C L  P       NL  + +F   F +PVL +++ Y+++  +L+ +   +   S    ++++ ITR   +++ I+V+ W P     LFVI  SR+  ++   +     +   LGY NS LNP+ YAF+ + F+  + E
Sbjct:    5 KMKTATNTYIFNLALADTLVTTTLPFQSADYLMGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIVMGTAK---KEEGIIE-------CILDFPHPAVKWENLLKICVFIFAFILPVLIIVVCYSLMVLRLRTVRLLSG--SKEKDRNLRRITRMVLIVVAIFVICWTPI---HLFVIIKSRVSISDTPTVSAAWYICVALGYTNSCLNPVLYAFLDENFKRCFKE 256          
BLAST of GCR366 vs. Ensembl Sea Lamprey
Match: oprm1 (opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-010125-1])

HSP 1 Score: 102.834 bits (255), Expect = 3.332e-25
Identity = 74/267 (27.72%), Postives = 139/267 (52.06%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN---RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIM---TQFLGYLNSALNPLWYAFMSKQFRTMYLE 974
            +M+T TNIY+  L++ D     ++ F  +  +L  + FG +LC++ ++++  N F   F LT +S+DR++AVCHP +A+ +RT   A ++ V I+L+  ++  P+ +   IK D       Q  Y +  C ++ P        L  + +F   F +PV+ + I Y ++  +L+ +   +   S    ++++ ITR   +++ ++++ W P     LFVI+R         ++         LGY NS LNP+ YAF+ + F+  + E
Sbjct:    6 KMKTATNIYIFNLALADALATSTLPFQSADYMLGTWPFGPILCKVVMSIDYYNMFTSIFTLTMMSVDRYVAVCHPVKALDFRTPTKAKLINVAIWLLSSIIGVPIMIMGTIKPD-------QIGYME--CLVVFPQPPWFWETLLKICVFIFAFIMPVMIITICYGLMILRLRTVRLFSG--SKEKDRNLRRITRMVLVVVAVFIVCWTPI---HLFVIARALMTIPETPFMAAAWYSCVALGYTNSCLNPVLYAFLDENFKRCFKE 258          
BLAST of GCR366 vs. Ensembl Sea Lamprey
Match: NPBWR1 (neuropeptides B and W receptor 1 [Source:HGNC Symbol;Acc:HGNC:4522])

HSP 1 Score: 99.3673 bits (246), Expect = 8.443e-24
Identity = 72/280 (25.71%), Postives = 138/280 (49.29%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRA--ISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLS---MFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSR---KSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATC 986
            Y++    +M+TVTN+++L L+I D    + +    +  +L+ + FG  +C++ L+++  N F   + LT +S DRF  V    ++  +  RT + A +V   ++L+  V++ P  ++A   +D         E+ +++C+L  P    N    S       GFA+PV  + I YT +  KL+     N  L+ N +   K+ + +T   F+++ + +  W PY ++ +  ++       V++ +      L Y NS LNP  YAF+   FR  + ++  C
Sbjct:   62 YVILRAPKMKTVTNMFILNLAIADELFTLVLPINIANHLLQDWPFGKTMCKVILSIDQYNMFTSIYFLTVMSADRFFVVTATVKSENLPRRTYRNAKLVSRGVWLLVSVVILPFTIFASTYVD---------EFDRNHCSLDFPKPEFNWLKGSRIYTLVFGFAIPVSTICILYTTMLYKLR-----NMRLNTNGKALDKAKRKVTIMVFIVLAVCLFCWTPYHLSTVIALTGNLQETPVVVGVSYFITSLSYANSCLNPFLYAFLDVNFRNNFQKLLEC 327          
BLAST of GCR366 vs. Ensembl Nematostella
Match: EDO46030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR08])

HSP 1 Score: 75.8702 bits (185), Expect = 1.350e-15
Identity = 77/280 (27.50%), Postives = 138/280 (49.29%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDI-FHLISIIFVCSTVVLEQ-FVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHH--NTALSVNSRKSMKSITRFAFLLIVIYVLF------------WLPYW-VNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFR 959
            +++  R +M+TVTN ++L L+I D+   LI I F      ++  + +G  +C+I   L+ +  FA  F LT++S+ R+ A+ HP R     TVK A V+ V I+++ +V +SP     E K         +T+Y + +    + T++R ++T+++F I + +P+  +   Y  I ++L     H  N  L     +  + + R   +LI +  LF            WL +   +Q+FV       W V+ +  IMT    + NSA NP+ Y  ++  +R
Sbjct:   27 FVIMRRRKMKTVTNYFILNLAIADLTLTLICIPFDIPVQEMDYIWPYGPFMCKILYPLQTMCLFASVFTLTSVSVARYRAIIHPLR--PQLTVKRAKVITVFIWMLSVVPVSPYIYVLEHK--------EETQYCEEH---WVDTKSRKIYTVTLFVIQYIIPLSLITAAYARIGKELGAKKLHADNKHLQSAQAEEARKVIR---MLIAVTALFAVCVLPTNIMWLWLDFGKADQVFVYF-----WEVVAFCNIMT----FANSAANPVCYTLLNDHYR 281          
BLAST of GCR366 vs. Ensembl Nematostella
Match: EDO49911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF82])

HSP 1 Score: 74.7146 bits (182), Expect = 4.244e-15
Identity = 67/279 (24.01%), Postives = 143/279 (51.25%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVD----IFHLISIIFVCSTVVLEQ-------FVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKL---QFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVML--YIGIMTQFLGYLNSALNPLWYAFMSKQFR 959
            +++   +RMRTVTN ++  ++  D    +F+++  +F     ++E+          G +LC+     + ++     F + A+S+DRF A+  P + I   T K A  ++ +I+    ++ SPL +YA +K++     VN  E    +  L     +  ++T+++F + +A+P+  +   Y +I  +L   Q    ++T+   N  ++ K + +    ++ ++ L WLP +V ++F++    +N+   L  ++  +T FLG+ NS++NP  Y   ++ FR
Sbjct:   22 WVIRSAYRMRTVTNYFITNVAFADLLTTVFNMMPTLFW----IIERKDPWSVGGTLGEILCKTLQFFQCVSVACSVFSMAAISMDRFFAIFRPLKRII--TFKLAKFIIALIWASSCLISSPL-IYA-LKLEGDGEDVNCVEV---WAPLFDDYTSPMVYTIALFVLFYALPLTIIAALYAVIMFRLWRRQTPGQNSTSNQSNKERTNKKVLKMLITVVAVFALCWLPLYV-RMFLVFLQPSNFPCGLPYHLDFITLFLGHANSSINPYLYVVFNENFR 288          
BLAST of GCR366 vs. Ensembl Nematostella
Match: EDO44418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVN5])

HSP 1 Score: 73.1738 bits (178), Expect = 9.224e-15
Identity = 65/261 (24.90%), Postives = 128/261 (49.04%), Query Frame = 3
Query:  195 MRTVTNIYLLCLSIVDIF-HLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRA-ISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTE-YAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKL---QFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFR 959
            M++VTN+++  L+  D+    + +    + +   +++FGTVLC++ + L+ ++  +    L A++ DRF+A+  P R  +S++T KT ++++  +          L + A +    K H+   TE +   +     P +    +T+ +F + +AVP+L M + Y +I RKL   + I     + S  +  S K + +    +I+++   WLP  V         F        +  ++ FLG+ NSA NP  YA  ++ +R
Sbjct:   27 MKSVTNLFIANLAASDLLITFLGMPHQITELYTTEWMFGTVLCKLVVYLQSVSVGSSVLTLLAITKDRFVAIIFPFRPRMSFKTAKTIIMLIWSLS---------LGIMAPLIYATKVHNNQCTEDWTPAFDAKTAPRD----YTVVLFVMLYAVPMLTMAVLYAIIVRKLWRRRRIGEVIPSASSKNEVSRKKVIKMLITVIMLFTFSWLPLHVFSFISFFAPFCPDTSNTALYFVSLFLGHGNSAANPYLYALFNQNYR 274          
BLAST of GCR366 vs. Ensembl Nematostella
Match: EDO49570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN9])

HSP 1 Score: 71.633 bits (174), Expect = 3.486e-14
Identity = 69/270 (25.56%), Postives = 128/270 (47.41%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQF----VFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYC-----TLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLF---WLPYWVNQ--LFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFR 959
            R R++T+ ++  L+  DI  LI+   +   ++ EQ+    VFG ++C++ + L+ ++  +    L A++IDRFI++  P R      +  A  +V + ++I + +++PL         +      Q     +YC         P E    FT+ +F + +  P+L M + Y  I R L   +     ++       +S  R   +L+ + +LF   WLP W+ Q  +F   + F  +    Y   ++ FLG+ NSA+NP  Y+F +  FR
Sbjct:   25 RARSMTDTFVANLAASDI--LITFTGM-PNMITEQYIRHWVFGPIVCKLVVYLQSVSVASSVLTLLAVTIDRFISIVFPLRGRI--ALSKAKYIVAVTWIISLSIMAPL---------IDAQKAKQFPDGMYYCIEEWQPPFNPLEAPKSFTVLLFVVMYVAPLLTMAVLYCAICRTLWKRTSPGARITRTETHLQRSRKRVLKMLLAVTLLFAVCWLPLWIFQFIMFFSPQTFPCFSKPFYF--VSLFLGHSNSAINPFLYSFFNANFR 278          
BLAST of GCR366 vs. Ensembl Nematostella
Match: EDO40582 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T3])

HSP 1 Score: 68.5514 bits (166), Expect = 3.830e-13
Identity = 66/272 (24.26%), Postives = 131/272 (48.16%), Query Frame = 3
Query:  192 RMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQF-----VFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQT-EYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQF--ISHHNTALSVNSR--KSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            RM+T TN+  + +++ DI   ++++    + +L  F     +FGT+ C+++     I+       LT ++ DRF A+  P + +  R  K   ++  I+++  ++ + P+AV  E+K+      +N   + A ++  L  P  +   F+L +    + +P+  M + Y +I  +L F  I   N     N R     + + R   +++V++ L WLP  +    +I    +   V++  G    FLG+ NSA+NP  Y  +   FR  +L++
Sbjct:   29 RMKTPTNMMFVNMALFDIIVAVTMMPYMISFILYPFRWLGGLFGTITCKLTYYAFYISIAGSILALTVMATDRFFAIVLPFKKV--RFFKRFKLLTCIVWVTSMLYMLPIAVLQEVKL------INGDFQCATNWFKLADPLLSFKAFSLCVLVSFYLIPLAVMAVLYALIAHRLWFSRIPVENAQDETNRRIQNKKRKVVRMLVIILVVFALCWLPAHIGHFMLIIND-SPTEVLVMFGF---FLGHANSAINPCLYVILHSGFRRAFLQL 288          
BLAST of GCR366 vs. Ensembl Medaka
Match: sstr2b (somatostatin receptor 2 [Source:NCBI gene;Acc:101172660])

HSP 1 Score: 122.479 bits (306), Expect = 4.039e-31
Identity = 75/275 (27.27%), Postives = 147/275 (53.45%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFS---IGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNS---RKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEV 977
            Y++    +M+TVTNIY+L L++ D+  ++ + F+   + L  + FG VLCRI + ++ +N F   F L  +SIDR++AV HP R+  WR  + A  + V ++ + +++  P+ +Y+ I +          ++   +CT++ P      +T  MF    +GF +P++ + + Y  I  K++     ++ + V S   ++S + +TR   +++ ++V  WLP++V  +  ++   +    +         LGY NS  NP+ YAF+S+ F+  +  V
Sbjct:   67 YVILRYAKMKTVTNIYILNLAVADVLFMLGLPFIALQLALVHWPFGPVLCRIVMTVDSLNQFTSIFCLMVMSIDRYLAVVHPIRSTKWRKPRVAKTINVAVWGVSLLVNLPIVIYSGIIM----------KHDSCFCTIVWPEPQEAYYTAFMFYTFILGFFLPLMVICLCYLFIIIKVK-----SSGIRVGSSMRKRSERKVTRMVSIVVAVFVFCWLPFYVFNVTSVTGTISTTPFLRSTFAFVVVLGYANSCANPILYAFLSENFKKSFQNV 326          
BLAST of GCR366 vs. Ensembl Medaka
Match: sstr1b (somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-120410-2])

HSP 1 Score: 115.161 bits (287), Expect = 1.567e-28
Identity = 81/267 (30.34%), Postives = 145/267 (54.31%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTEN-RNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFR 959
            Y++    +M+T TNIY+L L+I D   ++S+ F+ ++  +  + FG+V+CR+ L+++GIN F   F LT LS+DR++AV HP +A  +R    A VV V ++ +  +++ P+ ++A+  +  ++  V+        C  + P       F +  F +GF +PV  +   Y +I  +++ +      L    R+S K ITR   L++ ++VL W+P+++ QL  +     N        ++TQ    L Y NS  NP+ Y F+S+ FR
Sbjct:   54 YVILKYAKMKTATNIYILNLAIADELFMLSVPFLATSAAIRHWPFGSVMCRLVLSVDGINMFTSIFCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNVCVWGLSFIVILPIIIFAD-TVPAEDGGVD--------CNFLWPEAFWSEAFVVYTFLLGFLLPVGAICFCYCLIVARMRAVGLKAGWL--QRRRSEKKITRMVLLVVAVFVLCWMPFYIVQLVSVFHRPPN-------PMVTQLFVILSYANSGANPILYGFVSENFR 302          
BLAST of GCR366 vs. Ensembl Medaka
Match: oprl1 (delta-type opioid receptor [Source:NCBI gene;Acc:101160812])

HSP 1 Score: 110.538 bits (275), Expect = 6.294e-27
Identity = 78/281 (27.76%), Postives = 148/281 (52.67%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRN---LFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQF---LGYLNSALNPLWYAFMSKQFRTMYLEVATCTSF 995
            Y++    +M+T TNIY+  L++ D   L ++ F  + V L  + FG  LC+  ++++  N F  TF LT +S+DR++AVCHP +A+  RT   A VV + ++++      P  V   ++ + +++SV         C + +P    +   +F   +F   F +PV  + I Y+++ ++L+ +     + S    ++++ ITR   +++  +V+ W P    Q+ V+++        LY  +M  F   LGY+NS+LNP+ YAF+ + F+  + E    + F
Sbjct:   63 YVIIRYTKMKTATNIYIFNLALADSLFLATLPFQGTDVFLGFWPFGNALCKTVVSIDYYNMFTSTFTLTVMSMDRYVAVCHPVKALDMRTPHKAKVVNICVWVLASAFGVPAMVMGNVEEEQEHNSVE--------CIVALPEPKSHWEPVFGTCVFLFSFLIPVAIISICYSLMVKRLRNV--RILSGSKEKDRNLRRITRMVLVVVAAFVVCWTPI---QIMVLAQSLGFNLSSLYTLVMMHFFIALGYVNSSLNPVLYAFLDENFKRCFREFCQPSPF 330          
BLAST of GCR366 vs. Ensembl Medaka
Match: sstr5 (somatostatin receptor type 5 [Source:NCBI gene;Acc:101171493])

HSP 1 Score: 108.612 bits (270), Expect = 4.002e-26
Identity = 80/285 (28.07%), Postives = 145/285 (50.88%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRN---LFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYW----VNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDS 1004
            Y+V    ++  VTNIY++ L+I D  +++ I F+ +  V   + FG   C++ +  + +  FA TF LT +SIDRF+AV +P R+  WRT   A +   I++++  + + P+ +Y+ ++ ++K             C L  P  + +   +F L    +GF  P++ + + Y +I  K++  S    A     R+S + +TR   +++ ++VL WLP++    VN  +VI    T   +   + I+T    Y+NS  NP  Y F+S+ F     E   C   N++
Sbjct:   56 YVVGRYGKLNNVTNIYIINLAIADELYVLGIPFILTNNVFSYWPFGDFFCKMFMTTDAMCQFASTFCLTLMSIDRFMAVVYPMRSAKWRTPPKAKIFSGIVWIMSFLTVLPVTIYSHVQDNIKT------------CNLSWPEPHGSWSMVFILYTSILGFFSPLIIISLCYLLIVIKVKSASVR--AGLTKRRRSERKVTRMVVIIVFVFVLCWLPFFTANIVNLFYVIPENETTAAIYFSLVILT----YVNSCANPFLYGFLSENFEKNMKEALKCGKLNNA 322          
BLAST of GCR366 vs. Ensembl Medaka
Match: sstr5 (somatostatin receptor type 5 [Source:NCBI gene;Acc:101171493])

HSP 1 Score: 108.612 bits (270), Expect = 5.827e-26
Identity = 80/285 (28.07%), Postives = 145/285 (50.88%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRN---LFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYW----VNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDS 1004
            Y+V    ++  VTNIY++ L+I D  +++ I F+ +  V   + FG   C++ +  + +  FA TF LT +SIDRF+AV +P R+  WRT   A +   I++++  + + P+ +Y+ ++ ++K             C L  P  + +   +F L    +GF  P++ + + Y +I  K++  S    A     R+S + +TR   +++ ++VL WLP++    VN  +VI    T   +   + I+T    Y+NS  NP  Y F+S+ F     E   C   N++
Sbjct:   90 YVVGRYGKLNNVTNIYIINLAIADELYVLGIPFILTNNVFSYWPFGDFFCKMFMTTDAMCQFASTFCLTLMSIDRFMAVVYPMRSAKWRTPPKAKIFSGIVWIMSFLTVLPVTIYSHVQDNIKT------------CNLSWPEPHGSWSMVFILYTSILGFFSPLIIISLCYLLIVIKVKSASVR--AGLTKRRRSERKVTRMVVIIVFVFVLCWLPFFTANIVNLFYVIPENETTAAIYFSLVILT----YVNSCANPFLYGFLSENFEKNMKEALKCGKLNNA 356          
BLAST of GCR366 vs. Planmine SMEST
Match: SMESG000028611.1 (SMESG000028611.1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 316/317 (99.68%), Postives = 317/317 (100.00%), Query Frame = 3
Query:   75 MEFKIAVAMKMGCXXXXXXXXXXXXXXXXXXXYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE 1025
            MEFKIAVAMKMGCVTVTVILLIVGLIGNALVIYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTALVVVVIIFLICIVLLSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALS+NSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE
Sbjct:    1 MEFKIAVAMKMGCVTVTVILLIVGLIGNALVIYIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTALVVVVIIFLICIVLLSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSINSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLKLFGE 317          
BLAST of GCR366 vs. Planmine SMEST
Match: SMESG000028490.1 (SMESG000028490.1)

HSP 1 Score: 195.667 bits (496), Expect = 9.673e-59
Identity = 112/280 (40.00%), Postives = 179/280 (63.93%), Query Frame = 3
Query:  177 VSGRFR-MRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLK 1013
            V GR+  M+T TN+YL+ LSI D+ HL  I+FV + ++ E+F+FG  LC++ L LE  N  A TFILTA S+DR++AVCHP ++ ++R+ K A  ++V+I+LIC+ +L PL +YA I ++ KN+           C + +  E +  F    F +GFA+PV  + +FY ++  KL+ I   N + S + R S++ I +    LI+IY++ W PYW++Q ++I     +  +  Y+G+ TQFLGYLNS++NP+ YAF+S+ FR M++++  C    + FLK
Sbjct:   51 VVGRYSAMQTTTNLYLMSLSIADLLHLAQIVFVVNVILTEKFIFGKWLCKLHLTLEATNSLAVTFILTATSVDRYLAVCHPLKSQTFRSPKVARTIIVLIWLICLFMLCPLFIYANITMNTKNNETTPQ------CMIDL-GEKKLTFVQYTFILGFALPVCSISVFYLLVISKLRNIHRANISRSKDRRDSVQRIIKMILALILIYIVLWFPYWIHQ-WIIQFNDVDPILSFYVGLFTQFLGYLNSSINPILYAFLSQNFRVMFVQILNCQG--NRFLK 320          
BLAST of GCR366 vs. Planmine SMEST
Match: SMESG000028490.1 (SMESG000028490.1)

HSP 1 Score: 193.356 bits (490), Expect = 1.494e-58
Identity = 109/273 (39.93%), Postives = 175/273 (64.10%), Query Frame = 3
Query:  195 MRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATCTSFNDSFLK 1013
            M+T TN+YL+ LSI D+ HL  I+FV + ++ E+F+FG  LC++ L LE  N  A TFILTA S+DR++AVCHP ++ ++R+ K A  ++V+I+LIC+ +L PL +YA I ++ KN+           C + +  E +  F    F +GFA+PV  + +FY ++  KL+ I   N + S + R S++ I +    LI+IY++ W PYW++Q ++I     +  +  Y+G+ TQFLGYLNS++NP+ YAF+S+ FR M++++  C    + FLK
Sbjct:    1 MQTTTNLYLMSLSIADLLHLAQIVFVVNVILTEKFIFGKWLCKLHLTLEATNSLAVTFILTATSVDRYLAVCHPLKSQTFRSPKVARTIIVLIWLICLFMLCPLFIYANITMNTKNNETTPQ------CMIDL-GEKKLTFVQYTFILGFALPVCSISVFYLLVISKLRNIHRANISRSKDRRDSVQRIIKMILALILIYIVLWFPYWIHQ-WIIQFNDVDPILSFYVGLFTQFLGYLNSSINPILYAFLSQNFRVMFVQILNCQG--NRFLK 263          
BLAST of GCR366 vs. Planmine SMEST
Match: SMESG000018658.1 (SMESG000018658.1)

HSP 1 Score: 137.502 bits (345), Expect = 1.038e-36
Identity = 94/293 (32.08%), Postives = 154/293 (52.56%), Query Frame = 3
Query:  171 YIVSGRFRMRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEI--------------KIDLKNHSVNQTEYAKHYCTLMIPTENR---NLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQLFVI--SRLFTNWRVML--YIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLEVATC 986
            Y+V     M+T+ NI+L+ LSI D+  LIS     S V+ + F+FG + C+I L + G+N F  T+ +T +SIDR++AVCHP  + S R  +    +++ ++L   VL+ PL +Y  +               + L N S++  +  ++ C +      +   + FTL  F  GF  PV+ + I Y ++  +L  +   N   S   R   + ITR    ++ +Y++ WLPYWV QLF I   + ++    ML  Y+ +    L Y+NSA+NP+ YAFMS  FR+ +  +  C
Sbjct:   44 YVVVRFSSMQTIANIHLMNLSIADLVFLISGFIFLSNVIQKSFIFGLIGCKIYLIMTGVNSFTSTYSMTLMSIDRYLAVCHPISSKSIRNPRMTKWIILGLWLFSFVLMMPLMIYGNLVSWSNENEHSISNGSMTLLNMSLDIKQINQYACVINWNISGKLTSHGFTLYNFGFGFLCPVVIICILYPLVIIRLHNVGPRNK--SQERRDLNRRITRLVLAIVALYIILWLPYWVLQLFTIFHDQEYSASARMLIMYLNLTMLCLNYINSAINPILYAFMSPNFRSSFQLLIIC 334          
BLAST of GCR366 vs. Planmine SMEST
Match: SMESG000024273.1 (SMESG000024273.1)

HSP 1 Score: 123.25 bits (308), Expect = 7.214e-32
Identity = 85/284 (29.93%), Postives = 148/284 (52.11%), Query Frame = 3
Query:  195 MRTVTNIYLLCLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFILTALSIDRFIAVCHPTRAISWRTVKTAXXXXXXXXXXXXXXXSPLAVYAEIKIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIFYTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVNQL-------------FVISRLFTNWRVM-------------LYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMY 968
            M+TVTNIY+L LS+ DI  L+SI     T +   F    +LC+  +++   NWFA TF LT+++ DRF A+ +P R+ +WR     + V+V+++++  VL+SP ++ A++     N S       K  C      + ++ + L  F +G+ +P L +  FY+ +   L         +   S+++ +  T+   ++IV Y+  WLP+W+NQL             F ++      R++             L++ ++ Q LGYLNSA+NP+ Y++MS  FRT +
Sbjct:   41 MQTVTNIYILSLSLADILFLLSIPLFLYTTLFNSFPQSQILCKFYVSVTLFNWFASTFSLTSMAADRFFAIVYPVRSQNWRQKNKTITVIVVVWILACVLMSPGSINAQVNQISPNSS-------KGSCNQFWNGDYKS-YILYTFCLGYLIPCLFIFFFYSCVVWTLS-----KVRMGKGSKQNRQKTTKLVTIIIVTYICCWLPHWINQLRSLRFYYQTEKFNFSLNPTKNKTRILMSSSNNNYSSFYALFLNLIYQLLGYLNSAINPILYSYMSINFRTAF 311          
The following BLAST results are available for this feature:
BLAST of GCR366 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SSTR46.267e-3334.21somatostatin receptor 4 [Source:HGNC Symbol;Acc:HG... [more]
OPRL15.721e-2930.57opioid related nociceptin receptor 1 [Source:HGNC ... [more]
OPRL15.721e-2930.57opioid related nociceptin receptor 1 [Source:HGNC ... [more]
OPRL15.721e-2930.57opioid related nociceptin receptor 1 [Source:HGNC ... [more]
OPRL18.115e-2930.15opioid related nociceptin receptor 1 [Source:HGNC ... [more]
back to top
BLAST of GCR366 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-163.200e-2127.24NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-163.855e-2127.24NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-164.197e-2127.24NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-164.714e-2127.24NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-321.164e-2029.17NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of GCR366 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AstC-R12.143e-3331.47gene:FBgn0036790 transcript:FBtr0089578[more]
AstC-R27.439e-3029.57gene:FBgn0036789 transcript:FBtr0089387[more]
AstC-R27.439e-3029.57gene:FBgn0036789 transcript:FBtr0332867[more]
AstC-R28.962e-3029.57gene:FBgn0036789 transcript:FBtr0330088[more]
AstC-R21.005e-2929.57gene:FBgn0036789 transcript:FBtr0346968[more]
back to top
BLAST of GCR366 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sstr1b1.126e-2930.71somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
sstr1b1.191e-2930.71somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
sstr2a2.402e-2927.57somatostatin receptor 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
sstr2b7.915e-2826.18somatostatin receptor 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
sstr51.104e-2731.20somatostatin receptor 5 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of GCR366 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000030515.12.758e-3228.68pep primary_assembly:Xenopus_tropicalis_v9.1:10:22... [more]
ap5b14.088e-3131.52adaptor related protein complex 5 subunit beta 1 [... [more]
SSTR52.455e-2626.18somatostatin receptor 5 [Source:NCBI gene;Acc:1004... [more]
OPRD18.322e-2629.48opioid receptor delta 1 [Source:NCBI gene;Acc:1004... [more]
OPRD19.044e-2629.48opioid receptor delta 1 [Source:NCBI gene;Acc:1004... [more]
back to top
BLAST of GCR366 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sstr42.992e-3634.21somatostatin receptor 4 [Source:MGI Symbol;Acc:MGI... [more]
Sstr23.267e-2927.76somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI... [more]
Sstr23.267e-2927.76somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI... [more]
Sstr21.064e-2828.31somatostatin receptor 2 [Source:MGI Symbol;Acc:MGI... [more]
Oprl11.703e-2729.41opioid receptor-like 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of GCR366 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30937|SSR4_RAT2.853e-3534.21Somatostatin receptor type 4 OS=Rattus norvegicus ... [more]
sp|P31391|SSR4_HUMAN3.010e-3234.21Somatostatin receptor type 4 OS=Homo sapiens OX=96... [more]
sp|P49660|SSR4_MOUSE5.159e-3232.71Somatostatin receptor type 4 OS=Mus musculus OX=10... [more]
sp|F1MV99|SSR5_BOVIN1.275e-2828.21Somatostatin receptor type 5 OS=Bos taurus OX=9913... [more]
sp|P41146|OPRX_HUMAN3.897e-2830.15Nociceptin receptor OS=Homo sapiens OX=9606 GN=OPR... [more]
back to top
BLAST of GCR366 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUG80.000e+099.68GCR366 OS=Schmidtea mediterranea OX=79327 GN=gcr36... [more]
A0A193KUQ13.478e-5540.00GCR320 OS=Schmidtea mediterranea OX=79327 GN=gcr32... [more]
A0A0P4WDC19.889e-3731.90G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A088AVQ31.043e-3632.98G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0N7ZC691.219e-3631.90G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR366 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sstr1b9.500e-3030.34somatostatin receptor type 1-like [Source:NCBI gen... [more]
sstr2a1.432e-2927.21somatostatin receptor type 2-like [Source:NCBI gen... [more]
oprm12.241e-2828.52delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
oprd1a5.761e-2829.10opioid receptor, delta 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
sstr2b6.017e-2825.91somatostatin receptor 2b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of GCR366 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sstr1a1.229e-3328.89somatostatin receptor 1a [Source:ZFIN;Acc:ZDB-GENE... [more]
oprm11.370e-2629.89opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-01... [more]
oprk13.326e-2627.72opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
oprm13.332e-2527.72opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-01... [more]
NPBWR18.443e-2425.71neuropeptides B and W receptor 1 [Source:HGNC Symb... [more]
back to top
BLAST of GCR366 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR366 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460301.350e-1527.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499114.244e-1524.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444189.224e-1524.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495703.486e-1425.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405823.830e-1324.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR366 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sstr2b4.039e-3127.27somatostatin receptor 2 [Source:NCBI gene;Acc:1011... [more]
sstr1b1.567e-2830.34somatostatin receptor 1b [Source:ZFIN;Acc:ZDB-GENE... [more]
oprl16.294e-2727.76delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
sstr54.002e-2628.07somatostatin receptor type 5 [Source:NCBI gene;Acc... [more]
sstr55.827e-2628.07somatostatin receptor type 5 [Source:NCBI gene;Acc... [more]
back to top
BLAST of GCR366 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028611.10.000e+099.68SMESG000028611.1[more]
SMESG000028490.19.673e-5940.00SMESG000028490.1[more]
SMESG000028490.11.494e-5839.93SMESG000028490.1[more]
SMESG000018658.11.038e-3632.08SMESG000018658.1[more]
SMESG000024273.17.214e-3229.93SMESG000024273.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033539 ID=SMED30033539|Name=GCR366|organism=Schmidtea mediterranea sexual|type=transcript|length=1139bp
GTCACTATATTCCCACAATGCTTGGTATTTTTACATGTAAGTGACAAAAT
TTGTAATTTTTATATTATCAAAAAATGGAATTCAAAATTGCAGTAGCCAT
GAAAATGGGTTGCGTAACTGTAACTGTGATTTTGCTGATTGTCGGACTGA
TTGGGAACGCGCTCGTCATCTATATAGTTTCCGGTCGGTTCCGGATGCGG
ACAGTGACAAATATCTATTTGCTCTGCTTGTCTATTGTTGATATTTTTCA
TTTGATTTCCATTATATTTGTCTGTTCTACTGTGGTTTTGGAACAGTTTG
TTTTTGGAACGGTTTTGTGTCGAATTTCTTTGGCGCTTGAAGGAATAAAT
TGGTTTGCCGGGACATTCATTTTGACAGCTCTCAGTATTGATCGGTTTAT
TGCCGTTTGTCATCCGACGCGTGCAATTTCTTGGAGAACCGTGAAAACTG
CTTTGGTGGTCGTGGTAATTATCTTTTTGATCTGTATTGTTCTTTTGTCT
CCGTTGGCCGTTTATGCAGAAATCAAAATCGATTTGAAAAACCACTCAGT
AAATCAAACAGAATACGCCAAGCATTATTGCACTCTGATGATTCCGACAG
AAAACCGGAATCTATTTACGTTGTCAATGTTTAGCATCGGTTTTGCAGTA
CCTGTATTGTGTATGATCATATTTTATACGATGATATATAGAAAACTTCA
GTTCATTAGCCATCACAACACCGCATTATCAGTTAATAGTAGAAAATCCA
TGAAGTCCATTACAAGATTTGCATTTTTATTAATTGTAATATATGTGCTA
TTCTGGTTGCCCTATTGGGTCAATCAGTTATTTGTTATCAGTAGATTGTT
TACTAACTGGAGAGTTATGCTCTATATCGGGATCATGACCCAGTTCCTGG
GATATTTGAACAGTGCTCTCAACCCATTATGGTATGCTTTCATGTCTAAA
CAATTCAGGACCATGTACTTGGAGGTTGCAACATGCACTTCTTTTAATGA
CTCGTTTCTCAAGTTGTTTGGTGAATGACCTCCTATTTTGTAATTTTTGT
TTTGTGTAATTGTTTTAATAATCTTTTGTTTTTATTATTATTTTCTCTGT
TGGAAATTGCAGTTAATTGTGTAGAAATCTTTATTTGTG
back to top

protein sequence of SMED30033539-orf-1

>SMED30033539-orf-1 ID=SMED30033539-orf-1|Name=SMED30033539-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=318bp
MEFKIAVAMKMGCVTVTVILLIVGLIGNALVIYIVSGRFRMRTVTNIYLL
CLSIVDIFHLISIIFVCSTVVLEQFVFGTVLCRISLALEGINWFAGTFIL
TALSIDRFIAVCHPTRAISWRTVKTALVVVVIIFLICIVLLSPLAVYAEI
KIDLKNHSVNQTEYAKHYCTLMIPTENRNLFTLSMFSIGFAVPVLCMIIF
YTMIYRKLQFISHHNTALSVNSRKSMKSITRFAFLLIVIYVLFWLPYWVN
QLFVISRLFTNWRVMLYIGIMTQFLGYLNSALNPLWYAFMSKQFRTMYLE
VATCTSFNDSFLKLFGE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004994somatostatin receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0038170somatostatin signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 89..111
score: 29.42
coord: 182..205
score: 25.52
coord: 12..36
score: 26.48
coord: 45..66
score: 25.26
coord: 269..295
score: 36.07
coord: 229..253
score: 22.48
coord: 125..146
score: 17.25
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 21..302
e-value: 6.1E-5
score: -36.7
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 27..287
e-value: 6.8E-36
score: 123.9
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 95..111
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 7..298
e-value: 1.2E-60
score: 207.2
NoneNo IPR availablePANTHERPTHR24229NEUROPEPTIDES RECEPTORcoord: 14..301
NoneNo IPR availableCDDcd149707tmA_Opioid_R-likecoord: 14..295
e-value: 9.02972E-56
score: 180.568
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 14..306
NoneNo IPR availableTMHMMTMhelixcoord: 126..148
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 86..105
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 27..287
score: 38.867