DNA topoisomerase 2

Overview
NameDNA topoisomerase 2
Smed IDSMED30033538
Length (bp)4567
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA topoisomerase 2 (SMED30033538) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA topoisomerase 2 (SMED30033538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SmedASXL_017864SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033538SMESG000037559.1 SMESG000037557.1 SmedASXL_033464SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30033538SMESG000037559.1 SMESG000037557.1 dd_Smed_v4_4804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033538SMESG000037559.1 SMESG000037557.1 dd_Smed_v4_4804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 Contig6222uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 Contig6222newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033538SMESG000077843.1 SMESG000075930.1 SMESG000072474.1 SMESG000071411.1 SMESG000070882.1 SMESG000049741.1 SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000034944.1 SMESG000021315.1 SMESG000020394.1 SMESG000011999.1 Contig18945uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033538SMESG000077843.1 SMESG000075930.1 SMESG000072474.1 SMESG000071411.1 SMESG000070882.1 SMESG000049741.1 SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000034944.1 SMESG000021315.1 SMESG000020394.1 SMESG000011999.1 Contig18945newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30033538SMESG000037559.1 SMESG000037557.1 dd_Smed_v6_4804_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMESG000070153.1 SMESG000068232.1 SMESG000077027.1 dd_Smed_v6_1626_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30033538SMESG000037559.1 SMESG000037557.1 dd_Smed_v4_4804_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033538SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033538SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033538SMESG000037565.1 SMESG000037559.1 SMESG000037557.1 SMED_13275_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1391.71 bits (3601), Expect = 0.000e+0
Identity = 701/1201 (58.37%), Postives = 890/1201 (74.10%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNK-----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEP-GEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK  A ++ E +NQ D   S+      PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++ V +Q+  +    +    +K    K         ET PS + RRI P+I
Sbjct:   50 YQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEK--AAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEI 1241          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1390.94 bits (3599), Expect = 0.000e+0
Identity = 701/1201 (58.37%), Postives = 890/1201 (74.10%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNK-----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEP-GEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK  A ++ E +NQ D   S+      PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++ V +Q+  +    +    +K    K         ET PS + RRI P+I
Sbjct:   55 YQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEK--AAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEI 1246          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2A (DNA topoisomerase II alpha [Source:HGNC Symbol;Acc:HGNC:11989])

HSP 1 Score: 1382.47 bits (3577), Expect = 0.000e+0
Identity = 685/1154 (59.36%), Postives = 874/1154 (75.74%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKL-------LAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVV 3575
            Y KKTQLEHILLRPD+Y+GS++   + +W++D E   +  +++T+ PGLYKI+DEILVNA+DNK RD KMSCIR+ I+   N+I IWNNGKGIPVV H+   ++VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+++EY K FKQTW  NMG A +  +     ED+TC+TF PDL +F M  LD + +AL  RRAYDIA  T  + V+LNG ++PVK F+ YV++Y K+ LD     LKVI+E+   RWEV +T S    F Q+SFVNSIAT+KGG HV+++ DQ   KL+++ KKK K        +V     +MW+FV  LIENP+FDSQTKENMTL  K FGSTC L++KFI     CGIVE I  W  FK Q  L+KKCS  KH ++K IPKLDDAN AG +NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+  TP   +W++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  LK L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ +++++N++R+++G  P+ M P Y+NF GTI E+  N+YV++GE+  L+ TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDY+EY+TD TV+F+V+M   K AEAE VG HK FKLQT LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A+++KL NQARFILEKI+GK+I EN     LI  L+   YDSDPVKAW+++ +K+        + ++ E E  + + DS  P F YL  M +  LT EKKD L + R+EK +ELD ++ KSP  +W +DL    +E+  V
Sbjct:   34 YQKKTQLEHILLRPDTYIGSVELVTQQMWVYD-EDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVCLTMS-EKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKN---HMWIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQVQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIEELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSG-PTFNYLLDMPLWYLTKEKKDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAV 1181          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2B (DNA topoisomerase II beta [Source:HGNC Symbol;Acc:HGNC:11990])

HSP 1 Score: 1365.52 bits (3533), Expect = 0.000e+0
Identity = 673/1110 (60.63%), Postives = 842/1110 (75.86%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNK-----PDFGYLTQMQILTLT 3443
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK  A ++ E +NQ D   S+      PDF Y+  M + +LT
Sbjct:   50 YQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEK--AAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLT 1150          
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Match: TOP2A (DNA topoisomerase II alpha [Source:HGNC Symbol;Acc:HGNC:11989])

HSP 1 Score: 164.081 bits (414), Expect = 5.187e-46
Identity = 76/127 (59.84%), Postives = 103/127 (81.10%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVT 515
            Y KKTQLEHILLRPD+Y+GS++   + +W++D E   +  +++T+ PGLYKI+DEILVNA+DNK RD KMSCIR+ I+   N+I IWNNGKGIPVV H+   ++VP +IFGQLLTS+N++DD+K+VT
Sbjct:   22 YQKKTQLEHILLRPDTYIGSVELVTQQMWVYD-EDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVT 147          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: top-2 (DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss-Prot;Acc:Q23670])

HSP 1 Score: 1298.49 bits (3359), Expect = 0.000e+0
Identity = 662/1220 (54.26%), Postives = 873/1220 (71.56%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKA-LWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAE-AVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAI-DKGEEENQED------------IEDSNKP------DFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDL-----EILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIE 3716
            Y KK+QLEHILLRPD+Y+GS++  EK  +W+++ E++ + ++ I+Y PGLYKIYDEILVNA+DNK RD KM+ I+I IN  KN I ++NNGKGIPV  H+   V+VP +IFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS +F LETS+++Y  +FKQTW KNM    +P I     EDFT +TF PDL +F M  LDD+   L +RRAYD+A  + G+ V+LNG++IP+K F+DYV++YT    ++  E LK+ YE+ GDRW+VA+  S    F QVSFVNSIATTKGG HV+++ DQ   K ++  K+K+     ++ +K  Q+K +MWVFV CLIENP+FDSQTKE MTL  K FGSTC L++KF    +  GI + +  W  FK    L+KKCSKTK +KLK IPKL+DAN AGTKNS QCTLILTEGDSAK+LAVSGL+V+GRD YGVFPLRGKLLNVRE  +KQ+ +NAE+  +IKI+GLQY +KYE  +  KTLRYGKLM+M DQDQDGSHIKGL+INFIH  WP+L++ NFVE+FITPIVKA K  + +SFYS+PE  EW+  T     +++KYYKGLGTSTSKEAKEYF DM RH I+F+Y+G +D  ++ +AFSK K +ERK+WL+ WM + K R++ G+ E YLY K T+++TF++F+N+EL+LFSN DNERSIPCL+DGFKPGQRKVLFAC KR   +E+KVAQLAG+VAE+SAYHHGE SLM TI+NLAQD+VGSNNINLL+P GQFGTRL GGKDSAS RYI TQLS +T+ +F   D+ VL+ L ++NQ IEPEWY PIIPMVL+NG  GIGTGWS+ IPN+NP++++ N+KR+I G     + PWY+NF G I+++  +++   GE+  LD  T+EITELPI+ WT  YKE V+E     +DK    I DYKEY+TD TV+F+V+++P K  E E     H+ FKLQ  +  + M+LFD  G +R Y +   I + F+  R E Y++RK YLLG+L AQ+ +L NQARFIL KIN +++ EN K A ++D L+  K+D+DPVK W K  +KL  + + GE E  ED            I  + K       D+ YL  M ++ L+ E+K+ L+KE +EK+ E+ +I  K+ Q +W +DL     E+ ++E     +QD S        +        G    +  E  PSK  +RIEP ++
Sbjct:   67 YQKKSQLEHILLRPDTYIGSVEHTEKTPMWVYNMEESKLEQRDISYVPGLYKIYDEILVNAADNKQRDPKMNTIKITINKEKNEISVYNNGKGIPVTQHKVEKVYVPELIFGTLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTKFTLETSSRDYKSAFKQTWIKNMTRDEEPKIVKSTDEDFTKITFSPDLAKFKMKELDDDICHLMARRAYDVAGSSKGVAVFLNGKRIPIKGFEDYVQMYTSQ-FNNEGEPLKIAYEQVGDRWQVALALS-EKGFQQVSFVNSIATTKGGRHVDYVADQMVAKFIDSIKRKLTK--TSMNIKPFQIKNHMWVFVNCLIENPTFDSQTKETMTLQQKQFGSTCVLSEKFSKAASSVGITDAVMSWVRFKQMDDLNKKCSKTKTSKLKGIPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPLRGKLLNVREGNMKQIADNAEVNAMIKILGLQYKKKYETEDDFKTLRYGKLMVMADQDQDGSHIKGLVINFIHHFWPSLIQRNFVEEFITPIVKATKGKEEVSFYSLPEYSEWRMNTDNWKSYKIKYYKGLGTSTSKEAKEYFLDMVRHRIRFKYNGADDDNAVDMAFSKKKIEERKDWLSKWMREKKDRKQQGLAEEYLYNKDTRFVTFKDFVNRELVLFSNLDNERSIPCLVDGFKPGQRKVLFACFKRADKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSNNINLLLPIGQFGTRLQGGKDSASARYIFTQLSPVTRTLFPAHDDNVLRFLYEENQRIEPEWYCPIIPMVLVNGAQGIGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRFACYGEVAVLDDNTIEITELPIKQWTQDYKEKVLEGLMESSDKKSPVIVDYKEYHTDTTVKFVVKLSPGKLRELERGQDLHQVFKLQAVINTTCMVLFDAAGCLRTYTSPEAITQEFYDSRQEKYVQRKEYLLGVLQAQSKRLTNQARFILAKINNEIVLENKKKAAIVDVLIKMKFDADPVKKW-KEEQKLKELRESGEIELDEDDLAAVAVEEDEAISSAAKAVETKLSDYDYLVGMALIKLSEEEKNKLIKESEEKMAEVRVIEKKTWQDLWHEDLDNFVSELDKQEAREKADQDAS-IKNAAKKLAADAKTGRGPKKNVCTEVLPSKDGQRIEPMLD 1280          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 450/1135 (39.65%), Postives = 685/1135 (60.35%), Query Frame = 3
Query:  132 RYLKKTQLEHILLRPDSYVGSIK-PEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKE---DFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAAC-TNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQ--------VSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXM--NMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVA-KCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKR-NLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMING-GTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQL-------DGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMN---PAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTA 3446
            +Y KK+  EH+LLRPD+Y+G +   E++ +W+ DSE   M+ K++TY PGL KI+DEILVNA+DNK RD  M+ + + ++     I +WNNG G+PV +H    ++VPT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EFI+ET +    + F+Q W  NM   ++  +     E   D+T V F PDL+RF +  L D+ I L  RR +++AA     + VYLNGQ+  V  F+DYV+++  +          +++     RW V +    N+ F +        VSFVN+I T KGG+HV+++ D    K++ I K  + S        V    +  N+ +F+ CLIENPSF+SQTKE +T  AK+FGS      K  ++ A + G++E I    +  N         +   + ++DI KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  V  G  +W++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +RSIP L+DG KP QRK+L+  L   +   E+KV+QLAG+VA   +YHHGE SL+ TII + Q F GS+N+ LL P GQFGTR  GG D+AS RYI T L+  T+L+F   D+ +L+  +++   +EP W  PI+P++LING +GIGTGWS+KI N NP D+ID ++R I+   T  ++ P+Y  F G +  V   K++ +G+I  +          ++EI ELPI +WT+ YKE + +I     +  P  + ++ E +T+K V F + ++    +++ +        +FKL+T LT  N +LFD  G ++++ N  EI   FF+VR ++Y KR         A+   ++NQ  FI    NG +   ++    L +KL    +  DP+    K                    +S K ++GYL +M +  LT+
Sbjct:   46 KYEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFNDSS--------SLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD----KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDAKKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWADVEEGG-KWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRSIPSLIDGLKPSQRKILWTLLNNMDESTEIKVSQLAGAVAHRQSYHHGEESLVRTIIRMGQTFCGSSNLPLLQPIGQFGTRHEGGNDAASARYIFTALAPTTRLLFPQADDDLLQKNVEEGMVVEPTWLCPIVPLILINGTEGIGTGWSTKIANRNPIDIIDMIRRKIDSISTEYEIPPFYEEFRGKLEVVTPTKFISSGKIQLIRPERKNASTFSIEIVELPIGIWTSKYKEKLSKIV----ETLP--VLEFSERHTEKRVHFRITLDRKKSSRFLQKSNSDLLNYFKLRTSLT-ENRVLFDRNGELKEFGNISEIAAEFFEVRRDLYEKRLKIQKEECEAKLIYVENQLNFIEMVTNGTIEIRSMGRNQLEEKLQEMGFRVDPMATIAK--------------------NSKKANYGYLLEMPVSRLTS 1124          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: cin-4 (DNA topoisomerase-like protein cin-4 [Source:UniProtKB/Swiss-Prot;Acc:G5ECQ8])

HSP 1 Score: 768.074 bits (1982), Expect = 0.000e+0
Identity = 386/755 (51.13%), Postives = 524/755 (69.40%), Query Frame = 3
Query: 1362 IPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAE-AVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEE-------------ENQEDIEDSNKP------DFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEI 3566
            IPKL+DAN AGTKNS QCTLILTEGDSAK+LAVSGL+V+GRD YGVFP R KLLNV +  V Q+ ++AE+  IIKI+GLQY++KYE  +  KTLRYGKL+IM + D DGS  KGLL+NF H  WP L K +FVE FITPI KA +  + +SFYS+PE  EW+  T     + +KYY GLGT TSKEAK+ FSDM RH I+F+Y+G +D K++ +AFSK K + R ++L   M+D  +R++ G+ E  LY K T+++T ++F N E++    + N  SIPCL+DG KPGQRKVLFAC KR   +E+KVAQLAG+VAE+SAYHHGE SLM TI+NLAQD+VGS+NINLL+P GQFGTRL GGKDSAS R I  QLS++T+ +F   D+ VL+ L ++NQ IEPEWY PIIPMVL+NG  G GTGWS+ IPN+NP++++ N+KR+I G     + PWY+NF G I+++  +++   GE++ LD  T+EITELPI+ WT  YKE V+E     +DK    I DYKEY+TD TV+F+V+++P K  E E     H+ FKLQ  +  + M+LFD  G +R Y +   I + F+  R E Y++RK YLLG+L AQ+ +L NQARFIL  IN K++ EN K   ++D L+  K+D+DPVK W++  +KL  + +  E             E  EDI  + K       D+ YL  + ++ L+ E+K+ L+KE +EK+ E+ ++  K+ Q +W+ DL+    E+
Sbjct:   40 IPKLEDANDAGTKNSQQCTLILTEGDSAKTLAVSGLSVVGRDKYGVFPFRRKLLNVCDLNVNQIADSAEVNAIIKILGLQYTKKYETEDDFKTLRYGKLLIMANHDSDGSQFKGLLLNFFHRFWPALFKRDFVEDFITPIAKATEGKEEVSFYSLPEYSEWRMNTDNWKSYTIKYYNGLGTLTSKEAKKCFSDMVRHRIRFKYNGADDDKAVNMAFSKKKIEARTDYLMKLMQDKNQRKQQGLAEECLYNKETRFVTLKDFFNYEIVC---SWNLHSIPCLVDGLKPGQRKVLFACFKRANKREVKVAQLAGAVAEISAYHHGEQSLMGTIVNLAQDYVGSHNINLLLPIGQFGTRLQGGKDSASARSIFAQLSQVTRTLFPAHDDNVLRFLYEENQRIEPEWYCPIIPMVLVNGAQGTGTGWSTNIPNYNPRELVKNIKRLIAGEPQKALAPWYKNFRGKIIQIDPSRFACYGEVSVLDDNTIEITELPIKQWTQDYKEKVLEGLMESSDKKSPVIVDYKEYHTDTTVKFVVKLSPGKLRELERGQDLHQVFKLQAVINTTCMVLFDAAGWLRTYTSPEAITQEFYDSRQEKYVQRKEYLLGVLQAQSKRLTNQARFILATINNKIVLENKKKTAIVDVLIKMKFDADPVKKWKED-QKLKELRESGEIELDEDDLAAVAVEEGEDISSAAKAVETKLSDYDYLVGLALIKLSEEEKNKLIKESEEKMAEVRVLEKKTWQDLWITDLDNFMSEL 790          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 537.339 bits (1383), Expect = 4.747e-173
Identity = 293/705 (41.56%), Postives = 444/705 (62.98%), Query Frame = 3
Query:  132 RYLKKTQLEHILLRPDSYVGSIK-PEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKE---DFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAAC-TNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQ--------VSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXM--NMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVA-KCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERS 2192
            +Y KK+  EH+LLRPD+Y+G +   E++ +W+ DSE   M+ K++TY PGL KI+DEILVNA+DNK RD  M+ + + ++     I +WNNG G+PV +H    ++VPT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EFI+ET +    + F+Q W  NM   ++  +     E   D+T V F PDL+RF +  L D+ I L  RR +++AA     + VYLNGQ+  V  F+DYV+++  +          +++     RW V +    N+ F +        VSFVN+I T KGG+HV+++ D    K++ I K  + S        V    +  N+ +F+ CLIENPSF+SQTKE +T  AK+FGS      K  ++ A + G++E I    +  N         +   + ++DI KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  V  G  +W++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +R+
Sbjct:   46 KYEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFNDSS--------SLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD----KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDAKKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWADVEEGG-KWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Match: R05D3.12 (Putative DNA topoisomerase 2, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34534])

HSP 1 Score: 537.339 bits (1383), Expect = 4.747e-173
Identity = 293/705 (41.56%), Postives = 444/705 (62.98%), Query Frame = 3
Query:  132 RYLKKTQLEHILLRPDSYVGSIK-PEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKE---DFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAAC-TNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQ--------VSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXM--NMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVA-KCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAG-TKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHN-FVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERS 2192
            +Y KK+  EH+LLRPD+Y+G +   E++ +W+ DSE   M+ K++TY PGL KI+DEILVNA+DNK RD  M+ + + ++     I +WNNG G+PV +H    ++VPT++FG L TS+N++D + +  GGRNGYGAKLCNIFS EFI+ET +    + F+Q W  NM   ++  +     E   D+T V F PDL+RF +  L D+ I L  RR +++AA     + VYLNGQ+  V  F+DYV+++  +          +++     RW V +    N+ F +        VSFVN+I T KGG+HV+++ D    K++ I K  + S        V    +  N+ +F+ CLIENPSF+SQTKE +T  AK+FGS      K  ++ A + G++E I    +  N         +   + ++DI KL+DA +AG T  + +CTLILTEGDSAK+LA++GL V+GR+ YGVFPL+GKLLNV      + ++N EI+N+++I+GL++     +  + ++LRYG+L+I+ DQD+DGSHIKGL++NFIH  WP+L+  + F++ F TP++KA K ++V SF+S+ E  +W  V  G  +W++KYYKGLGTSTS EA+EYFSD++ H + F+Y+G  D  +I +AF + K+DERKEW+        RR E   +E+     G   I+++ F++ +L+ F   D +R+
Sbjct:   46 KYEKKSPTEHVLLRPDTYIGGVAMREDQIIWLRDSENRKMIAKEVTYPPGLLKIFDEILVNAADNKARDSSMNRLEVWLDRETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTRIKRRFRQKWYDNMKKCNEAEVVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIDLIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFNDSS--------SLLFLHPTPRWHVGVAKR-NNFFGESHVVLPKIVSFVNNINTEKGGSHVDYVMD----KIVNIIKPIVDSKLGDPTKSVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDAKKTAEWAEQSGLIEDIVEEVL--NMKKKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLEVLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFEDSNSI--TRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHTDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWADVEEGG-KWKIKYYKGLGTSTSNEAREYFSDLDHHTVNFKYTGTTDDDAIRMAFDRDKSDERKEWI--------RRSE---NEITNEDDGKTEISYQEFVDGQLMQFGMVDLKRT 721          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0332320)

HSP 1 Score: 1319.29 bits (3413), Expect = 0.000e+0
Identity = 660/1169 (56.46%), Postives = 856/1169 (73.22%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYA--EAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAI-----------------DKGEEENQEDIEDSNK-----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEIN 3569
            Y KK+QLEHILLRPDSY+GS++  ++ +W++D+ +N MV+K+I++ PGLYKI+DEILVNA+DNK RD+ M+ I+IDI+  +NM+ +WNNG+GIPV MH++  ++VPTMIFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS  F +ET+ +EY KSFKQTW  NMG ASD  I      D+T +TF PDL +F M  LD++ +AL SRRAYD+AA + G+ V+LNG ++ V+NFKDY++L+ KN  D +   +K+++E   +RWEVA   S +  F QVSFVNSIAT KGG HV+H+ D    +LLE+ KKK K        +V     ++WVFV CLIENP+FDSQTKENMTL  K FGS C L++KFI+ ++K GIVE +  WA FK Q     K    K +K+K IPKL+DAN AG KNS++CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGKLLNVREA  KQL+ENAEI N+ KIIGLQY +KY   + LKTLRYGK+MIMTDQDQDGSHIKGLLINFIH+ WP LL+  F+E+FITPIVKA K N+ LSFYS+PE  EW+  T   + + +KYYKGLGTSTSKEAKEYF DM+RH I F+Y G  D +SIV+AFSK   + RK WLTN M++ KRR+ELG+ E YLY KGTK IT+ +FIN EL+LFSN DNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQL+GSVAE+SAYHHGE SL  TI+NLAQ+FVG+NNINLL P GQFGTRL+GGKD AS RYI T +S LT+LI+H  D+ +L   +DD Q IEP WY PIIPMVL+NG +GIGTGWS+KI N+NP++++ NL++MING  P  MHPWY+NF G +  V + +Y+  G I  L G  LEI+ELP+ VWT +YKE+V+E   +G +K    I++Y+EY+TD TVRF++   P ++    AE  GF++ FKL T L+ + M  FD+   +R++   I+IL+ ++K+R E Y +R+++L+G L+AQA +L +QARFILEK   K++ EN +   + D+L+   Y  DPVK WQ+ ++   A                   K ++E + D E + K       F YL  M +  LT EKK+ LLK+RD KL EL+ +R K+P+ +WLDDL+ LE ++N
Sbjct:   14 YQKKSQLEHILLRPDSYIGSVEFTKELMWVYDNSQNRMVQKEISFVPGLYKIFDEILVNAADNKQRDKSMNTIKIDIDPERNMVSVWNNGQGIPVTMHKEQKMYVPTMIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETATREYKKSFKQTWGNNMGKASDVQIKDFNGTDYTRITFSPDLAKFKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNGNKLGVRNFKDYIDLHIKNTDDDSGPPIKIVHEVANERWEVACCPS-DRGFQQVSFVNSIATYKGGRHVDHVVDNLIKQLLEVLKKKNKGGINIKPFQVRN---HLWVFVNCLIENPTFDSQTKENMTLQQKGFGSKCTLSEKFINNMSKSGIVESVLAWAKFKAQN-DIAKTGGRKSSKIKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQKIEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRYIQTGNIQILSGNRLEISELPVGVWTQNYKENVLEPLSNGTEKVKGIISEYREYHTDTTVRFVISFAPGEFERIHAEEGGFYRVFKLTTTLSTNQMHAFDQNNCLRRFPTAIDILKEYYKLRREYYARRRDFLVGQLTAQADRLSDQARFILEKCEKKLVVENKQRKAMCDELLKRGYRPDPVKEWQRRIKMEDAEQADEEDEEEEEAAPSVSSKAKKEKEVDPEKAFKKLTDVKKFDYLLGMSMWMLTEEKKNELLKQRDTKLSELESLRKKTPEMLWLDDLDALESKLN 1177          
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Match: Top2 (gene:FBgn0284220 transcript:FBtr0081287)

HSP 1 Score: 1319.29 bits (3413), Expect = 0.000e+0
Identity = 660/1169 (56.46%), Postives = 856/1169 (73.22%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYA--EAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAI-----------------DKGEEENQEDIEDSNK-----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEIN 3569
            Y KK+QLEHILLRPDSY+GS++  ++ +W++D+ +N MV+K+I++ PGLYKI+DEILVNA+DNK RD+ M+ I+IDI+  +NM+ +WNNG+GIPV MH++  ++VPTMIFG LLTS+N+NDD+K+VTGGRNGYGAKLCNIFS  F +ET+ +EY KSFKQTW  NMG ASD  I      D+T +TF PDL +F M  LD++ +AL SRRAYD+AA + G+ V+LNG ++ V+NFKDY++L+ KN  D +   +K+++E   +RWEVA   S +  F QVSFVNSIAT KGG HV+H+ D    +LLE+ KKK K        +V     ++WVFV CLIENP+FDSQTKENMTL  K FGS C L++KFI+ ++K GIVE +  WA FK Q     K    K +K+K IPKL+DAN AG KNS++CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGKLLNVREA  KQL+ENAEI N+ KIIGLQY +KY   + LKTLRYGK+MIMTDQDQDGSHIKGLLINFIH+ WP LL+  F+E+FITPIVKA K N+ LSFYS+PE  EW+  T   + + +KYYKGLGTSTSKEAKEYF DM+RH I F+Y G  D +SIV+AFSK   + RK WLTN M++ KRR+ELG+ E YLY KGTK IT+ +FIN EL+LFSN DNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQL+GSVAE+SAYHHGE SL  TI+NLAQ+FVG+NNINLL P GQFGTRL+GGKD AS RYI T +S LT+LI+H  D+ +L   +DD Q IEP WY PIIPMVL+NG +GIGTGWS+KI N+NP++++ NL++MING  P  MHPWY+NF G +  V + +Y+  G I  L G  LEI+ELP+ VWT +YKE+V+E   +G +K    I++Y+EY+TD TVRF++   P ++    AE  GF++ FKL T L+ + M  FD+   +R++   I+IL+ ++K+R E Y +R+++L+G L+AQA +L +QARFILEK   K++ EN +   + D+L+   Y  DPVK WQ+ ++   A                   K ++E + D E + K       F YL  M +  LT EKK+ LLK+RD KL EL+ +R K+P+ +WLDDL+ LE ++N
Sbjct:   14 YQKKSQLEHILLRPDSYIGSVEFTKELMWVYDNSQNRMVQKEISFVPGLYKIFDEILVNAADNKQRDKSMNTIKIDIDPERNMVSVWNNGQGIPVTMHKEQKMYVPTMIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTSFTVETATREYKKSFKQTWGNNMGKASDVQIKDFNGTDYTRITFSPDLAKFKMDRLDEDIVALMSRRAYDVAASSKGVSVFLNGNKLGVRNFKDYIDLHIKNTDDDSGPPIKIVHEVANERWEVACCPS-DRGFQQVSFVNSIATYKGGRHVDHVVDNLIKQLLEVLKKKNKGGINIKPFQVRN---HLWVFVNCLIENPTFDSQTKENMTLQQKGFGSKCTLSEKFINNMSKSGIVESVLAWAKFKAQN-DIAKTGGRKSSKIKGIPKLEDANEAGGKNSIKCTLILTEGDSAKSLAVSGLGVIGRDLYGVFPLRGKLLNVREANFKQLSENAEINNLCKIIGLQYKKKYLTEDDLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHTNWPELLRLPFLEEFITPIVKATKKNEELSFYSLPEFEEWKNDTANHHTYNIKYYKGLGTSTSKEAKEYFQDMDRHRILFKYDGSVDDESIVMAFSKKHIESRKVWLTNHMDEVKRRKELGLPERYLYTKGTKSITYADFINLELVLFSNADNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLSGSVAEMSAYHHGEVSLQMTIVNLAQNFVGANNINLLEPRGQFGTRLSGGKDCASARYIFTIMSPLTRLIYHPLDDPLLDYQVDDGQKIEPLWYLPIIPMVLVNGAEGIGTGWSTKISNYNPREIMKNLRKMINGQEPSVMHPWYKNFLGRMEYVSDGRYIQTGNIQILSGNRLEISELPVGVWTQNYKENVLEPLSNGTEKVKGIISEYREYHTDTTVRFVISFAPGEFERIHAEEGGFYRVFKLTTTLSTNQMHAFDQNNCLRRFPTAIDILKEYYKLRREYYARRRDFLVGQLTAQADRLSDQARFILEKCEKKLVVENKQRKAMCDELLKRGYRPDPVKEWQRRIKMEDAEQADEEDEEEEEAAPSVSSKAKKEKEVDPEKAFKKLTDVKKFDYLLGMSMWMLTEEKKNELLKQRDTKLSELESLRKKTPEMLWLDDLDALESKLN 1177          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 1380.93 bits (3573), Expect = 0.000e+0
Identity = 698/1198 (58.26%), Postives = 893/1198 (74.54%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKG---EEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEP--GEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD E   M  ++I++ PGLYKI+DEILVNA+DNK RD+ M+ I+I I+   N I +WNNGKGIPVV H+D  ++VP +IFG LLTS+N++D++K+VTGGRNGYGAKLCNIFS +F +ET+ KEY +SFKQTWT+NMG +++  I     EDFTCVTF PDL +FNM  LD + +AL +RRAYD+A    G+ V LNG+++PV +F+ YV+ Y K+ LD     LKV+ E   +RWEV +T S    F Q+SFVNSIATTKGG H+++I DQ   KL+E+ KKK K+       +V     ++WVFV  LIENP+FDSQTKENMTL  K FGS CAL++KFI     CGIVE I  W  FK Q  L+KKCS  KH+K+K IPKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESLK+LRYG++MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+E+FITPIVKA KN Q +SFYSIPE  EW+K T     W +KYYKGLGTSTSKEAKEYFSDMERH I F+Y+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  T+++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C+KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNN+N+L P GQFGTR+ GGKD+ASPRYI T LS L KL+F   D ++LK L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF GTI E+ +N+Y+V+GE++ LD  T+EI+ELP+R WT +YKESV+E    G DKTP  I+DYKEY+TD TV+F+V M   K A+AEA G HK FKLQ+ LT ++M+LFD  G +++Y +  EIL+ FF++RL  Y  RK++L+G L A+++KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K+ EK L  + G   + ++  D    + P+F Y+  M +  LT EK + LLK+RD K  EL+ +++K+ + +W +DL +  +E++ V  Q+      G+ V  +VK    K         ET PS F RR+EP+I
Sbjct:   54 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEEIG-MNLREISFVPGLYKIFDEILVNAADNKQRDKNMTTIKITIDPESNTISVWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSLKFTVETACKEYKRSFKQTWTENMGKSNEAKIKYFDGEDFTCVTFQPDLAKFNMEKLDKDIVALLTRRAYDVAGSCRGVKVILNGKKLPVNSFRSYVDFYVKDKLDETGVALKVVNETVNERWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYIVDQIVGKLIEVVKKKNKAGVSVKPFQVKN---HLWVFVNALIENPTFDSQTKENMTLQTKSFGSKCALSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKILGLQYKKSYDDPESLKSLRYGRIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEEFITPIVKASKNKQEVSFYSIPEFEEWKKHTESYKTWHIKYYKGLGTSTSKEAKEYFSDMERHRIMFKYNGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTSTRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCVKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSSLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGTIHELGQNQYLVSGEVSVLDKNTIEISELPVRTWTQAYKESVLEPMLQGTDKTPPLISDYKEYHTDTTVKFVVRMTEEKLAQAEAAGLHKVFKLQSSLTCNSMVLFDHMGCMKRYESVQEILKEFFELRLHYYKLRKDWLVGSLGAESAKLSNQARFVLEKIEGKLSIENKSKRDLIRMLVQRGYESDPVAAWNKAQEKSLEEEDGGGNDSDSSVDSGSFSGPNFNYILNMPLWCLTKEKVEELLKQRDLKKAELNELQSKTSENLWREDLAVFIEELDRVEEQEKESVNLGKAVK-LVKGKVGKPKVKKMQLEETLPSPFGRRVEPQI 1245          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 685/1195 (57.32%), Postives = 885/1195 (74.06%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD +   NC   + IT+ PGLYKI+DEILVNA+DNK RD+ M+CI+++I+   N I +WNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ +E  + FKQTW  NMG A +  I     +D+TC+TF PDL +F M  LD +T+AL +RRAYDIA  T G+ V LNG+++P+ NF+ YV+LY K+ +D     L V++E   +RWEV +T S    F QVSFVNSIATTKGG H +++ DQ   KL+E+ KKK K+       +V     +MW+FV CLIENPSFDSQTKENMTL  K+FGS C+L+DKF+ Q   CGIVE I  W  FK QA L+KKCS  KHTK+K +PKLDDAN AG KNS  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  PESLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+KA    Q +SFYSIPE  EW++       W++KYYKGLGTSTSKEAKEYFSDM RH I F+YSG  D ++I LAFSK   +ERKEWLT++M + ++RRE  + E YLYG+ TK +++ +FIN+EL+LFSN+DNERSIPC++DG KPGQRKV+F C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LK   DDN  +EPEWY PIIP+VL NG +GIGTGW+S+IPN++ +++I+N+ RM+NG  P+ M P Y+ F GTI E+ +N+YV NGE+  +D TT+EITELP++ WT +YKE+V+E+  +G +K PA ITDYKEY+TD TVRF+V+M   +  EAEA G HK FKLQ  LT ++M+LFD  G ++KY +  +IL+ FF++R++ Y+ RK++L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVKAW+ + EK    D  +++ +E  + S  PD+ YL  M +  LT EKKD L K+RD K+ EL+ ++ K+P  +W +DL    +E+  V  ++      +    + K      K +K+  ET P+   RR+ P+I
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDTGMNC---RDITFVPGLYKIFDEILVNAADNKQRDKTMNCIKVNIDPENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSLKFTVETACRESKRCFKQTWFDNMGRAGESKIKPFDGDDYTCITFQPDLAKFKMQALDKDTVALLTRRAYDIAGSTKGVRVLLNGKRLPINNFRTYVDLYVKDKVDETGSPLTVVHEMVNERWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKKNKAGVAVKPFQVKN---HMWLFVNCLIENPSFDSQTKENMTLQQKNFGSACSLSDKFVKQANGCGIVESIMNWVKFKAQAQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSNSCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKILGLQYKKNYSDPESLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASNKKQEISFYSIPEFTEWKEKQSSIKSWKIKYYKGLGTSTSKEAKEYFSDMTRHRIPFKYSGPADDEAITLAFSKKMIEERKEWLTSFMINRRQRREHNLPEEYLYGQETKSLSYHDFINKELVLFSNSDNERSIPCMVDGLKPGQRKVVFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDNLRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVNNGEVAIIDSTTIEITELPVKTWTQTYKENVLEVMLNGTEKVPALITDYKEYHTDTTVRFVVKMTEERLREAEAAGLHKVFKLQNLLTCNSMVLFDHVGSLKKYESVQDILKEFFELRMKYYVLRKDWLVGMLGAESAKLSNQARFILEKIQGTLVIENKPKKELIRMLQQMGYDSDPVKAWKDAQEKEEEEDAEDDDEKEKEDTSG-PDYNYLLSMPMWYLTKEKKDELCKQRDAKMTELNTLKMKAPADLWKEDLAAFTEELERVEQKEKESQNAM---PLVKGKVGKPKVVKVKNETMPTPQGRRVIPRI 1216          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 416.387 bits (1069), Expect = 7.632e-127
Identity = 226/459 (49.24%), Postives = 316/459 (68.85%), Query Frame = 3
Query: 2337 SLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LK   DDN  +EPEWY PIIP+VL NG +GIGTGW+S+IPN++ +++I+N+ RM+NG  P+ M P Y+ F GTI E+ +N+YV NGE+  +D TT+EITELP++ WT +YKE+V+E+  +G +K PA ITDYKEY+TD TVRF+V+M   +  EAEA G HK FKLQ  LT ++M+LFD  G ++KY +  +IL+ FF++R++ Y+ RK++L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVKAW+ + EK    D  +++ +E  + S  PD+ YL  M +  LT EKKD L K+RD K+ EL+ ++ K+P  +W +DL    +E+  V  ++      +    + K      K +K+  ET P+   RR+ P+I
Sbjct:    2 SLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSTLARLLFPVVDDNLLKYNYDDNLRVEPEWYMPIIPLVLANGGEGIGTGWASRIPNYDVREIINNIHRMLNGEEPLPMLPSYKGFKGTIDELAKNQYVNNGEVAIIDSTTIEITELPVKTWTQTYKENVLEVMLNGTEKVPALITDYKEYHTDTTVRFVVKMTEERLREAEAAGLHKVFKLQNLLTCNSMVLFDHVGSLKKYESVQDILKEFFELRMKYYVLRKDWLVGMLGAESAKLSNQARFILEKIQGTLVIENKPKKELIRMLQQMGYDSDPVKAWKDAQEKEEEEDAEDDDEKEKEDTSG-PDYNYLLSMPMWYLTKEKKDELCKQRDAKMTELNTLKMKAPADLWKEDLAAFTEELERVEQKEKESQNAM---PLVKGKVGKPKVVKVKNETMPTPQGRRVIPRI 456          
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 119.398 bits (298), Expect = 1.157e-30
Identity = 54/92 (58.70%), Postives = 73/92 (79.35%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKG 410
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD E+  M  ++I++ PGLYKI+DEILVNA+DNK RD+ M+ I+I I+   N I +WNNGKG
Sbjct:   49 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFD-EEIGMNLREISFVPGLYKIFDEILVNAADNKQRDKNMTTIKITIDPESNTISVWNNGKG 139          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1405.96 bits (3638), Expect = 0.000e+0
Identity = 707/1195 (59.16%), Postives = 884/1195 (73.97%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD ++  NC   + +T+ PGLYKI+DEILVNA+DNK RD  MSCI+I IN   N + +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFSN+F +ET+ +EY K FKQTWT NM  A+D  I     ED+TC+TF PDL +F M  LD + +AL SRRAYD+A  + G+ V+LNG+++P+  F+ YV+LY KN LD     LKV++E   DRWE+ +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K        +V     +MWVFV  LIENP+FDSQTKENMTL +K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+  T     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK + DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEA G HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W+++ EK  A +  EEE + ++  +  PDF YL  M +  L+ EKKD L K+RD K  EL  ++ KSP  +W +DL    +E++ V  ++  E       VVK    +         E  PS   RR+ PK+
Sbjct:   31 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVKPFQVKN---HMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQTQEKEEAGELLEEEEETEVNTAG-PDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVKGKSGRPQVKKMQLQEIMPSPHGRRVVPKV 1217          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1402.88 bits (3630), Expect = 0.000e+0
Identity = 707/1195 (59.16%), Postives = 885/1195 (74.06%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD ++  NC   + +T+ PGLYKI+DEILVNA+DNK RD  MSCI+I IN   N + +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFSN+F +ET+ +EY K FKQTWT NM  A+D  I     ED+TC+TF PDL +F M  LD + +AL SRRAYD+A  + G+ V+LNG+++P+  F+ YV+LY KN LD     LKV++E   DRWE+ +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K        +V     +MWVFV  LIENP+FDSQTKENMTL +K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+  T     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK + DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEA G HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W+++ EK  A +  EEE + ++ ++  PDF YL  M +  L+ EKKD L K+RD K  EL  ++ KSP  +W +DL    +E++ V  ++  E       VVK    +         E  PS   RR+ PK+
Sbjct:   31 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVKPFQVKN---HMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQTQEKEEAGELLEEEEETEV-NTAGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVKGKSGRPQVKKMQLQEIMPSPHGRRVVPKV 1217          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1402.5 bits (3629), Expect = 0.000e+0
Identity = 707/1195 (59.16%), Postives = 884/1195 (73.97%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD ++  NC   + +T+ PGLYKI+DEILVNA+DNK RD  MSCI+I IN   N + +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFSN+F +ET+ +EY K FKQTWT NM  A+D  I     ED+TC+TF PDL +F M  LD + +AL SRRAYD+A  + G+ V+LNG+++P+  F+ YV+LY KN LD     LKV++E   DRWE+ +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K        +V     +MWVFV  LIENP+FDSQTKENMTL +K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+  T     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK + DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEA G HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W+++ EK  A +  EEE + ++  +  PDF YL  M +  L+ EKKD L K+RD K  EL  ++ KSP  +W +DL    +E++ V  ++  E       VVK    +         E  PS   RR+ PK+
Sbjct:   31 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVKPFQVKN---HMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQTQEKEEAGELLEEEEETEVNTAG-PDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVKGKSGRPQVKKMQLQEIMPSPHGRRVVPKV 1217          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1402.5 bits (3629), Expect = 0.000e+0
Identity = 707/1195 (59.16%), Postives = 884/1195 (73.97%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD ++  NC   + +T+ PGLYKI+DEILVNA+DNK RD  MSCI+I IN   N + +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFSN+F +ET+ +EY K FKQTWT NM  A+D  I     ED+TC+TF PDL +F M  LD + +AL SRRAYD+A  + G+ V+LNG+++P+  F+ YV+LY KN LD     LKV++E   DRWE+ +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K        +V     +MWVFV  LIENP+FDSQTKENMTL +K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+  T     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK + DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEA G HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W+++ EK  A +  EEE + ++  +  PDF YL  M +  L+ EKKD L K+RD K  EL  ++ KSP  +W +DL    +E++ V  ++  E       VVK    +         E  PS   RR+ PK+
Sbjct:   31 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVKPFQVKN---HMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQTQEKEEAGELLEEEEETEVNTAG-PDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVKGKSGRPQVKKMQLQEIMPSPHGRRVVPKV 1217          
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Match: TOP2A (DNA topoisomerase II alpha [Source:NCBI gene;Acc:100038293])

HSP 1 Score: 1399.03 bits (3620), Expect = 0.000e+0
Identity = 704/1195 (58.91%), Postives = 880/1195 (73.64%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD ++  NC   + +T+ PGLYKI+DEILVNA+DNK RD  MSCI+I IN   N + +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFSN+F +ET+ +EY K FKQTWT NM  A+D  I     ED+TC+TF PDL +F M  LD + +AL SRRAYD+A  + G+ V+LNG+++P+  F+ YV+LY KN LD     LKV++E   DRWE+ +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K        +V     +MWVFV  LIENP+FDSQTKENMTL +K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NSL CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPI+K  K+ Q LSFYSIPE  EW+  T     W++KYYKGLGTSTSKEAKEYFSDMERH I F+Y G  D  +I LAFS+ K D+RKEWLTN+M+D + RR  G+ E YLYGK TKY+TF +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TIINLAQ+FVGSNN++LL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D++VLK + DDNQ +EPEWY PIIP VL+NG +GIGTGWS KIPN++ ++++ N+ R+++G  P+ M P Y+NF G I E+  N+Y++NGE++ LD TT+EI+ELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V++   K  EAEA G HK FKLQTPLT ++M+LFD  G +RKY    +IL  FF +RL+ Y  RK++L+G+L+A+AS+L NQARFILEKI GK++ EN     LI  LV   YDSDPVK+W+++ EK+        E ++     + PDF YL  M +  L+ EKKD L K+RD K  EL  ++ KSP  +W +DL    +E++ V  ++  E       VVK    +         E  PS   RR+ PK+
Sbjct:   31 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEDEGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDPTMSCIKITINPESNTVSVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSNKFTVETACREYKKVFKQTWTDNMSDAADAKIKPFDGEDYTCITFQPDLSKFKMQILDKDIVALMSRRAYDVAGSSKGVKVFLNGKRLPISGFRSYVDLYLKNKLDETGNPLKVMHELVNDRWEICLTMS-EKGFQQISFVNSIATTKGGRHVDYVADQIIAKLIEVVKKKNKGGIAVKPFQVKN---HMWVFVNSLIENPTFDSQTKENMTLQSKSFGSKCTLSEKFIKGATNCGIVESILNWVKFKAQTQLNKKCSSVKHTKIKGIPKLDDANDAGSRNSLDCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDNESLKTLRYGKVMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIIKVTKSKQELSFYSIPEFEEWKNNTDSHKTWKIKYYKGLGTSTSKEAKEYFSDMERHRIPFKYEGPIDDAAITLAFSRKKVDDRKEWLTNFMQDRRERRLHGLPEEYLYGKSTKYLTFNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGETSLMMTIINLAQNFVGSNNVSLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAMDDSVLKFMYDDNQKVEPEWYIPIIPTVLVNGAEGIGTGWSCKIPNYDTREIVSNIGRLLDGLEPLPMLPSYKNFKGLIQELGPNQYILNGEVSVLDNTTIEISELPVRTWTQNYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKLTEQKLMEAEAAGLHKVFKLQTPLTCNSMVLFDHVGCLRKYETATDILREFFVLRLKYYSLRKDWLVGMLTAEASRLSNQARFILEKIEGKIVIENKPKKELIQMLVQRGYDSDPVKSWKQTQEKVFIC----VEFRDRSLLPSGPDFNYLLGMPLWNLSKEKKDELCKQRDVKNAELQDLKKKSPSDLWKEDLSAFVEELDRVEAKEREEQSVTTGKVVKGKSGRPQVKKMQLQEIMPSPHGRRVVPKV 1214          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2a (topoisomerase (DNA) II alpha [Source:MGI Symbol;Acc:MGI:98790])

HSP 1 Score: 1392.87 bits (3604), Expect = 0.000e+0
Identity = 689/1151 (59.86%), Postives = 875/1151 (76.02%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKL----LAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVV 3575
            Y KKTQLEHILLRPD+Y+GS++   + +W++D E   +  +++T+ PGLYKI+DEILVNA+DNK RD KMSCIR+ I+   N+I IWNNGKGIPVV H+   ++VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+++EY K FKQTW  NMG A D  +     ED+TC+TF PDL +F M  LD + +AL  RRAYDIA  T  + V+LNG  +PVK F+ YV+LY K+ +D     LKVI+E+   RWEV +T S    F Q+SFVNSIAT+KGG HV+++ DQ   KL+++ KKK K        +V     +MW+FV  LIENP+FDSQTKENMTL AK FGSTC L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+  TP   +W++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  L+ L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  LD TT+EI+ELPIR WT +YKE V+E   +G +KTP+ ITDY+EY+TD TV+F+++M   K AEAE VG HK FKLQ+ LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A++SKL NQARFILEKI+GK++ EN     LI  L+   YDSDPVKAW+++ +K+       +   E +  D      P F YL  M +  LT EKKD L K+R+EK +EL+ ++ KSP  +W +DL +  +E+ VV
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVELVTQQMWVYD-EDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNNGKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCLTMS-ERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAHQVKN---HMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVV 1178          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 1383.62 bits (3580), Expect = 0.000e+0
Identity = 697/1199 (58.13%), Postives = 886/1199 (73.89%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDS---NKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSE-PGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK    +  + ++ +   DS   + PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++ V  Q+  +    +    +K    K         ET PS + RRI P+I
Sbjct:   43 YQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVSKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDILAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVPEI 1234          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 184.111 bits (466), Expect = 4.773e-52
Identity = 84/156 (53.85%), Postives = 116/156 (74.36%), Query Frame = 3
Query: 2598 INGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDE 3065
            ING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M   +E
Sbjct:    2 INGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMAAEEE 157          
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Match: Top2b (topoisomerase (DNA) II beta [Source:MGI Symbol;Acc:MGI:98791])

HSP 1 Score: 66.6254 bits (161), Expect = 8.645e-11
Identity = 49/124 (39.52%), Postives = 76/124 (61.29%), Query Frame = 3
Query: 3207 RFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDS---NKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEIN 3569
            RFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK    +  + ++ +   DS   + PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++
Sbjct:    1 RFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELD 124          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|P41515|TOP2A_CRIGR (DNA topoisomerase 2-alpha OS=Cricetulus griseus OX=10029 GN=TOP2A PE=1 SV=1)

HSP 1 Score: 1394.79 bits (3609), Expect = 0.000e+0
Identity = 691/1150 (60.09%), Postives = 881/1150 (76.61%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKL---LAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVV 3575
            Y KKTQLEHILLRPD+Y+GS++   + +W++D E   +  +++T+ PGLYKI+DEILVNA+DNK RD KMSCIR+ I+   N+I IWNNGKGIPVV H+   ++VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS  F +ET++KEY K FKQTW  NMG A D  +     ED+TC+TF PDL +F M  LD + +AL  RRAYDIA  T  + V+LNG ++PVK F+ YV++Y K+ LD     LKV++E+   RWEV +T S    F Q+SFVNSIAT+KGG HV+++ DQ   KL+++ KKK K        +V     +MW+FV  LIENP+FDSQTKENMTL AK FGSTC L++KFI     CGIVE I  W  FK Q  L+KKCS  KH ++K IPKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q L+FYS+PE  EW+  TP   +W++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLT++MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS LT+L+F   D+  LK L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  L+ TT+EI+ELPIR WT +YKE V+E   +G +KTP  ITDY+EY+TD TV+F+++M   K AEAE VG HK FKLQT LT ++M+LFD  G ++KY+  ++IL+ FF++RL+ Y  RK +LLG+L A+++KL NQARFILEKI+GK+I EN     LI  L+   YDSDPVKAW+++ +K+      ++ + EN + + +S  P F YL  M +  LT EKKD L K+R+EK +EL+ ++NKSP  +W +DL +  +E+ VV
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVELVTQQMWVYD-EDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTRFTVETASKEYKKMFKQTWMDNMGRAGDMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNALKVVHEQVNPRWEVCLTMS-EKGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAHQVKN---HMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHNRIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQELAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLTRLLFPPKDDHTLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILKDFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDNENSDSVAESG-PTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKNKSPSDLWKEDLAVFIEELEVV 1176          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q01320|TOP2A_MOUSE (DNA topoisomerase 2-alpha OS=Mus musculus OX=10090 GN=Top2a PE=1 SV=2)

HSP 1 Score: 1392.87 bits (3604), Expect = 0.000e+0
Identity = 689/1151 (59.86%), Postives = 875/1151 (76.02%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKL----LAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVV 3575
            Y KKTQLEHILLRPD+Y+GS++   + +W++D E   +  +++T+ PGLYKI+DEILVNA+DNK RD KMSCIR+ I+   N+I IWNNGKGIPVV H+   ++VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+++EY K FKQTW  NMG A D  +     ED+TC+TF PDL +F M  LD + +AL  RRAYDIA  T  + V+LNG  +PVK F+ YV+LY K+ +D     LKVI+E+   RWEV +T S    F Q+SFVNSIAT+KGG HV+++ DQ   KL+++ KKK K        +V     +MW+FV  LIENP+FDSQTKENMTL AK FGSTC L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K IPKLDDAN AG++NS +CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  +SLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q ++FYS+PE  EW+  TP   +W++KYYKGLGTSTSKEAKEYF+DM+RH I+F+YSG ED  +I LAFSK + D+RKEWLTN+MED ++R+ LG+ E YLYG+ T Y+T+ +FIN+ELILFSN+DNERSIP ++DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+S+YHHGE SLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+  L+ L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++V++N++R+++G  P+ M P Y+NF GTI E+  N+YV+NGE+  LD TT+EI+ELPIR WT +YKE V+E   +G +KTP+ ITDY+EY+TD TV+F+++M   K AEAE VG HK FKLQ+ LT ++M+LFD  G ++KY+  ++IL  FF++RL+ Y  RK +LLG+L A++SKL NQARFILEKI+GK++ EN     LI  L+   YDSDPVKAW+++ +K+       +   E +  D      P F YL  M +  LT EKKD L K+R+EK +EL+ ++ KSP  +W +DL +  +E+ VV
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVELVTQQMWVYD-EDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNVISIWNNGKGIPVVEHKVEKIYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDNMGRAGDMELKPFSGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNSLPVKGFRSYVDLYLKDKVDETGNSLKVIHEQVNPRWEVCLTMS-ERGFQQISFVNSIATSKGGRHVDYVADQIVSKLVDVVKKKNKGGVAVKAHQVKN---HMWIFVNALIENPTFDSQTKENMTLQAKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQIQLNKKCSAVKHTKIKGIPKLDDANDAGSRNSTECTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEIAFYSLPEFEEWKSSTPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQVDDRKEWLTNFMEDRRQRKLLGLPEDYLYGQSTSYLTYNDFINKELILFSNSDNERSIPSMVDGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLRFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLLDGEEPLPMLPSYKNFKGTIEELASNQYVINGEVAILDSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPSLITDYREYHTDTTVKFVIKMTEEKLAEAERVGLHKVFKLQSSLTCNSMVLFDHVGCLKKYDTVLDILRDFFELRLKYYGLRKEWLLGMLGAESSKLNNQARFILEKIDGKIVIENKPKKELIKVLIQRGYDSDPVKAWKEAQQKVPDEEENEESDTETSTSDSAAEAGPTFNYLLDMPLWYLTKEKKDELCKQRNEKEQELNTLKQKSPSDLWKEDLAVFIEELEVV 1178          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q02880|TOP2B_HUMAN (DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B PE=1 SV=3)

HSP 1 Score: 1390.94 bits (3599), Expect = 0.000e+0
Identity = 701/1201 (58.37%), Postives = 890/1201 (74.10%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNK-----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEP-GEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM++G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK  A ++ E +NQ D   S+      PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++ V +Q+  +    +    +K    K         ET PS + RRI P+I
Sbjct:   55 YQKKTQLEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEK--AAEEDETQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVESQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEI 1246          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|O42130|TOP2A_CHICK (DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031 GN=TOP2A PE=2 SV=2)

HSP 1 Score: 1384.39 bits (3582), Expect = 0.000e+0
Identity = 716/1267 (56.51%), Postives = 913/1267 (72.06%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSE-----PGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSE 3914
            Y KKTQLEHILLRPD+Y+GS++   + +W+FD +   NC   + +T+ PGLYKI+DEILVNA+DNK RD+ MSCI++ I+   N I +WNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ +EY K FKQTWT NMG A +  +     ED+TCVTF PDL +F M+ LD + +AL SRRAYDIA  T  + V+LNG+++PVK F+ YV+LY K+ +D     LKVI+E+   RWEV +T S    F QVSFVNSIATTKGG HV+++ DQ   KL+++ KKK K+       +V     +MW+FV  LIENP+FDSQTKENMTL AK FGSTC L++KFI     CGIVE I  W  FK Q  L+KKCS  KHTK+K +PKLDDAN AG+KNS+ CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + YE  ESLK+LRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+K  KN + + FYSIPE  EW+  T   N W++KYYKGLGTSTSKEAKEYF+DM RH I F+YSG ED  +I LAFSK K +ERKEWLTN+MED ++R   G+ E YLYGK T Y+T+ +FIN+EL+LFSN+DNERSIP L+DG KPGQRKVLF C KRN  +E+K AQLAGSVAE+S+YHHGEASLM TIINLAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ VL+ L DDNQ +EPEWY PIIPMVLING +GIGTGWS KIPNF+ ++ ++N++ +++G  P+ M P Y+NF GTI E+  N+YV++GE++ LD TT+EITELP+R WT +YKE V+E   +G +KTP  ITDYKEY+TD TV+F+V+M+  K AEAEAVG HK FKLQT LT ++M+LFD  G ++KY +  +IL+ FF++RL  Y  RK +L+G+L A+++KL NQARFILEKI+GK++ EN     LI  L+   Y+SDPVKAW++   K        +E+ E+   +  PDF YL  M +  LT EKKD L K+RD K KEL+ +++KSP  +W +DL    +E++ V  +   +      G+ +     K G K        AE  PS    R+ P++  E   +                    I+  +  E   ++ +   N+S + E  +L QRLA+   +E
Sbjct:   35 YQKKTQLEHILLRPDTYIGSVETVTQQMWVFDEDVGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDKSMSCIKVTIDPENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACREYKKLFKQTWTDNMGKAGEMTLKHFDGEDYTCVTFQPDLSKFKMTILDKDIVALMSRRAYDIAGSTKDVKVFLNGKRLPVKGFRSYVDLYLKDKVDETGNALKVIHEEVNSRWEVCLTLS-EKGFQQVSFVNSIATTKGGRHVDYVADQIVTKLIDVVKKKNKNGVGVKPFQVKN---HMWIFVNSLIENPTFDSQTKENMTLQAKSFGSTCKLSEKFIKGAVGCGIVESILNWVKFKAQTQLNKKCSAVKHTKIKGVPKLDDANDAGSKNSIDCTLILTEGDSAKTLAVSGLGVVGRDKYGVFPLRGKMLNVREASHKQIMENAEINNIIKIVGLQYKKNYEDRESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSKNKEEIPFYSIPEFEEWKSSTQNYNSWKIKYYKGLGTSTSKEAKEYFADMARHRIGFKYSGPEDDAAITLAFSKKKVEERKEWLTNFMEDRRQRNVHGLPEDYLYGKDTNYLTYNDFINKELVLFSNSDNERSIPSLVDGLKPGQRKVLFTCFKRNDKREVKGAQLAGSVAEMSSYHHGEASLMMTIINLAQNFVGSNNLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPVDDNVLRFLYDDNQRVEPEWYMPIIPMVLINGAEGIGTGWSCKIPNFDIRETVNNIRCLLDGKEPLPMLPSYKNFKGTIDELGPNQYVISGEVSILDSTTIEITELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYKEYHTDTTVKFVVKMSEEKLAEAEAVGLHKVFKLQTNLTCNSMVLFDHVGFLKKYESPQDILKEFFELRLRYYGLRKEWLIGMLGAESAKLNNQARFILEKIDGKIVIENKPKKELIQVLIQRGYESDPVKAWKELQNKEEEE---GDESGEESAAATGPDFNYLLNMPLWYLTKEKKDELCKQRDNKDKELEDLKHKSPSDLWKEDLAAFVEELDAVEAKQMQDEMAGITGKPLKVKGGKQGGKQKVTKAQLAEVMPSPHGIRVVPRVTAEMKAEAEKR----------------IKKKIKSEKNESDEKQEGNSSGDKEPSSLKQRLAQKRKAE 1275          
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Match: sp|Q64511|TOP2B_MOUSE (DNA topoisomerase 2-beta OS=Mus musculus OX=10090 GN=Top2b PE=1 SV=2)

HSP 1 Score: 1383.62 bits (3580), Expect = 0.000e+0
Identity = 697/1199 (58.13%), Postives = 886/1199 (73.89%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSE--KNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDS---NKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSE-PGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W++D +   NC   +++T+ PGLYKI+DEILVNA+DNK RD+ M+CI++ I+   N+I IWNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+  I     ED+TC+TF PDL +F M  LD + +AL +RRAYD+A    G+ V  NG+++PV  F+ YV+LY K+ LD     LKVI+E   +RW+V +T S    F Q+SFVNSIATTKGG HV+++ DQ   KL+E+ KKK K+       +V     ++WVF+ CLIENP+FDSQTKENMTL  K FGS C L++KF    + CGIVE I  W  FK Q  L+KKCS  K++K+K IPKLDDAN AG K+SL+CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+  ESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LLKH F+E+FITPIVKA KN Q LSFYSIPE  EW+K       W++KYYKGLGTST+KEAKEYF+DMERH I FRY+G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E +LYG  TK++T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNINLL P GQFGTRL GGKD+ASPRYI T LS L +L+F   D+ +LK L DDNQ +EPEWY PIIPMVLING +GIGTGW+ K+PN++ +++++N++RM+ G  P  M P Y+NF GTI E+ +N+Y V+GEI  +D  T+EITELP+R WT  YKE V+E   +G DKTPA I+DYKEY+TD TV+F+V+M   K A+AEA G HK FKLQT LT ++M+LFD  G ++KY    +IL+ FF +RL  Y  RK +L+G+L A+++KL NQARFILEKI GK+  EN     LI  LV   Y+SDPVKAW+++ EK    +  + ++ +   DS   + PDF Y+  M + +LT EK + L+K+RD K +E++ ++ KSP  +W +DL    +E++ V  Q+  +    +    +K    K         ET PS + RRI P+I
Sbjct:   43 YQKKTQLEHILLRPDTYIGSVEPLTQLMWVYDEDVGMNC---REVTFVPGLYKIFDEILVNAADNKQRDKNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHELANERWDVCLTLS-EKGFQQISFVNSIATTKGGRHVDYVVDQVVSKLIEVVKKKNKAGVSVKPFQVKN---HIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLARLLFPAVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLEGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEDSQNQHDDSSSDSGTPSGPDFNYILNMSLWSLTKEKVEELIKQRDTKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQEREDILAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVPEI 1234          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A094ZNL1 (DNA topoisomerase 2 OS=Schistosoma haematobium OX=6185 GN=MS3_03959 PE=3 SV=1)

HSP 1 Score: 1450.26 bits (3753), Expect = 0.000e+0
Identity = 760/1353 (56.17%), Postives = 982/1353 (72.58%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEEN------QEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTV---------VXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGD-NNSENDEELTLAQRLAKTHGSEAFKGLIGKG---DKPTKTNKTNILIEKNAKVSP-------GNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMS 4115
            Y KKTQLEHILLRPDSY+GS   + + +W+ D  +  MV + IT++PGLYKI+DEILVNA+DNK+RD  MSCI+IDIN  +NM+RIWN+GKGIPVV H+  N +VPT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +FI+ETS+KEY KSF+Q W +NM   +DP I + + +DFTC+TFYPDL RF M+ L+ +T++LF+RRAYD+AA  NG+ V+LNG+++P+K+F DYV L+ K   D  +  +KV+YE    RW+VA+  S N  F QVSFVNSIATTKGGTH+N+++DQ   KL+EI KKK  S K  V++K  Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGSTC L++KFI Q +K GIVE +  W  FK    +DK+C K+KH+KLK IPKLDDAN AGTKNS QCTLILTEGDSAK+LAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE  ++LK LRYGK+MIMTDQDQDGSHIKGL+INF+H  WPNLLKHN VE+FITPIVK FK  Q  SFYS+PE  EWQK TP  + WR+KYYKGLGTSTSKEAKEYFSDM RH I+FRYSG ED  SI LAF K+K  +RK WLTN+ ++ KRRRELG+ E YLYGK T+ IT+ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNL++E+KVAQLAGSVAELSAYHHGE SLMSTII LAQ+FVGSNN+NLL P GQFGTRL+GGKD+ASPRYI T L+ LT+LIFH +D+ +L  L DDNQ IEPEWYAPIIPMVL+NG DGIGTG+++ I N+N  ++I+NL RM++G  P +M P +R FTGTI ++  N+YV  GE+  LD  TLEITELPIRVWT +YKESV+E   +G++K PA ITDYKEY+TD TVRF+V+M+P K  EAE+ G HKFFKLQT ++  +M+ FD  G ++ Y N + I+  F+++RL  Y KRK YL G+LSA+A KL+NQARF+LEKI   ++ EN     LI  L  A YDSDPVKAW++S++K  A+ + EE        Q +  ++ +PD+ Y+  M + +LT E+KD LL +RD K KEL I+++KSP  +W +DL+ LE+E   V  +  ++    +  V                  K+ K+A ET P    RRI P ++ + +KK+    +K+ K   +  +   ++N         + EA D  N  NDE   LAQRL  +  ++  K    +G    +   T++  +L   +  +SP       GN +++ S  +   S +D GDS ++Q  + ++   +S
Sbjct:   36 YQKKTQLEHILLRPDSYIGSTLKDTQQMWVLDESQQHMVSRDITFSPGLYKIFDEILVNAADNKVRDPTMSCIKIDINPAENMVRIWNDGKGIPVVHHKVENTYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWVENMTKTTDPKILADKGDDFTCITFYPDLARFGMNELEQDTVSLFTRRAYDMAATCNGVKVFLNGKRLPIKSFMDYVNLFIKPNKDDGDS-VKVVYEAVNPRWQVAVAVS-NTGFQQVSFVNSIATTKGGTHINYVSDQIVNKLMEIVKKK--SGKSGVQIKPFQIKNHMWLFVNCLIENPTFDSQTKENMTLQTKSFGSTCTLSEKFIGQASKSGIVENVLSWIRFKAMEKMDKQCHKSKHSKLKGIPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESVDTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVEEFITPIVKVFKGKQEYSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGTEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQRIEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGNNRYVCYGEVAVLDDDTLEITELPIRVWTQNYKESVLEPMLNGSEKVPACITDYKEYHTDVTVRFVVKMSPEKLREAESTGLHKFFKLQTVMSTGSMVCFDPLGCLKCYPNEMVIIREFYELRLTWYEKRKVYLEGVLSAEARKLENQARFVLEKIQSIMVIENKPKKELIRMLKEANYDSDPVKAWKESIDKAAAVQEQEESRTDEGAPQTEAVEAGQPDYNYILNMPLWSLTKERKDDLLAQRDAKQKELLILKSKSPSDLWREDLKKLEEEYKKVEAELAADEQAAIEAVEKKLKIASTTTAGRVAATKSRKLAMETRPDPMGRRIVPTVDADMMKKVEGNKKKRNKTENDLNEGNELDN---------SFEANDEENDGNDEPKPLAQRLGASEKTDVQKTATTRGRGKGRTVPTSRPKLLKPSSPNISPIKRRNVGGNAKRKRSSRMPWESGSDTGDS-ESQVSIDSDNDHIS 1374          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A3Q0KH18 (DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 1446.03 bits (3742), Expect = 0.000e+0
Identity = 759/1338 (56.73%), Postives = 974/1338 (72.80%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEE------NQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQ---------DTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKG---DKPTKTNKTNILIEKNAKVSP-------GNKRKRDSGEIIELSDNDDGDS 4070
            Y KKTQLEHILLRPDSY+GS   + + +W+ D  +  MV + IT++PGLYKI+DEILVNA+DNK+RD  MSCI+IDIN  +NM+RIWN+GKGIPVV H+  N +VPT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +FI+ETS+KEY KSF+Q W  NM   SDP I + + EDFTC+TFYPDL RF M+ L+ +T++LF+RRAYD+AA  NGI V+LNG+++P+KNF DYV L+ K   D + + +KV+YE    RW+VA+  S N  F QVSFVNSIATTKGGTH+N+++DQ   KL++I KKK  S K  V++K  Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGSTC L++KFI Q +K GIVE +  W  FK    +DK+C K+KH+KLK IPKLDDAN AGTKNS QCTLILTEGDSAK+LAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE  ++LK LRYGK+MIMTDQDQDGSHIKGL+INF+H  WPNLLKHN VE+FITPIVK FK  Q  SFYS+PE  EWQK TP  + WR+KYYKGLGTSTSKEAKEYFSDM RH I+FRYSG ED  SI LAF K+K  +RK WLTN+ ++ KRRRELG+ E YLYGK T+ IT+ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNL++E+KVAQLAGSVAELSAYHHGE SLMSTII LAQ+FVGSNN+NLL P GQFGTRL+GGKD+ASPRYI T L+ LT+LIFH +D+ +L  L DDNQ IEPEWYAPIIPMVL+NG DGIGTG+++ I N+N  ++I+NL RM++G  P +M P +R FTGTI ++  N+YV  GE+  LD  TLEITELPIRVWT +YKESV+E   +G++K PA ITDYKEY+TD TVRF+++M+P K  EAE+ G HKFFKLQT ++  +M+ FD  G ++ Y N I I+  F+++RL  Y KRK YL G+LSA+A KL+NQARF+LEKI   ++ EN     LI  L  A YDSDPVKAW++S++K  A+ + EE       +Q +  ++ +PD+ Y+  M + +LT E+KD LL +RD K KEL I+++KSP  +W +DL+ LE+E   V  +         + ++    + +          K+ K+A ET P    RRI P ++ + +KK+    +K+ K   +  +   ++N         + EA D  N  NDE   LAQRL  +  ++  K    +G    +   T++  +    +   SP       GN +++ S  +   S +D GDS
Sbjct:   36 YQKKTQLEHILLRPDSYIGSTLKDTQQMWVLDESQQHMVNRDITFSPGLYKIFDEILVNAADNKVRDPTMSCIKIDINPAENMVRIWNDGKGIPVVHHKVENTYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWVDNMTKTSDPKILADKGEDFTCITFYPDLSRFGMNELEQDTVSLFTRRAYDMAATCNGIKVFLNGKRLPIKNFVDYVNLFIKPNKD-DADSVKVVYEAVNQRWQVAVAVS-NTGFQQVSFVNSIATTKGGTHINYVSDQIVNKLMDIVKKK--SGKSGVQIKPFQIKNHMWLFVNCLIENPTFDSQTKENMTLQIKSFGSTCTLSEKFIGQASKSGIVENVLSWIRFKAMEKMDKQCHKSKHSKLKGIPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESADTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVEEFITPIVKVFKGKQEHSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGIEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQRIEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGSNRYVCYGEVAVLDDDTLEITELPIRVWTQNYKESVLEPMLNGSEKVPACITDYKEYHTDVTVRFVIKMSPEKLREAESTGLHKFFKLQTVMSTGSMVCFDPLGCLKCYPNEIIIIREFYELRLTWYEKRKVYLEGVLSAEARKLENQARFVLEKIQSIMVIENKPKKELIRMLKEANYDSDPVKAWKESIDKAAALQEQEEARTDEAVSQTEAVEAGQPDYNYILNMPLWSLTKERKDDLLAQRDAKQKELLILKSKSPSDLWREDLKKLEEEYKKVEAELAADEQAAIEAADKKLKIASTTTAGRVAATKSRKLAMETRPDPMGRRIVPTVDADIMKKVEGNKKKRNKTENDPNEGNELDN---------SFEANDEENDGNDEPKPLAQRLGVSEKTDIQKTATTRGRGKGRTVPTSRPKLPKPSSPNNSPIKRKNMGGNAKRKRSSRMPWESGSDTGDS 1360          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A0X3PUD6 (DNA topoisomerase 2 OS=Schistocephalus solidus OX=70667 GN=TR96187 PE=3 SV=1)

HSP 1 Score: 1444.1 bits (3737), Expect = 0.000e+0
Identity = 715/1156 (61.85%), Postives = 889/1156 (76.90%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQ---------------EDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILE 3557
            Y KKTQLEHIL+RPD+Y+GS++     +W++D EK  M++K+ITY PGLYKIYDEILVNA+DNK+RD  M+CI+IDI    N+IRIWNNG GIPVV HR   + VP++IFG LLTS+N++D +K+VTGGRNG+GAKLCNIFS +F++ETS+KE+ K FKQTW  NM   S+P I++   EDFTC++FYPDL RF M+ L+ +T+ALF RRAYDIAA T G+ V LNG ++P+KNFKDYV+LY K+  +  E  + V+YE    RWEVA+  S N  F QVSFVNSIATTKGG H+++I+DQ A KL+++ KKK  S K  V +K  Q++ +MWVFV CLIENPSFDSQTKE MTL +K FGSTC L++KFI+QV++ GIVE +  W  FK Q  +DK+C K+KH KLK IPKLDDAN AGTKNS  CTLILTEGDSAK+LAV+GL+V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI N+IKI+GLQY  KYE PES+ TLRYGK+MIMTDQDQDGSHIKGLLI+FIH  WP LL HNF+E+FITPIVK FK  Q L+FYSIPE  EWQK T   + WR+KYYKGLGTSTSKEAK+YFSDM RH I+FRYSG ED  SI LAF+K K+D+RK WLT WM + KRR ELG+ E YLYG GT  IT+ +F+++ELILFSN DNERSIP L+DG KPGQRKVL+ CLKRNLVKE+KVAQL+GSVAE+S+YHHGEASLM TII LAQDFVGSNN+NLLMP+GQFGTRL+GGKD+ASPRYI T LS  T+ IF   D+A+L  L +DNQ IEP WY P+IPMVLING DGIGTGW +KIPN++  +VI NL+RMI+G  P+ M P +R+F G I E+ +N+YVV GEI  LD  T+EITELP+RVWT SYKE V+E+  +G++K PA I DYKEY+TD TVRF+V M P K  EAEA+G HKFFKL T +T ++M+LFD  G +++Y +  EIL+ FF++RLE Y KRK+YL G+LSA+A +L+NQARF+LEKI GK+  EN     LI  L    Y+ DPV AW++ ++KL AI+     ++               +    S   D+ Y+  M + +LT E+KD LL +RD+K  EL  + +KS +++W DDL+ LE
Sbjct:   30 YQKKTQLEHILIRPDTYIGSVERATTLMWLYDKEKQAMIQKEITYTPGLYKIYDEILVNAADNKVRDPSMNCIKIDIKAEDNLIRIWNNGAGIPVVHHRVEKMFVPSLIFGHLLTSSNYDDTEKKVTGGRNGFGAKLCNIFSRKFVVETSSKEHKKCFKQTWIDNMTKTSEPRITASAGEDFTCISFYPDLARFGMTELEADTVALFERRAYDIAASTRGVKVILNGVRVPIKNFKDYVDLYLKDKGEDGEA-VPVVYECVNPRWEVAVAAS-NLGFQQVSFVNSIATTKGGKHIDYISDQVANKLVDVVKKK--SGKSGVTVKSFQIRSHMWVFVNCLIENPSFDSQTKEFMTLQSKSFGSTCVLSEKFINQVSRSGIVENVLSWVRFKAQEKMDKQCHKSKHVKLKGIPKLDDANDAGTKNSAACTLILTEGDSAKTLAVAGLSVVGRDRYGVFPLRGKLLNVREASSKQIMENAEINNLIKILGLQYKNKYETPESVATLRYGKIMIMTDQDQDGSHIKGLLISFIHHNWPKLLHHNFLEEFITPIVKVFKGKQELAFYSIPEFEEWQKTTSNWHTWRVKYYKGLGTSTSKEAKDYFSDMTRHRIRFRYSGPEDDASITLAFNKNKSDDRKSWLTTWMNERKRRVELGLPEDYLYGSGTHAITYSDFVHKELILFSNMDNERSIPSLVDGLKPGQRKVLYTCLKRNLVKEIKVAQLSGSVAEMSSYHHGEASLMGTIIGLAQDFVGSNNLNLLMPHGQFGTRLSGGKDAASPRYIFTSLSPFTRKIFSERDDAILHYLFEDNQRIEPYWYIPVIPMVLINGADGIGTGWGTKIPNYDVMEVISNLRRMIDGADPLPMLPSFRDFRGVIQELGDNRYVVFGEIAILDEQTVEITELPVRVWTQSYKEGVLEVMLNGSEKVPASILDYKEYHTDATVRFVVRMTPEKLREAEAIGLHKFFKLSTAMTTNSMVLFDHMGCVKRYASVSEILKEFFELRLEWYNKRKSYLEGMLSAEARRLENQARFVLEKIQGKISIENRAKRDLIRLLKEHNYEPDPVHAWKECIDKLAAIEDARAASRAAGEGEEEDSEEQGGDASTSSAAADYNYILGMPLWSLTKERKDDLLAQRDKKQAELTELLSKSARRLWRDDLDELE 1181          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: G4VPA9 (DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183 GN=Smp_065840 PE=3 SV=1)

HSP 1 Score: 1443.71 bits (3736), Expect = 0.000e+0
Identity = 759/1338 (56.73%), Postives = 974/1338 (72.80%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEE------NQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQ---------DTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKG---DKPTKTNKTNILIEKNAKVSP-------GNKRKRDSGEIIELSDNDDGDS 4070
            Y KKTQLEHILLRPDSY+GS   + + +W+ D  +  MV + IT++PGLYKI+DEILVNA+DNK+RD  MSCI+IDIN  +NM+RIWN+GKGIPVV H+  N +VPT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +FI+ETS+KEY KSF+Q W  NM   SDP I + + EDFTC+TFYPDL RF M+ L+ +T++LF+RRAYD+AA  NGI V+LNG+++P+KNF DYV L+ K   D + + +KV+YE    RW+VA+  S N  F QVSFVNSIATTKGGTH+N+++DQ   KL++I KKK  S K  V++K  Q+K +MW+FV CLIENP+FDSQTKENMTL  K FGSTC L++KFI Q +K GIVE +  W  FK    +DK+C K+KH+KLK IPKLDDAN AGTKNS QCTLILTEGDSAK+LAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE  ++LK LRYGK+MIMTDQDQDGSHIKGL+INF+H  WPNLLKHN VE+FITPIVK FK  Q  SFYS+PE  EWQK TP  + WR+KYYKGLGTSTSKEAKEYFSDM RH I+FRYSG ED  SI LAF K+K  +RK WLTN+ ++ KRRRELG+ E YLYGK T+ IT+ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNL++E+KVAQLAGSVAELSAYHHGE SLMSTII LAQ+FVGSNN+NLL P GQFGTRL+GGKD+ASPRYI T L+ LT+LIFH +D+ +L  L DDNQ IEPEWYAPIIPMVL+NG DGIGTG+++ I N+N  ++I+NL RM++G  P +M P +R FTGTI ++  N+YV  GE+  LD  TLEITELPIRVWT +YKESV+E   +G++K PA ITDYKEY+TD TVRF+++M+P K  EAE+ G HKFFKLQT ++  +M+ FD  G ++ Y N I I+  F+++RL  Y KRK YL G+LSA+A KL+NQARF+LEKI   ++ EN     LI  L  A YDSDPVKAW++S++K  A+ + EE       +Q +  ++ +PD+ Y+  M + +LT E+KD LL +RD K KEL I+++KSP  +W +DL+ LE+E   V  +         + ++    + +          K+ K+A ET P    RRI P ++ + +KK+    +K+ K   +  +   ++N         + EA D  N  NDE   LAQRL  +  ++  K    +G    +   T++  +    +   SP       GN +++ S  +   S +D GDS
Sbjct:   36 YQKKTQLEHILLRPDSYIGSTLKDTQQMWVLDESQQHMVNRDITFSPGLYKIFDEILVNAADNKVRDPTMSCIKIDINPAENMVRIWNDGKGIPVVHHKVENTYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWVDNMTKTSDPKILADKGEDFTCITFYPDLSRFGMNELEQDTVSLFTRRAYDMAATCNGIKVFLNGKRLPIKNFVDYVNLFIKPNKD-DADSVKVVYEAVNQRWQVAVAVS-NTGFQQVSFVNSIATTKGGTHINYVSDQIVNKLMDIVKKK--SGKSGVQIKPFQIKNHMWLFVNCLIENPTFDSQTKENMTLQIKSFGSTCTLSEKFIGQASKSGIVENVLSWIRFKAMEKMDKQCHKSKHSKLKGIPKLDDANNAGTKNSSQCTLILTEGDSAKTLAVAGLGVVGRDNYGVFPLRGKLLNVREASNKQIMENAEINALIKILGLQYKLKYESADTLKDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVVEEFITPIVKVFKGKQEHSFYSLPEFEEWQKSTPNWHTWRVKYYKGLGTSTSKEAKEYFSDMNRHRIRFRYSGIEDDGSIQLAFDKSKIADRKNWLTNFTQERKRRRELGLPEPYLYGKDTRAITYHDFVHKELVLFSNLDNERSIPSVVDGLKPGQRKVLFTCLKRNLIREIKVAQLAGSVAELSAYHHGEQSLMSTIIGLAQNFVGSNNLNLLQPIGQFGTRLSGGKDAASPRYIFTALNSLTRLIFHLEDDPLLNYLYDDNQRIEPEWYAPIIPMVLVNGADGIGTGYATHILNYNVIEIINNLYRMLDGEEPHRMLPNFRGFTGTIEDLGSNRYVCYGEVAVLDDDTLEITELPIRVWTQNYKESVLEPMLNGSEKVPACITDYKEYHTDVTVRFVIKMSPEKLREAESTGLHKFFKLQTVMSTGSMVCFDPLGCLKCYPNEIIIIREFYELRLTWYEKRKVYLEGVLSAEARKLENQARFVLEKIQSIMVIENKPKKELIRMLKEANYDSDPVKAWKESIDKAAALQEQEEARTDEAVSQTEAVEAGQPDYNYILNMPLWSLTKERKDDLLAQRDAKQKELLILKSKSPSDLWREDLKKLEEEYKKVEAELAADEQAAIEAADKKLKIASTTTAGRVAATKSRKLAMETRPDPMGRRIVPTVDADIMKKVEGNKKKRNKTENDPNEGNELDN---------SFEANDEENDGNDEPKPLAQRLGVSEKTDIQKTATTRGRGKGRTVPTSRPKLPKPSSPNNSPIKRKNMGGNAKRKRSSRMPWESGSDTGDS 1360          
BLAST of DNA topoisomerase 2 vs. TrEMBL
Match: A0A5J4NZ25 (DNA topoisomerase 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0000844 PE=3 SV=1)

HSP 1 Score: 1434.85 bits (3713), Expect = 0.000e+0
Identity = 714/1209 (59.06%), Postives = 914/1209 (75.60%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDK----GEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEK---------EINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEE 3722
            Y KKTQLEHILLRPDSY+GS     +++W+ D EK CMV + IT++PGLYKI+DEILVNA+DNK+RD  MSCI++DI+  +NM++IWNNGKGIPVV H+  N++VPT+IFG LLTS+N++D +++VTGGRNGYGAKLCNIFS +FI+ETS+KEY KSF+Q W +NM   SDP +S  + EDFTCVTFYPDL+RF M+ L+ +T++LF RRAYD+AA TN + VYLNG+++P+K+F DYVELY K   D  E   K++YE    RW+VA+  S N  F QVSFVNSIATTKGG HV+++ +Q   KL+EI KKK  S K  V++K  Q++ +MW+FV CLIENP+FDSQTKENMTL +K FGSTC+L++KFI+Q AKCGIVE +  W  FK    +DK+C K KH KLK IPKLDDAN AGT++S  CTLILTEGDSAKSLAV+GL V+GRD YGVFPLRGKLLNVREA  KQ+ ENAEI  +IKI+GLQY  KYE P+SL+ LRYGK+MIMTDQDQDGSHIKGL+INFIH  WP+LLKHN +E+FITPIVK FK  + +SFYS+PE   WQK TP  + WR+KYYKGLGTS+ KEAKEYFSDM RH I+FRY+G ED  SI LAF ++K+ +RK WLTNW  + KRRRELG+ E YLYGK T+ I++ +F+++EL+LFSN DNERSIP ++DG KPGQRKVLF CLKRNLVKE+KVAQLAGSV+ELSAYHHGE SL+ TI+ LAQ+FVGSNN+NLL+P GQFGTRL+GGKD+AS RYI T LS LT+LIFH  D+A+L  L DDNQ IEPEWYAPI+PMVL+NG +GIGTG++++IPN++  ++I NL R+++G  P+ M P +R F GTI E+  N+YVV+G I  LD  T+EITELP+R WT +YKESV+E+  +G DK    ITDYKEY+TD TVRF+++M P K  +AE VG HKFFKL T LT ++M++FD  G ++ Y +   +L  FF +RL+ Y KRK+YL G+LSA+A KL+NQARF+LEKI  ++  EN     LI  L AA YDSDPV+AW++ ++KL  +++    G  +  E +E +  PD+ Y+  M + +L+ E+KD LL +RD K  EL  +R KS   +W +DL+ILE+          ++     D +E   +             K++K A ET P    RR+ P ++ E
Sbjct:   41 YQKKTQLEHILLRPDSYIGSTIKTTQSMWVMDEEKQCMVYRDITFSPGLYKIFDEILVNAADNKVRDATMSCIKVDIDPEQNMVKIWNNGKGIPVVHHKVENIYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETSSKEYKKSFRQVWIENMTKTSDPKVSVDKGEDFTCVTFYPDLQRFGMNELEADTVSLFVRRAYDLAATTNNVKVYLNGKRLPIKSFMDYVELYVKANKD-EESAPKIVYESNNARWQVAVAAS-NSGFQQVSFVNSIATTKGGKHVDYVAEQLNNKLIEIVKKK--SGKSGVQIKPFQIRNHMWLFVNCLIENPTFDSQTKENMTLQSKSFGSTCSLSEKFITQAAKCGIVESVLSWVRFKAMEKMDKQCHKAKHVKLKGIPKLDDANNAGTRSSSNCTLILTEGDSAKSLAVAGLGVVGRDNYGVFPLRGKLLNVREASSKQIMENAEINALIKILGLQYKLKYETPDSLRDLRYGKVMIMTDQDQDGSHIKGLIINFIHCNWPHLLKHNIIEEFITPIVKVFKGKEEISFYSLPEFEGWQKSTPNWHTWRVKYYKGLGTSSGKEAKEYFSDMVRHRIRFRYTGHEDDDSIQLAFDRSKSSDRKNWLTNWTAERKRRRELGLPEPYLYGKDTRAISYHDFVHRELVLFSNLDNERSIPSMVDGLKPGQRKVLFTCLKRNLVKEIKVAQLAGSVSELSAYHHGEQSLLGTIVGLAQNFVGSNNLNLLLPIGQFGTRLSGGKDAASARYIFTALSPLTRLIFHPADDALLNYLRDDNQRIEPEWYAPIVPMVLVNGAEGIGTGYATRIPNYDVLEIIANLNRLLDGEDPLPMLPSFRGFLGTIQELEANRYVVHGNIAVLDDETVEITELPVRTWTQTYKESVLEVMLNGTDKIQPCITDYKEYHTDTTVRFVIKMTPEKLRDAENVGLHKFFKLSTQLTTNSMVVFDHLGCLKHYQSVSSLLRDFFDLRLQWYEKRKSYLEGMLSAEARKLENQARFVLEKIQSQISIENKPRKELIRMLQAAHYDSDPVRAWKECLDKLATLEEELESGSADRSETVE-TGGPDYNYILGMPLWSLSKERKDDLLAQRDTKQNELRSLRAKSASMLWREDLKILEEAYKKFESELAVDEKVASDAAEKKVLKAATTGTGRTAAQKSLKRAQETKPDPNGRRVLPTVDPE 1244          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2b (DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GENE-041008-136])

HSP 1 Score: 1384.39 bits (3582), Expect = 0.000e+0
Identity = 704/1203 (58.52%), Postives = 887/1203 (73.73%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIE--------DSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQ--DTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD E   M  ++ITY PGLYKI+DEILVNA+DNK RD+ MS I+I I+   N + IWNNGKGIPVV H+D  ++VP +IFG LLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   SDP I     +DFTCVTF PDL +F M  LD + +AL +RRAYD+A    G+ V+LNG+++PV  F+ YV+LY K+ LD     LKV+ E   +RWEV +T S    F Q+SFVNSIATTKGG H++++ DQ   KL+E+ KKK K+       +V     ++WVFV  LIENP+FDSQTKENMTL  K FGS CAL++KFI     CGIVE I  W  FK Q  L+KKCS  KH+K+K IPKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESLK+LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+E+FITPIVKA KN Q + FYSIPE  EW+K T     W +KYYKGLGTSTSKEAKEYF+DMERH I F+Y G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  T+++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF C+KRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNN+N+L P GQFGTR+ GGKD+ASPRYI T LS L KL+F   D  +LK L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM++   P+ M P Y+NF G I E+ +N+YVV+GEI+ LD  T+EITELPIR WT +YKESV+E    G +KTPA I DYKEY+TD TV+F+V M   K A+AEA G HK FKLQ+ LT ++M+LFD  G +++Y +  +IL+ FF++RL  Y  RK++L+G L A+++KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW ++ EK L     EEE+++  E         S+ P+F Y+  M +  LT EK D LLK+RD K  EL+ ++ K  + +W +DL +  +E++ V  Q  +++  G+ V  +VK    K         ET PS F RR+EP+I
Sbjct:   54 YQKKTQLEHILLRPDTYIGSVEPVTQQMWVFDEEIG-MNLREITYVPGLYKIFDEILVNAADNKQRDKNMSSIKITIDPESNTVSIWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWQNNMTKTSDPKIKYFDGDDFTCVTFQPDLSKFKMEKLDKDIVALLTRRAYDVAGSCKGVKVFLNGKKLPVNGFRSYVDLYVKDKLDETGVALKVVNESVNERWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVSKLIEVVKKKNKAGVTVKPFQVKN---HIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCALSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEEFITPIVKASKNKQEIPFYSIPEFDEWKKQTENYKTWHIKYYKGLGTSTSKEAKEYFADMERHRIMFKYGGTEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEQYLYGTATRHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCMKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNVNILQPLGQFGTRINGGKDAASPRYIFTMLSPLAKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLDHQDPLPMLPSYKNFKGVIHELGQNQYVVSGEISVLDKNTIEITELPIRTWTQAYKESVLEPMLQGTEKTPALINDYKEYHTDTTVKFVVRMTEEKLAQAEAAGLHKVFKLQSSLTCNSMVLFDHMGCMKRYESVQDILKEFFELRLHYYKLRKDWLVGSLGAESAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQRGYESDPVAAWNRAQEKAL-----EEEDRDGNESDSSIDSGSSSGPNFNYILNMPLWCLTKEKVDELLKQRDLKKAELNELQRKCSEDLWREDLAVFVEELDRVEEQERESASQGKGVK-LVKGKVGKPKVKKIQLEETLPSPFGRRVEPQI 1245          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 676/1195 (56.57%), Postives = 865/1195 (72.38%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD +   NC   + IT+ PGLYKI+DEILVNA+DNK RD  M+CI+I+I+   N I +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+  E   SFKQTW  NM  A +  I     +D+TC+TF PDL +F M  LD +T+AL +RRAYDIA  + G+ V LNG ++ V  F+ YV+LY K+ +D     L V++E    RWEV +T S    F QVSFVNSIATTKGG H +++ DQ   KL+E+ KK+ K        +V     +MW+FV CLIENPSFDSQTKENMTL  K FGSTC L++KFI Q   CGIV+ I  W  FK Q  L+KKCS  KHTK+K +PKLDDAN AG K+S  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  P+SLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+K    NQ  SFYSIPE  EW++       W++KYYKGLGTSTSKEAKEYFSDM RH I FRYSG  D ++I LAFS+ K +ERK+WLT++M + ++RRE  + E YLYGK T  +T+ +F+N+EL+LFSN+DNERSIPCL+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ L              P GQFGTRL GGKDSASPRYI T LS L++L+F   D+ +LK   DDN  +EPEWY PIIP+VL+NG DGIGTGW+ K+PNF+ +++I+N+ RM+NG  P+ M P Y+ F GTI E+  N Y+++GE++ +D TT+EI+ELP++ WT SYKE+V+E+  +G+DK PA ITDY+EY+TD TVRF+V+M   +  EAEA G HK FKLQ+PLT ++M+LFD  G ++KY    +IL+ FF++RL+ Y+ RK +L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVK W+++ EK + ID GEE+ Q++ E ++ PD+ YL  M +  LT EKKD L K+RD KL EL+++  K+P  +W  DL    +E+  V   +     ++      K      K +K+  ET P+   RR+ P+I
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVEPLSQQMWVFDEDVGLNC---RDITFVPGLYKIFDEILVNAADNKQRDNSMNCIKINIDSENNTISVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTKFTVETACAESKYSFKQTWFDNMSRAGEAKIKPFSGDDYTCITFRPDLTKFKMQSLDRDTVALMTRRAYDIAGASKGVRVLLNGTKLSVNGFRSYVDLYLKDKVDETGTPLTVVHEVVNSRWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKRNKGGVAVKPFQVKN---HMWLFVNCLIENPSFDSQTKENMTLQQKSFGSTCLLSEKFIKQANTCGIVDSIMNWVKFKAQNQLNKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTIVGL--------------PLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDNVKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEELTSNHYLISGEVSIIDSTTIEISELPVKTWTQSYKENVLEVMLNGSDKVPALITDYREYHTDSTVRFVVKMTEERLIEAEAAGLHKVFKLQSPLTCTSMVLFDHVGSLKKYEFVQDILKDFFELRLKYYVLRKAWLVGMLGAESAKLSNQARFILEKIEGTLVIENKPKKELIRMLQEMGYDSDPVKVWKQAQEKEVEIDAGEEDEQKE-EQTSGPDYNYLLSMPMWYLTKEKKDELCKQRDAKLTELNMLEKKTPSDLWQADLAAFTEELERVEQAEKESQAKVTQV---KGKGGRTKVVKMKDETLPTPQGRRVIPRI 1202          
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1335.47 bits (3455), Expect = 0.000e+0
Identity = 676/1195 (56.57%), Postives = 865/1195 (72.38%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD +   NC   + IT+ PGLYKI+DEILVNA+DNK RD  M+CI+I+I+   N I +WNNGKGIPVV H+   V VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ET+  E   SFKQTW  NM  A +  I     +D+TC+TF PDL +F M  LD +T+AL +RRAYDIA  + G+ V LNG ++ V  F+ YV+LY K+ +D     L V++E    RWEV +T S    F QVSFVNSIATTKGG H +++ DQ   KL+E+ KK+ K        +V     +MW+FV CLIENPSFDSQTKENMTL  K FGSTC L++KFI Q   CGIV+ I  W  FK Q  L+KKCS  KHTK+K +PKLDDAN AG K+S  CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y  P+SLK+LRYGKLMIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+K    NQ  SFYSIPE  EW++       W++KYYKGLGTSTSKEAKEYFSDM RH I FRYSG  D ++I LAFS+ K +ERK+WLT++M + ++RRE  + E YLYGK T  +T+ +F+N+EL+LFSN+DNERSIPCL+DG KPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ L              P GQFGTRL GGKDSASPRYI T LS L++L+F   D+ +LK   DDN  +EPEWY PIIP+VL+NG DGIGTGW+ K+PNF+ +++I+N+ RM+NG  P+ M P Y+ F GTI E+  N Y+++GE++ +D TT+EI+ELP++ WT SYKE+V+E+  +G+DK PA ITDY+EY+TD TVRF+V+M   +  EAEA G HK FKLQ+PLT ++M+LFD  G ++KY    +IL+ FF++RL+ Y+ RK +L+G+L A+++KL NQARFILEKI G ++ EN     LI  L    YDSDPVK W+++ EK + ID GEE+ Q++ E ++ PD+ YL  M +  LT EKKD L K+RD KL EL+++  K+P  +W  DL    +E+  V   +     ++      K      K +K+  ET P+   RR+ P+I
Sbjct:   33 YQKKTQLEHILLRPDTYIGSVEPLSQQMWVFDEDVGLNC---RDITFVPGLYKIFDEILVNAADNKQRDNSMNCIKINIDSENNTISVWNNGKGIPVVEHKVEKVFVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTKFTVETACAESKYSFKQTWFDNMSRAGEAKIKPFSGDDYTCITFRPDLTKFKMQSLDRDTVALMTRRAYDIAGASKGVRVLLNGTKLSVNGFRSYVDLYLKDKVDETGTPLTVVHEVVNSRWEVCLTLS-EKGFQQVSFVNSIATTKGGRHTDYVADQIVSKLIEVVKKRNKGGVAVKPFQVKN---HMWLFVNCLIENPSFDSQTKENMTLQQKSFGSTCLLSEKFIKQANTCGIVDSIMNWVKFKAQNQLNKKCSAVKHTKIKGVPKLDDANDAGGKHSAGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIMGLQYRKNYSDPDSLKSLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSSKNQEFSFYSIPEFTEWKEKQNNIKSWKIKYYKGLGTSTSKEAKEYFSDMARHRIPFRYSGPADDEAITLAFSRKKIEERKDWLTSFMINRRQRREHNLPEEYLYGKETSSLTYHDFVNKELVLFSNSDNERSIPCLVDGLKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEISLMMTIVGL--------------PLGQFGTRLHGGKDSASPRYIFTMLSSLSRLLFPSVDDNLLKYNYDDNVKVEPEWYIPIIPLVLVNGGDGIGTGWACKLPNFDVREIINNIHRMLNGDEPLPMLPSYKGFKGTIEELTSNHYLISGEVSIIDSTTIEISELPVKTWTQSYKENVLEVMLNGSDKVPALITDYREYHTDSTVRFVVKMTEERLIEAEAAGLHKVFKLQSPLTCTSMVLFDHVGSLKKYEFVQDILKDFFELRLKYYVLRKAWLVGMLGAESAKLSNQARFILEKIEGTLVIENKPKKELIRMLQEMGYDSDPVKVWKQAQEKEVEIDAGEEDEQKE-EQTSGPDYNYLLSMPMWYLTKEKKDELCKQRDAKLTELNMLEKKTPSDLWQADLAAFTEELERVEQAEKESQAKVTQV---KGKGGRTKVVKMKDETLPTPQGRRVIPRI 1202          
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Match: top2a (DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GENE-030131-2453])

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 514/876 (58.68%), Postives = 660/876 (75.34%), Query Frame = 3
Query: 1125 NMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYK---GLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKS-VEKLLAIDKGEEENQEDIEDSNK---------PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKI 3713
            +MW+FV CL+ENP+FDSQTKENMTL  K FGSTC+L++KFI     CGIVE I  W  FK Q+ L++ CS  K +KL+ IPKLDDAN AG KNS +CTLILTEGDSAK+LAVSGL V+GRD+YG+FPLRGK+LNVREA  KQ+ ENAEI N+IKI+GLQY +KY+ PESLKTLRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+H F+E+FITPIVK  KN Q L FYS+PE  EW+  T     W++KYYK   GLGTSTSKEAKEYF+DM+RH I+FRYSG ED  +I LAFS+ K ++RKEWLTNWM D ++RRE G+ E +LYGK T Y+T+ +FIN+ELILFSN+DNERSIP L+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI++LAQ+FVGSNNIN+L P GQFGTRL GGKD+ASPRYI T +S + +L+F   D+ +LK L DDNQ +EPEWY PIIP+VL+NG DGIGTGW+S+IPNFNP+++I+N++R+++G  P+ M PWY+NF G+I E+  N+++ +GEI+ LD  T+EI+ELP+R WT +YKESV+E    G DKT   ITDYKEY+TD TVRF+++++  K  EAEA G HK FKLQ PLT ++M+LFD  G ++KY +  +IL  F++VRL+ Y  RK +L GIL A+++KL NQARFILEKI G V+ EN     LI  L A  YDSDP++AW+++ V+     +   +E+ +D E+S           PD+ Y+  M +  LT E+KD LL++RD K++EL+ ++ KSP  +W DDL +  +E++ V  ++  +    +        K G K++ + AE  PS   RRI P I
Sbjct:    4 HMWIFVNCLVENPTFDSQTKENMTLQHKKFGSTCSLSEKFIKTAMGCGIVESILNWVKFKAQSQLNQNCSAKKISKLRGIPKLDDANDAGGKNSQKCTLILTEGDSAKTLAVSGLGVVGRDHYGIFPLRGKMLNVREASYKQIMENAEINNLIKIVGLQYKKKYDDPESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLQHRFLEEFITPIVKVSKNKQELPFYSMPEFDEWKNETSNYKTWKIKYYKDMPGLGTSTSKEAKEYFADMKRHRIEFRYSGPEDDNAITLAFSRKKIEDRKEWLTNWMVDRRQRREQGLPESFLYGKQTAYLTYNDFINKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQSLMMTIVSLAQNFVGSNNINVLQPIGQFGTRLNGGKDAASPRYIFTMISTVARLLFPPVDDNLLKFLWDDNQRVEPEWYCPIIPLVLVNGADGIGTGWASRIPNFNPREIINNIRRLLDGEEPLPMLPWYKNFKGSIDELGPNQFMFSGEISILDSETIEISELPVRTWTQTYKESVLEPMLSGTDKTTPLITDYKEYHTDTTVRFIIKISREKLLEAEAAGLHKVFKLQAPLTCNSMVLFDHLGCLKKYESVADILREFYEVRLKYYSLRKEWLNGILGAESAKLSNQARFILEKIEGTVVIENKPKKELIRMLEARGYDSDPIRAWKEAQVKSNFEEEANSQEDSDDGEESGSATSSTPSSGPDYNYILNMALWCLTKERKDELLRQRDLKIQELEDLKCKSPCDLWKDDLAVFLEELDRVEAKERKDDTADMARGKGGQKKAGSKSLAMKAEVVPSPHGRRIVPVI 879          
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007762.1 (pep scaffold:Pmarinus_7.0:GL492656:1017:4077:-1 gene:ENSPMAG00000007010.1 transcript:ENSPMAT00000007762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 368.622 bits (945), Expect = 3.290e-116
Identity = 176/316 (55.70%), Postives = 230/316 (72.78%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKS 1082
            Y KKTQLEHILLRPD+Y+GS++P  + +W+FD E   M  + +TY PGL+KI+DEILVNA+DNK RD  M+CI++ I+   N I +WNNGKGIPVV H+   V+VP +IFGQLLTS+N++DD+K+VTGGRNGYGAKLCNIFS +F +ETS  E  K FKQ W  NM    D +I     EDFTC+TF PDL +FNM+ LD + +A+ +RRAYDIA    G+ V+LNGQ++P+  F+ YV+ Y K+ +D +   L V++E   +RWEV +T S    F QVSFVNSIATTKGG HV+++ DQ   KL+E  KKK K+
Sbjct:   32 YQKKTQLEHILLRPDTYIGSVEPVTQNMWVFD-EGIGMNCRDVTYVPGLFKIFDEILVNAADNKQRDPNMTCIKVTIDPENNKISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTQFTVETSCSESKKMFKQKWMNNMSKECDSVIKPSSGEDFTCITFQPDLTKFNMTILDKDIMAIMTRRAYDIAGICKGVKVFLNGQKLPLTGFRKYVDFYLKDRVDESGMPLHVVHEVVSNRWEVCLTIS-EKGFQQVSFVNSIATTKGGRHVDYVVDQVTSKLIETVKKKNKA 345          
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Match: TOP2 (Topoisomerase II; relieves torsional strain in DNA by cleaving and re-sealing phosphodiester backbone of both positively and negatively supercoiled DNA; cleaves complementary strands; localizes to axial cores in meiosis; required for replication slow zone (RSZ) breakage following Mec1p inactivation; human homolog TOP2A implicated in cancers, and can complement yeast null mutant [Source:SGD;Acc:S000005032])

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 526/1066 (49.34%), Postives = 724/1066 (67.92%), Query Frame = 3
Query:  132 RYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQK-EDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNC-----LDSNEEELK------VIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLK-HNFVEQFITPIVKAF---KNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKL 3281
            +Y K +QLEHIL RPD+Y+GS++ +E+  WI+D E +CM+EK +T  PGL+KI+DEILVNA+DNK+RD  M  I ++I+  ++ I + N+GKGIP+ +H   N+++P MIFG LLTS+N++DD+K+VTGGRNGYGAKLCNIFS EFILET++   G+ + Q W  NM +   P I+S +K   +T VTF PDL RF M  LD++ + +  RR YDI      I VYLNG+ + ++NFK+YVELY K+      LD+ E+         ++YE+  +RWEVA   S + +F Q+SFVNSIATT GGTHVN+ITDQ   K+ EI KKK K   ++ ++K      NM++F+ CLIENP+F SQTKE +T   KDFGS C +  ++I+++ K  +  ++   A   N+    KK   T+ +++ + PKL+DAN AGTK   +CTL+LTEGDSA SLAV+GLAV+GRDYYG +PLRGK+LNVREA   Q+ +NAEI  I KI+GLQ+ +KYE     K+LRYG LMIMTDQD DGSHIKGL+INF+ S +P LL    F+ +FITPI+K          ++FY++P+  +W++       W+ KYYKGLGTS ++E +EYFS+++RHL  F      D   I LAFSK KAD+RKEWL        R+ E G     +     K I   +FIN+ELILFS  DN RSIP ++DGFKPGQRKVL+ C K+NL  ELKVAQLA  V+E +AYHHGE SL  TII LAQ+FVGSNNI LL+PNG FGTR  GGKD+A+ RYI T+L+KLT+ IFH  D+ + K + +D +++EPEWY PI+PM+L+NG +GIGTGWS+ IP FNP ++I N++ ++N     +MHPW+R +TGTI E+   +Y + G I Q+    LEITELP R WT++ KE ++ +   GNDK   +I D +E + D  ++F++ ++P + A+   +GF++ FKL +P++L NM+ FD  G I+KYN+  EIL  F+ VRLE Y KRK+++   L  +  K   Q +FI   I  ++   N     +I +L
Sbjct:   11 KYQKISQLEHILKRPDTYIGSVETQEQLQWIYDEETDCMIEKNVTIVPGLFKIFDEILVNAADNKVRDPSMKRIDVNIHAEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADLNVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRDINVYLNGKSLKIRNFKNYVELYLKSLEKKRQLDNGEDGAAKSDIPTILYERINNRWEVAFAVS-DISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKKKKKSVKSFQIKN-----NMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIAD-ANEENALKKSDGTRKSRITNYPKLEDANKAGTKEGYKCTLVLTEGDSALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYE---DTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDIQGFLLEFITPIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKGLGTSLAQEVREYFSNLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWL--------RQYEPGT----VLDPTLKEIPISDFINKELILFSLADNIRSIPNVLDGFKPGQRKVLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLAQNFVGSNNIYLLLPNGAFGTRATGGKDAAAARYIYTELNKLTRKIFHPADDPLYKYIQEDEKTVEPEWYLPILPMILVNGAEGIGTGWSTYIPPFNPLEIIKNIRHLMNDEELEQMHPWFRGWTGTIEEIEPLRYRMYGRIEQIGDNVLEITELPARTWTSTIKEYLL-LGLSGNDKIKPWIKDMEEQHDD-NIKFIITLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNSVNEILSEFYYVRLEYYQKRKDHMSERLQWEVEKYSFQVKFIKMIIEKELTVTNKPRNAIIQEL 1052          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44813 (DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:A7RUU5])

HSP 1 Score: 546.199 bits (1406), Expect = 7.505e-180
Identity = 279/480 (58.13%), Postives = 361/480 (75.21%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISS-CQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELK------VIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQL 1553
            Y KKTQLEHILLRPD+Y+GS++P ++ ++++D     +V ++ITY PGL+KI+DEILVNA+DNK RD  MS I+I+IN  KN I +WN+G+GIP+ MH++  V+VPTMIFGQLLTS+N+NDD+K+VTGGRNGYGAKLCNIFS +F +ET+  E  K FKQ WT NMG A++P+I      +++TC+TF PDL++F M  LD +T+AL +RRAYDIAA   G+ V LNG+++ VK FKDYV+L  K      EE+ +      V++E   +RWEV +T S +  F Q SFVNSIATTKGGTHVN++TDQ   KL+ + KKK K        ++     ++WVF+ CLIENP+FDSQTKENMTL AKDFGS C L+DKFI  V   G++E +  W  FK +A L+KKCS +KH+K++ IPKLDDAN AG KNS  CTLILTEGDSAK+LA+SGL+++GRD YGVFPLRGKLLNVREA  KQ+
Sbjct:   41 YTKKTQLEHILLRPDTYIGSVEPNKQNMFVYDDILEAIVNREITYVPGLFKIFDEILVNAADNKQRDPAMSTIKIEINPEKNFISVWNDGRGIPIEMHKEHQVYVPTMIFGQLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSKKFSVETACLENKKRFKQVWTNNMGKAAEPVIKEFTSNKEYTCITFQPDLEKFKMETLDRDTVALLTRRAYDIAASVRGVSVILNGKKLKVKTFKDYVQLCLKGATKDKEEDDEEEKKPTVVHEVVNNRWEVCVTVS-DKGFQQASFVNSIATTKGGTHVNYVTDQIVDKLMTVIKKKNKGGLAIKPFQIKS---HLWVFINCLIENPAFDSQTKENMTLRAKDFGSKCELSDKFIKAVQNSGVMENVMNWMRFKEKAQLNKKCSGSKHSKIRGIPKLDDANDAGGKNSRHCTLILTEGDSAKTLAISGLSIVGRDRYGVFPLRGKLLNVREASHKQV 516          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44811 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU3])

HSP 1 Score: 349.747 bits (896), Expect = 1.536e-108
Identity = 185/370 (50.00%), Postives = 252/370 (68.11%), Query Frame = 3
Query: 2478 LSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNK----PDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVV 3575
            LS ++K++F   DE  LK L +DNQ IEPEWY PIIP +L+NG +GIGTG+S+K+PN++P+ + +N+++M+NG  P +M PWY+NF GTI +V + KY V G I  +D TTLEITELPI  WT SYKESV+E   HG DK P  ITDYKEY+T+  VRF++ M   K  EAE VG HK FKL+  +  SNM+LFD  G ++KY+   EIL+ FF +R+E YI RK Y+ G+L+A++ KL +QARFILEKI G ++ EN     LI  LV   Y SDPVKAW+ S +  L +D  +++    +  +      PDF YL  M + +L+ EKKD LLK+RD+K  EL+ +R KSP+ +W +DL+I   E+  V
Sbjct:    2 LSTVSKMLFPPSDEPNLKFLNEDNQRIEPEWYCPIIPTILVNGAEGIGTGYSTKVPNYDPRAIAENIRKMMNGEEPEEMLPWYKNFIGTITKVDDTKYSVTGNIEVIDDTTLEITELPIGTWTQSYKESVLEPMLHGTDKVPPCITDYKEYHTETRVRFVITMAENKMREAEQVGLHKKFKLEATINTSNMVLFDAMGCLKKYDTTREILKEFFTLRMERYIMRKAYMEGMLTAESGKLNSQARFILEKIEGTIVIENKPKRDLITMLVQRGYPSDPVKAWKDSQDTTLGVDDSDDDTMSTVSSTASGAGGPDFNYLLNMSMWSLSQEKKDELLKQRDQKAAELEDLRKKSPKDLWNEDLDIFLAELEAV 371          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO29547 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3B9])

HSP 1 Score: 231.876 bits (590), Expect = 4.711e-70
Identity = 109/170 (64.12%), Postives = 133/170 (78.24%), Query Frame = 3
Query: 1833 LVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASL 2342
            + EW+  T     W++KYYKGLGTST KEAKEYFSDMERH I F+Y G  D ++IV+AFSK K  ERK+WLT  +E+ K RRE G+ E+YLY K TK +++ +F+N+ELILFSNTDNERSIP L+DG KPGQRKV+F C KRN  +E+KVAQLAGS+AELSAYHHGE   
Sbjct:    1 MEEWKAGTANHKSWKVKYYKGLGTSTPKEAKEYFSDMERHKINFKYEGPHDDEAIVMAFSKKKIQERKDWLTRGLEERKWRREQGLSELYLYEKDTKRVSYCDFVNKELILFSNTDNERSIPSLVDGLKPGQRKVMFTCFKRNDKREVKVAQLAGSIAELSAYHHGEVGF 170          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO44812 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUU4])

HSP 1 Score: 159.844 bits (403), Expect = 1.150e-45
Identity = 76/113 (67.26%), Postives = 87/113 (76.99%), Query Frame = 3
Query: 1557 ENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKG 1895
            +NAEI NIIKI GLQY++KY+  + LK+LRYG LMIMTDQDQDGSHIKGL+INFIHS WP LLK  FVEQFITPIVK  K  +  SFYSIPE  EW+        W++KYYKG
Sbjct:    2 DNAEINNIIKITGLQYNKKYKSEDDLKSLRYGHLMIMTDQDQDGSHIKGLVINFIHSNWPGLLKLGFVEQFITPIVKVSKGKEEHSFYSIPEYEEWKAGNANHKSWKVKYYKG 114          
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Match: EDO25698 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVR1])

HSP 1 Score: 79.7221 bits (195), Expect = 5.191e-16
Identity = 57/178 (32.02%), Postives = 91/178 (51.12%), Query Frame = 3
Query: 1401 NSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPES--LKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFY---SIPELVEWQKVTPGANQWRLKYYKGLGTSTSKE 1919
            +  QC + L EGDSA   A  G     R++  + PLRGK+LNV +A   ++ EN EI N+   +G+    + E P +  L  +RY K++IM D D DGSHI  L++ F       +++  +V    TP +   K  Q   +    +  +L+  QK+  G     ++ YKGLG   +++
Sbjct:   59 DPAQCEIFLVEGDSAGGTAKQGR---DRNFQAILPLRGKILNVEKAMQHKVFENEEIKNMFTALGVSIGTE-EDPRALNLSKVRYHKVVIMCDADVDGSHIATLILTFFFRYMREMIEQGYV-YIATPPLYLVKKGQKREYAWDDNQRDLIA-QKMGGGVT---IQRYKGLGEMNAEQ 227          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 1390.17 bits (3597), Expect = 0.000e+0
Identity = 708/1201 (58.95%), Postives = 886/1201 (73.77%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQE-----DIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIE 3716
            Y KKT LEHILLRPD+YVGS++P  + +W+FD E   M +++ITY PGLYKI+DEILVNA+DNK RD+ MS I+I I+   N I IWNNGKGIPVV H+D  ++VP +IFG LLTS+N++D++K+VTGGRNGYGAKLCNIFS +F +ET+ KEY  SFKQTW  NM   S+P I     +DFTCVTF PDL +F M  LD +T+AL +RRAYD+A    G+ V LNG+++PV  F+ YV+LY K  LD     LKV+ E   DRWEV +T S    F Q+SFVNSIATTKGG H++++ DQ   K++E+ KKK K+       +V     ++WVFV  LIENP+FDSQTKENMTL  K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KH+K+K IPKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESL++LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+EQFITPIVKA KN Q LSFYS+PE  EW+K T     W +KYYKGLGTSTSKEAKEYF+DMERH I FRY G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  TK++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF CLKRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNIN+L P GQFGTR+ GGKD+ASPRYI T LS LTKL+F   D  +LK L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELP+R WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEAVG HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K+ EK  A ++GE +  +     D   S+ P+F Y+  M +  LT EK + LLK+RD K  EL  ++ KS + +W +DL +  +E++ V  Q+  E   G  +  +VK    K         ET PS F RR++P  +
Sbjct:   44 YQKKTPLEHILLRPDTYVGSVEPVSQPMWVFD-EDVGMNQREITYVPGLYKIFDEILVNAADNKQRDKNMSAIKITIDPESNTITIWNNGKGIPVVEHKDEKMYVPALIFGHLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTKFTVETACKEYRHSFKQTWQNNMTKTSEPKIRFFDGDDFTCVTFQPDLAKFKMEKLDRDTVALMTRRAYDVAGSCRGVKVTLNGKKLPVNGFRSYVDLYVKEKLDETGVPLKVVNEMVNDRWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVAKIIEVVKKKNKAGVTVKPFQVKN---HIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCVLSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQTKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEK--AQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDNVEAQEREEQSAGRAIK-LVKGKVGKPKAKKMNLEETMPSPFGRRVDPPTQ 1236          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2a (DNA topoisomerase II alpha [Source:NCBI gene;Acc:101158729])

HSP 1 Score: 1370.91 bits (3547), Expect = 0.000e+0
Identity = 714/1307 (54.63%), Postives = 932/1307 (71.31%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAW---QKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQ---DTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSG 4031
            Y KKTQLEHILLRPDSY+GS++P  + +W++D +   NC   + +T+ PGLYKI+DEILVNA+DNK RD+ MSCI+++I+   N I +WNNGKGIPVV H+   V+VP +IFGQLLTS+N++D++K+VTGGRNGYGAKLCNIFS +F +ET+ KE  K+FKQTW  NMG A D  I +   E+FTC+TF PDL +F MS LD +T+AL +RRAYD+A  + G+ V+ NG+++P+  F+ YV++Y K+ +D     L VI+E   +RWEV +T S    F QVSFVNSIATTKGG H++++ DQ   +L+E+ KKK K+       +V     +MW+FV CL+ENP+FDSQTKENMTL  K FGSTC+L+DKF  Q   CGIVE I  W  FK Q  L+KKCS  KHTK+K +PKLDDAN AG KNS+ CTLILTEGDSAK+LAVSGL V+GRD YGVFPLRGK+LNVREA  KQ+ ENAEI N+IKI+GLQY + Y  PESLK+LRYGK+MIMTDQDQDGSHIKGLLINFIH  WP+LL+HNF+E+FITPI+KA      LSFYSIPE   W++       W++KYYKGLGTSTS+EAKEYFSDMERH I F+YSG ED ++I LAFSK K +ERKEWLTN+M + ++RRE  + E YLYG+ TK +++ +FIN+EL+LFSN+DNERSIPCL+DGFKPGQRKVLF C KRN  +E+KVAQLAGSVAE+SAYHHGE SLM TI+ LAQ+FVGSNN+NLL P GQFGTRL GGKDSASPRYI T LS L +L+F   D+ +LK   DDNQ +EPEWY PIIP VL+NG +GIGTGW+SKIPN++ ++++ N+ RM++G  P+ M P Y+ F GTI +V  N+Y+ +GE+  +D TT+EI+ELP++ WT +YKE+V+E   +G DK PA ITDYKEY+TD TVRF+V+M   K  EAEA G HK FKLQ+PLT ++M+LFD  G ++KY +  +IL+ FF +R++ Y+ RK +L+G+L A++SKL NQARFILEKI G ++ EN     LI  L    YDSDPV+AW   QK  E  +  ++ +EE  E  + S+  D+ YL  M +  LT EKK+ L K+RD K+ EL+ ++ KSP  +W +DL    +E+  +  +   D S P +           KG K +K+  ET P+   RR+ P++      + + + E KK      K+ +  E+ V +   G   E    N E  EE  LA RL K   ++  + L  KG + T    T   + K  K +P +  + ++G
Sbjct:   30 YQKKTQLEHILLRPDSYIGSVEPVTQQMWVYDVDVGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDKSMSCIKVNIDVENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDEQKKVTGGRNGYGAKLCNIFSTKFTVETACKESRKTFKQTWYDNMGRAGDTNIKAFDGEEFTCITFKPDLSKFKMSTLDKDTVALMTRRAYDVAGSSKGVKVFFNGKRLPITGFRSYVDMYVKDKVDELGGPLTVIHEAVNERWEVCLTMS-EKGFQQVSFVNSIATTKGGRHIDYVADQIVGRLIEVVKKKNKAGVAVKPFQVKN---HMWLFVNCLVENPTFDSQTKENMTLQQKSFGSTCSLSDKFFKQATSCGIVESIMNWVKFKAQTQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGVVGRDRYGVFPLRGKMLNVREASHKQIMENAEINNVIKILGLQYKKNYSDPESLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASNKKNQLSFYSIPEFNAWKETQSNHKSWKIKYYKGLGTSTSQEAKEYFSDMERHRIPFKYSGPEDDEAISLAFSKKKVEERKEWLTNFMVNRRQRREHNLPEDYLYGQSTKSLSYNDFINKELVLFSNSDNERSIPCLVDGFKPGQRKVLFCCFKRNDKREVKVAQLAGSVAEMSAYHHGEVSLMMTIVGLAQNFVGSNNLNLLQPLGQFGTRLHGGKDSASPRYIFTMLSPLARLVFPPVDDNLLKYNYDDNQRVEPEWYIPIIPTVLVNGAEGIGTGWASKIPNYDIREIVSNIHRMLDGEEPLPMLPNYKGFRGTIDQVMSNQYMNSGEVAIIDSTTIEISELPVKTWTQAYKENVLEPMLNGTDKVPALITDYKEYHTDATVRFVVKMTEEKLMEAEAAGLHKVFKLQSPLTCNSMVLFDYAGSLKKYESVQDILKDFFDLRMKYYVLRKEWLVGMLGAESSKLSNQARFILEKIQGTLVIENKPKKELIRMLQEMGYDSDPVRAWKEAQKKDEDDMEAEEEQEEGAEREDQSSGADYNYLLSMPMWFLTKEKKEDLCKQRDAKMTELNTLKGKSPADLWKEDLAAFSEELERLEQKEKDDASAPAK--------RPAKGKKPMKVKQETLPTPQGRRVIPRVTSTMKAEAHKKAELKKGEGRRGKKVKS-EDVVVKMEFGEECE----NLEQIEETGLAARLGKKTKTQTKRALSSKGKQTTLQFST---VSKKPKKNPWSDEESEAG 1313          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 1176 bits (3041), Expect = 0.000e+0
Identity = 606/1042 (58.16%), Postives = 757/1042 (72.65%), Query Frame = 3
Query:  612 QTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQE-----DIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSE--PGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIE 3716
            QTW  NM   S+P I     +DFTCVTF PDL +F M  LD +T+AL +RRAYD+A    G+ V LNG+++PV  F+ YV+LY K  LD     LKV+ E   DRWEV +T S    F Q+SFVNSIATTKGG H++++ DQ   K++E+ KKK K+       +V     ++WVFV  LIENP+FDSQTKENMTL  K FGS C L++KFI     CGIVE I  W  FK Q  L+KKCS  KH+K+K IPKLDDAN AG K+S +CTLILTEGDSAKSLAVSGL VIGRD YGVFPLRGK+LNVREA  KQ+ ENAEI NIIKI+GLQY + Y+ PESL++LRYGK+MIMTDQDQDGSHIKGLLINF H  WP+LLKH F+EQFITPIVKA KN Q LSFYS+PE  EW+K T     W +KYYKGLGTSTSKEAKEYF+DMERH I FRY G ED  +I LAFSK K D+RKEWLTN+MED ++RR  G+ E YLYG  TK++++ +FIN+ELILFSN+DNERSIP L+DG KPGQRKVLF CLKRN  +E+KVAQLAGSVAE+SAYHHGE +LM TI+NLAQ+FVGSNNIN+L P GQFGTR+ GGKD+ASPRYI T LS LTKL+F   D  +LK L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELP+R WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEAVG HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K+ EK  A ++GE +  +     D   S+ P+F Y+  M +  LT EK + LLK+RD K  EL  ++ KS + +W +DL +  +E++ V  Q+  E   G  +  +VK    K         ET PS F RR++P  +
Sbjct:  123 QTWQNNMTKTSEPKIRFFDGDDFTCVTFQPDLAKFKMEKLDRDTVALMTRRAYDVAGSCRGVKVTLNGKKLPVNGFRSYVDLYVKEKLDETGVPLKVVNEMVNDRWEVCLTMS-EKGFQQISFVNSIATTKGGRHIDYVVDQIVAKIIEVVKKKNKAGVTVKPFQVKN---HIWVFVNALIENPTFDSQTKENMTLQTKSFGSKCVLSEKFIRAATNCGIVESILNWVKFKAQTQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSSECTLILTEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREATHKQIMENAEINNIIKIVGLQYKKSYDDPESLRSLRYGKIMIMTDQDQDGSHIKGLLINFFHHNWPSLLKHTFLEQFITPIVKATKNKQELSFYSLPEFEEWKKQTDNYKSWHVKYYKGLGTSTSKEAKEYFADMERHRITFRYQGAEDDAAITLAFSKKKTDDRKEWLTNFMEDRRQRRMHGLPEKYLYGTQTKHLSYNDFINKELILFSNSDNERSIPSLVDGLKPGQRKVLFTCLKRNDKREVKVAQLAGSVAEMSAYHHGEQALMMTIVNLAQNFVGSNNINILQPLGQFGTRINGGKDAASPRYIFTMLSPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEK--AQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDNVEAQEREEQSAGRAIK-LVKGKVGKPKAKKMNLEETMPSPFGRRVDPPTQ 1157          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2b (DNA topoisomerase II beta [Source:NCBI gene;Acc:101157229])

HSP 1 Score: 351.288 bits (900), Expect = 7.900e-109
Identity = 186/372 (50.00%), Postives = 261/372 (70.16%), Query Frame = 3
Query: 2481 SKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQE-----DIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYN 3581
            S LTKL+F   D  +LK L DDNQ +EPEWY PIIPMVL+NG +GIGTGW+ KIPN++P+++++N+ RM+N   P+ M P Y+NF G I E+ +N+Y+V+GE++ LD  T+EITELP+R WT +YKESV+E    G DKTPA I DYKEY+TD TV+F+V M+  K A+AEAVG HK FKLQ+ LT ++M+LFD  G +++Y++  +IL+ FF++RL     RK++LLG L A+A+KL NQARF+LEKI GK+  EN     LI  LV   Y+SDPV AW K+ EK  A ++GE +  +     D   S+ P+F Y+  M +  LT EK + LLK+RD K  EL  ++ KS + +W +DL +  +E++V ++
Sbjct:    5 SPLTKLLFPAVDSNLLKFLYDDNQKVEPEWYIPIIPMVLVNGAEGIGTGWACKIPNYDPREIVNNINRMLNHQDPLPMLPSYKNFKGVIHELGQNQYLVSGEVSVLDKNTIEITELPVRTWTQAYKESVLEPMLQGTDKTPALINDYKEYHTDSTVKFVVRMSEEKLAQAEAVGLHKVFKLQSSLTCNSMVLFDHMGCLKRYDSVQDILKEFFELRLHYCKLRKDWLLGSLGAEAAKLSNQARFVLEKIEGKISIENKSKRELIRMLVQKGYESDPVAAWSKAQEK--AQEEGETDGNQSDSSVDSGSSSGPNFNYILNMPLWCLTKEKVEELLKQRDIKRGELADLQKKSSEDLWKEDLAVFIEELDVSFS 374          
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Match: top2a (DNA topoisomerase II alpha [Source:NCBI gene;Acc:101158729])

HSP 1 Score: 253.447 bits (646), Expect = 3.003e-76
Identity = 118/194 (60.82%), Postives = 153/194 (78.87%), Query Frame = 3
Query:  135 YLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEK--NCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLK 710
            Y KKTQLEHILLRPDSY+GS++P  + +W++D +   NC   + +T+ PGLYKI+DEILVNA+DNK RD+ MSCI+++I+   N I +WNNGKGIPVV H+   V+VP +IFGQLLTS+N++D++K+VTGGRNGYGAKLCNIFS +F +ET+ KE  K+FKQTW  NMG A D  I +   E+FTC+TF PDLK
Sbjct:   24 YQKKTQLEHILLRPDSYIGSVEPVTQQMWVYDVDVGLNC---RDVTFVPGLYKIFDEILVNAADNKQRDKSMSCIKVNIDVENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDEQKKVTGGRNGYGAKLCNIFSTKFTVETACKESRKTFKQTWYDNMGRAGDTNIKAFDGEEFTCITFKPDLK 214          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037559.1 (SMESG000037559.1)

HSP 1 Score: 2337.38 bits (6056), Expect = 0.000e+0
Identity = 1288/1435 (89.76%), Postives = 1341/1435 (93.45%), Query Frame = 3
Query:  129 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQK-SVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTNHSDDSSEGAVRKERSKRKAAIKTY 4430
            K Y KKTQLEHILLRPDSYVGSIK E+K +W+FD EKN MVEK+ITYNP LYKI+DEILVNASDNKIRD KM+ IRIDI+   NM+RIWNNG+GIPV +H++  V++PTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFS+EF+LETS+KEYGKSFKQTW+ NM    DP IS   KEDFTCVTFYPDLKRF+M+ LD++ +ALFSRRAYDIAACT GI V+LNG+QI VK FKDYV+LYTK+ LD+NEE LKV+YE +G RWEVA+TTS+N+ F QVSFVNSIATTKGGTHVN++ DQ A K+LE AKKKIK DKQAVKLK AQVKMNMW+FV+CLIENPSFDSQTKENMTLN KDFGS C L +KFIS VAKCGIVEK+TMW +FKNQALLDKKCSKTK TKLKD+PKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPL+GKLLNVREA  KQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTST KEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAG                  K+  H    AVLK LLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEA GFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKING +ICENVKIAVLIDKLVAAKYDSDPVKAW K +  KL      +EE++E IEDS KPDFGYLTQMQILTLTAEKK+ALLKERDEKL+EL  I+NKSP+QMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIEKPKTMKPKTDKPKPQKKDAAPKDKKEAAPKMTKKPAAPKKKEI ENTNHSDDSSEGAVRKERSKRKAAIKTY
Sbjct:   20 KLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGA-----------------KIALHLVTYAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGIIICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIEKPKTMKPKTDKPKPQKKDAAPKDKKEAAPKMTKKPAAPKKKEIVENTNHSDDSSEGAVRKERSKRKAAIKTY 1437          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037559.1 (SMESG000037559.1)

HSP 1 Score: 2321.2 bits (6014), Expect = 0.000e+0
Identity = 1281/1435 (89.27%), Postives = 1334/1435 (92.96%), Query Frame = 3
Query:  129 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQK-SVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTNHSDDSSEGAVRKERSKRKAAIKTY 4430
            K Y KKTQLEHILLRPDSYVGSIK E+K +W+FD EKN MVEK+ITYNP LYKI+DEILVNASDNKIRD KM+ IRIDI+   NM+RIWNNG+GIPV +H++  V++PTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFS+EF+LETS+KEYGKSFKQTW+ NM    DP IS   KEDFTCVTFYPDLKRF+M+ LD++ +ALFSRRAYDIAACT GI V+LNG+QI VK FKDYV+LYTK+ LD+NEE LKV+YE +G RWEVA+TTS+N+ F QVSFVNSIATTKGGTHVN++ DQ A K+LE AKKKIK DKQAVKLK AQVKMNMW+FV+CLIENPSFDSQTKENMTLN KDFGS C L +KFIS VAKCGIVEK+TMW +FKNQALLDKKCSKTK TKLKD+PKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPL+GKLLNVREA  KQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTST KEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASL+                               GKDSASPRYICTQLSKLTKLIFHHDDEAVLK LLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEA GFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKING +ICENVKIAVLIDKLVAAKYDSDPVKAW K +  KL      +EE++E IEDS KPDFGYLTQMQILTLTAEKK+ALLKERDEKL+EL  I+NKSP+QMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIEKPKTMKPKTDKPKPQKKDAAPKDKKEAAPKMTKKPAAPKKKEI ENTNHSDDSSEGAVRKERSKRKAAIKTY
Sbjct:   20 KLYQKKTQLEHILLRPDSYVGSIKKEDKLMWVFDDEKNEMVEKKITYNPALYKIFDEILVNASDNKIRDSKMTTIRIDIDSKMNMVRIWNNGRGIPVTIHKEHQVYIPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSSEFVLETSSKEYGKSFKQTWSNNMNDCFDPEISKAAKEDFTCVTFYPDLKRFSMTRLDEDIVALFSRRAYDIAACTQGITVFLNGKQINVKTFKDYVDLYTKHVLDANEEPLKVVYESYGKRWEVAVTTSVNETFSQVSFVNSIATTKGGTHVNYLADQLAAKILEKAKKKIKDDKQAVKLKPAQVKMNMWIFVRCLIENPSFDSQTKENMTLNQKDFGSECTLNEKFISLVAKCGIVEKLTMWTLFKNQALLDKKCSKTKQTKLKDMPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLKGKLLNVREASAKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTDKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLI------------------------------WGKDSASPRYICTQLSKLTKLIFHHDDEAVLKYLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGIIICENVKIAVLIDKLVAAKYDSDPVKAWMKFNANKLTIEKAEDEEDEEAIEDSGKPDFGYLTQMQILTLTAEKKEALLKERDEKLEELMRIKNKSPEQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGTNAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILIEKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLFKNIKFPQKQSKLLVENKDKPVAKKAKIEKPKTMKPKTDKPKPQKKDAAPKDKKEAAPKMTKKPAAPKKKEIVENTNHSDDSSEGAVRKERSKRKAAIKTY 1424          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2295.39 bits (5947), Expect = 0.000e+0
Identity = 1205/1302 (92.55%), Postives = 1223/1302 (93.93%), Query Frame = 3
Query:  129 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKGDKP--TKTNKTNILIEKNAKVSPGNKRKRD 4025
            KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEK+ITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMH+DVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQ+ TP +N+WRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQL                            +WYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEA GFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKK+  ETEKKKK  E KKQ ++I   V          + DN +S + EE  LAQRL+  + +EAFK L+ K  KP  TK        +K    SP  KRKR+
Sbjct:   17 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQL----------------------------KWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQII---VKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRN 1287          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2278.83 bits (5904), Expect = 0.000e+0
Identity = 1202/1303 (92.25%), Postives = 1225/1303 (94.01%), Query Frame = 3
Query:  129 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVL-INGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKGDKP--TKTNKTNILIEKNAKVSPGNKRKRD 4025
            KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEK+ITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMH+DVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQ+ TP +N+WRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK                I  M + ++  +G+   +  KIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEA GFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKK+  ETEKKKK  E KKQ ++I   V          + DN +S + EE  LAQRL+  + +EAFK L+ K  KP  TK        +K    SP  KRKR+
Sbjct:   17 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK----------------ICWMTINLSNQNGMHQLFRCKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQII---VKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRN 1300          
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Match: SMESG000037565.1 (SMESG000037565.1)

HSP 1 Score: 2248.78 bits (5826), Expect = 0.000e+0
Identity = 1193/1302 (91.63%), Postives = 1212/1302 (93.09%), Query Frame = 3
Query:  129 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDXXXXXXXXXXXXMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALXXXXXXXXXXXXXXXIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGWSSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAXXXXXXXXXXXXXXXXXXIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVXXXXXXXXXXXXXXXETAPSKFSRRIEPKIEEEYXXXXXXXXXXXXXXXXXXXXXXMIENFVTRESTGTNAEAGDN-NSENDEELTLAQRLAKTHGSEAFKGLIGKGDKP--TKTNKTNILIEKNAKVSPGNKRKRD 4025
            KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEK+ITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMH+DVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQ+ TP +N+WRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK                 I  + IN            + N N     DNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEA GFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKK+  ETEKKKK  E KKQ ++I   V          + DN +S + EE  LAQRL+  + +EAFK L+ K  KP  TK        +K    SP  KRKR+
Sbjct:   17 KRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFDSEKNCMVEKRITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKNMIRIWNNGKGIPVVMHKDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNGYGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDFTCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPVKNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSFVNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNMWVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEKITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILTEGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNIIKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSKWPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQRNTPDSNKWRLKYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADERKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTDNERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHGEASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQLSKLTKLIFHHDDEAVLK-----------------ICWMTIN------------LSNQN-----DNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVNGEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEYNTDKTVRFLVEMNPAKYAEAEAAGFHKFFKLQTPLTLSNMILFDECGVIRKYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKINGKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQEDIEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQMWLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAPSKFSRRIEPKIEEEYLKKLTTETEKKKKKTETKKQNQII---VKENGDIVTTNSRDNIDSVDYEEAPLAQRLSNANSNEAFKDLVRKIKKPVTTKELNKLKSNKKKNSTSPNKKRKRN 1281          
The following BLAST results are available for this feature:
BLAST of DNA topoisomerase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP2B0.000e+058.37DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2B0.000e+058.37DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2A0.000e+059.36DNA topoisomerase II alpha [Source:HGNC Symbol;Acc... [more]
TOP2B0.000e+060.63DNA topoisomerase II beta [Source:HGNC Symbol;Acc:... [more]
TOP2A5.187e-4659.84DNA topoisomerase II alpha [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top-20.000e+054.26DNA topoisomerase 2 top-2 [Source:UniProtKB/Swiss... [more]
R05D3.120.000e+039.65Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
cin-40.000e+051.13DNA topoisomerase-like protein cin-4 [Source:UniP... [more]
R05D3.124.747e-17341.56Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
R05D3.124.747e-17341.56Putative DNA topoisomerase 2, mitochondrial [Sour... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Top20.000e+056.46gene:FBgn0284220 transcript:FBtr0332320[more]
Top20.000e+056.46gene:FBgn0284220 transcript:FBtr0081287[more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
top2b0.000e+058.26DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a0.000e+057.32DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a7.632e-12749.24DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2b1.157e-3058.70DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TOP2A0.000e+059.16DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.16DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.16DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+059.16DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
TOP2A0.000e+058.91DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Top2a0.000e+059.86topoisomerase (DNA) II alpha [Source:MGI Symbol;Ac... [more]
Top2b0.000e+058.13topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
Top2b4.773e-5253.85topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
Top2b8.645e-1139.52topoisomerase (DNA) II beta [Source:MGI Symbol;Acc... [more]
back to top
BLAST of DNA topoisomerase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P41515|TOP2A_CRIGR0.000e+060.09DNA topoisomerase 2-alpha OS=Cricetulus griseus OX... [more]
sp|Q01320|TOP2A_MOUSE0.000e+059.86DNA topoisomerase 2-alpha OS=Mus musculus OX=10090... [more]
sp|Q02880|TOP2B_HUMAN0.000e+058.37DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 G... [more]
sp|O42130|TOP2A_CHICK0.000e+056.51DNA topoisomerase 2-alpha OS=Gallus gallus OX=9031... [more]
sp|Q64511|TOP2B_MOUSE0.000e+058.13DNA topoisomerase 2-beta OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of DNA topoisomerase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A094ZNL10.000e+056.17DNA topoisomerase 2 OS=Schistosoma haematobium OX=... [more]
A0A3Q0KH180.000e+056.73DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183... [more]
A0A0X3PUD60.000e+061.85DNA topoisomerase 2 OS=Schistocephalus solidus OX=... [more]
G4VPA90.000e+056.73DNA topoisomerase 2 OS=Schistosoma mansoni OX=6183... [more]
A0A5J4NZ250.000e+059.06DNA topoisomerase 2 OS=Paragonimus westermani OX=3... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
top2b0.000e+058.52DNA topoisomerase II beta [Source:ZFIN;Acc:ZDB-GEN... [more]
top2a0.000e+056.57DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
top2a0.000e+056.57DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
top2a0.000e+058.68DNA topoisomerase II alpha [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000007762.13.290e-11655.70pep scaffold:Pmarinus_7.0:GL492656:1017:4077:-1 ge... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOP20.000e+049.34Topoisomerase II; relieves torsional strain in DNA... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448137.505e-18058.13DNA topoisomerase 2 [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO448111.536e-10850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295474.711e-7064.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448121.150e-4567.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256985.191e-1632.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
top2b0.000e+058.95DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2a0.000e+054.63DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
top2b0.000e+058.16DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2b7.900e-10950.00DNA topoisomerase II beta [Source:NCBI gene;Acc:10... [more]
top2a3.003e-7660.82DNA topoisomerase II alpha [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of DNA topoisomerase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037559.10.000e+089.76SMESG000037559.1[more]
SMESG000037559.10.000e+089.27SMESG000037559.1[more]
SMESG000037565.10.000e+092.55SMESG000037565.1[more]
SMESG000037565.10.000e+092.25SMESG000037565.1[more]
SMESG000037565.10.000e+091.63SMESG000037565.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033538 ID=SMED30033538|Name=DNA topoisomerase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=4567bp
TGAAAAGTTATTAAATAAAGTATTTCTTATCAATTTCTTTAAAGTGATTG
AAAATAAATACTAAAAGTATTTAAGAAGCAATGTCTTCGGACGACTCATT
AAGTTTAGAAGAAAATGAGTCAATTGAAAAACGTTATCTGAAAAAAACTC
AGTTAGAGCACATTCTTTTAAGACCAGATTCTTATGTTGGTTCAATAAAG
CCAGAGGAAAAAGCATTATGGATTTTCGACTCTGAAAAAAACTGCATGGT
TGAAAAACAAATTACATATAATCCAGGGCTTTACAAAATCTATGACGAAA
TTCTTGTTAATGCTTCAGATAATAAAATAAGAGATCGAAAAATGTCTTGT
ATTAGGATAGATATTAATGGACCAAAAAATATGATAAGAATCTGGAATAA
TGGGAAAGGAATTCCGGTTGTAATGCACAGAGATGTTAACGTTCATGTAC
CTACGATGATATTTGGACAGCTTCTAACATCAACTAATTTCAATGATGAT
AAAAAACAAGTTACCGGTGGCAGAAATGGCTATGGTGCTAAATTATGTAA
TATATTTAGTAATGAATTTATTCTGGAAACCTCCAATAAAGAGTATGGAA
AAAGTTTTAAACAGACTTGGACAAAAAATATGGGTGTCGCAAGTGATCCA
ATTATCAGCAGTTGCCAGAAAGAAGATTTCACCTGTGTCACATTTTACCC
AGATTTAAAACGATTTAATATGAGTCATTTGGACGATGAAACTATAGCGC
TTTTCAGTCGACGAGCCTATGACATAGCTGCTTGCACAAATGGAATAGTT
GTATATTTAAATGGTCAACAGATACCGGTAAAAAATTTCAAAGATTATGT
GGAATTATATACGAAAAACTGTCTTGACAGTAATGAGGAGGAATTGAAAG
TTATTTATGAGAAATTTGGTGATCGTTGGGAAGTTGCCATGACAACGAGT
CTAAATGATAACTTTTGTCAAGTTAGTTTTGTCAACAGCATTGCAACTAC
AAAAGGTGGAACCCATGTTAATCATATTACCGATCAAGCAGCGGTTAAAT
TATTGGAAATCGCGAAAAAGAAAATCAAAAGTGACAAACAGGCAGTAAAA
TTAAAGGTTGCCCAAGTGAAAATGAACATGTGGGTATTTGTAAAATGTCT
TATTGAAAATCCAAGTTTCGATTCACAAACCAAAGAAAATATGACTTTAA
ATGCTAAAGATTTCGGTTCAACTTGTGCTCTGACAGATAAGTTTATATCC
CAGGTGGCGAAATGTGGTATCGTAGAAAAAATAACGATGTGGGCTATGTT
TAAGAATCAAGCGTTGTTAGATAAAAAATGCAGTAAAACTAAGCATACAA
AACTGAAAGATATACCAAAATTGGATGATGCCAATTTCGCGGGCACTAAG
AACTCGCTGCAGTGTACTTTGATCTTAACGGAAGGAGATTCAGCCAAATC
ATTGGCTGTTTCGGGTTTGGCAGTTATCGGCAGGGATTATTATGGTGTAT
TTCCACTAAGGGGAAAATTATTAAATGTCAGAGAAGCAGGTGTAAAGCAA
TTAACAGAAAATGCTGAAATCACAAACATCATAAAGATTATTGGCTTGCA
ATACAGTCAAAAGTATGAATTACCGGAATCATTGAAGACTTTGCGATATG
GAAAACTAATGATAATGACAGATCAGGATCAAGACGGATCTCACATAAAG
GGCCTGTTGATAAATTTCATTCATTCAAAATGGCCCAATTTATTAAAACA
CAATTTCGTCGAACAATTCATCACACCAATAGTAAAAGCATTCAAAAACA
ACCAAGTATTATCTTTCTATAGCATTCCTGAGCTTGTCGAATGGCAAAAA
GTCACTCCAGGTGCGAATCAATGGCGGTTGAAGTATTACAAGGGGTTGGG
TACATCCACTAGTAAGGAAGCAAAGGAATATTTCAGTGACATGGAACGGC
ATTTGATTAAGTTTCGATACAGTGGCGAAGAGGATGGTAAAAGTATTGTT
TTGGCATTTTCAAAAACTAAAGCTGATGAGCGTAAAGAATGGTTGACAAA
TTGGATGGAAGACTGTAAACGCCGCCGAGAGCTTGGAATGGACGAGGTTT
ATTTGTACGGAAAGGGCACAAAATACATCACGTTTGAAAACTTCATTAAT
CAGGAGTTGATTTTATTCAGCAATACGGATAATGAGAGAAGCATTCCATG
TTTAATGGACGGGTTCAAGCCAGGTCAAAGAAAAGTGTTATTTGCCTGCT
TGAAAAGGAATTTAGTGAAGGAATTAAAAGTTGCACAATTAGCTGGATCC
GTGGCTGAACTATCCGCATATCACCACGGTGAAGCATCCTTGATGTCAAC
TATCATTAATTTGGCTCAGGATTTCGTCGGCAGCAATAACATCAATCTAT
TGATGCCAAACGGCCAATTCGGTACTCGGCTAGCTGGGGGCAAAGATAGC
GCTTCACCTCGTTACATATGTACTCAATTGAGTAAATTGACGAAATTGAT
TTTCCACCACGACGACGAGGCGGTATTGAAAAATTTGCTGGATGACAATC
AATCTATCGAACCAGAATGGTATGCACCAATTATTCCGATGGTATTAATT
AACGGGTGTGACGGTATCGGAACTGGGTGGAGTAGTAAAATTCCTAATTT
CAACCCGAAAGATGTTATAGATAATTTAAAACGAATGATTAATGGTGGAA
CTCCCGTGAAAATGCATCCATGGTATCGTAATTTCACCGGAACAATCGTT
GAGGTGTGTGAAAACAAGTATGTGGTTAATGGGGAAATAAATCAACTCGA
TGGAACTACTTTGGAAATAACCGAGTTACCCATTCGAGTTTGGACTAATT
CTTACAAAGAGAGCGTAATGGAAATTTATCGTCATGGAAACGATAAAACT
CCAGCATTTATCACCGATTACAAAGAGTACAATACGGATAAAACAGTTCG
ATTCCTCGTGGAAATGAATCCAGCCAAATACGCAGAAGCAGAAGCGGTGG
GTTTCCACAAATTTTTCAAACTGCAGACACCTTTGACGTTGAGCAACATG
ATATTGTTTGATGAATGCGGAGTCATCAGAAAATATAATAACGGAATAGA
AATATTAGAGAGCTTTTTTAAAGTGCGTTTGGAAATTTATATCAAACGGA
AAAATTATTTATTGGGCATTTTATCAGCTCAGGCGTCCAAGTTGCAAAAC
CAAGCGAGATTTATTTTAGAGAAAATTAATGGAAAAGTTATTTGTGAAAA
TGTGAAAATTGCCGTTTTGATTGATAAATTGGTGGCAGCAAAATATGATT
CCGATCCTGTTAAAGCTTGGCAGAAAAGTGTTGAAAAGTTATTGGCAATC
GATAAGGGAGAAGAAGAAAACCAAGAAGATATTGAGGATTCTAACAAACC
TGATTTTGGATATTTAACCCAGATGCAAATCTTAACTTTAACAGCAGAAA
AGAAAGACGCATTGTTGAAGGAGAGAGACGAAAAATTAAAAGAATTGGAT
ATTATACGAAATAAATCACCGCAACAAATGTGGTTGGATGATTTAGAAAT
ACTGGAAAAGGAAATAAATGTGGTTTATAATCAAGATACTTCGGAACCAG
GGGAAATAGTGAATACCGTTGTGAAGAAGCCTGGTAAAAAAGGTGGAAAA
GCTATAAAAATAGCAGCAGAAACCGCTCCGTCGAAATTCAGTCGCCGTAT
TGAACCGAAAATAGAAGAGGAATATTTGAAAAAAATCAATTTAGAAACGG
AAAAAAAGAAAAAGCTAGTTGAGAATAAAAAGCAGAAAGAAATGATAGAA
AATTTCGTTACAAGAGAATCTACAGGTACAAATGCAGAAGCTGGCGACAA
TAATTCTGAAAATGACGAAGAGCTGACTCTGGCTCAGAGATTGGCCAAGA
CTCATGGAAGTGAGGCGTTCAAAGGTTTGATAGGAAAAGGAGATAAACCA
ACTAAAACAAACAAAACGAATATTTTGATTGAAAAAAATGCTAAAGTTAG
TCCCGGTAACAAGAGAAAACGAGATAGCGGTGAAATTATCGAATTATCCG
ATAATGATGACGGCGACTCCAATCAAGCTCAAAATAAAGTTAAAACCAAT
AAATCAGAAATGTCCTCGGAAAGCCTATTTAAAAATATCAAGTTTCCGCA
AAAGCAATCAAAACTTCTGGTAGAGAATAAAGACAAGCCCGTCGCTAAAA
AAGCTAAAATTGAGAAACCCAAGACAATGAAGCCTAAAACCGATAAACCA
AAACCCCAGAAGAAAGATGCGGCTCCTAAAGACAAAAAAGAAGCAGCTCC
GAAAATGACAAAAAAGCCAGCAGCGCCAAAAAAGAAAGAAATCGCGGAAA
ATACAAATCATTCTGACGATTCATCTGAAGGCGCTGTGAGGAAAGAAAGA
TCAAAGAGAAAAGCCGCCATTAAAACTTACGATGTTTTTTCCGATGAAGA
GGAATCTGTGAAGGATGACGACAGCGATTTCGATTTCAATGCGGAAAAGA
GTAAAGCGTCAAATAAGAAGGCAAGGAGGATTAGCAGTGACTCGGATTAA
ATGATTTGTATATAGAG
back to top

protein sequence of SMED30033538-orf-1

>SMED30033538-orf-1 ID=SMED30033538-orf-1|Name=SMED30033538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1490bp
MSSDDSLSLEENESIEKRYLKKTQLEHILLRPDSYVGSIKPEEKALWIFD
SEKNCMVEKQITYNPGLYKIYDEILVNASDNKIRDRKMSCIRIDINGPKN
MIRIWNNGKGIPVVMHRDVNVHVPTMIFGQLLTSTNFNDDKKQVTGGRNG
YGAKLCNIFSNEFILETSNKEYGKSFKQTWTKNMGVASDPIISSCQKEDF
TCVTFYPDLKRFNMSHLDDETIALFSRRAYDIAACTNGIVVYLNGQQIPV
KNFKDYVELYTKNCLDSNEEELKVIYEKFGDRWEVAMTTSLNDNFCQVSF
VNSIATTKGGTHVNHITDQAAVKLLEIAKKKIKSDKQAVKLKVAQVKMNM
WVFVKCLIENPSFDSQTKENMTLNAKDFGSTCALTDKFISQVAKCGIVEK
ITMWAMFKNQALLDKKCSKTKHTKLKDIPKLDDANFAGTKNSLQCTLILT
EGDSAKSLAVSGLAVIGRDYYGVFPLRGKLLNVREAGVKQLTENAEITNI
IKIIGLQYSQKYELPESLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHSK
WPNLLKHNFVEQFITPIVKAFKNNQVLSFYSIPELVEWQKVTPGANQWRL
KYYKGLGTSTSKEAKEYFSDMERHLIKFRYSGEEDGKSIVLAFSKTKADE
RKEWLTNWMEDCKRRRELGMDEVYLYGKGTKYITFENFINQELILFSNTD
NERSIPCLMDGFKPGQRKVLFACLKRNLVKELKVAQLAGSVAELSAYHHG
EASLMSTIINLAQDFVGSNNINLLMPNGQFGTRLAGGKDSASPRYICTQL
SKLTKLIFHHDDEAVLKNLLDDNQSIEPEWYAPIIPMVLINGCDGIGTGW
SSKIPNFNPKDVIDNLKRMINGGTPVKMHPWYRNFTGTIVEVCENKYVVN
GEINQLDGTTLEITELPIRVWTNSYKESVMEIYRHGNDKTPAFITDYKEY
NTDKTVRFLVEMNPAKYAEAEAVGFHKFFKLQTPLTLSNMILFDECGVIR
KYNNGIEILESFFKVRLEIYIKRKNYLLGILSAQASKLQNQARFILEKIN
GKVICENVKIAVLIDKLVAAKYDSDPVKAWQKSVEKLLAIDKGEEENQED
IEDSNKPDFGYLTQMQILTLTAEKKDALLKERDEKLKELDIIRNKSPQQM
WLDDLEILEKEINVVYNQDTSEPGEIVNTVVKKPGKKGGKAIKIAAETAP
SKFSRRIEPKIEEEYLKKINLETEKKKKLVENKKQKEMIENFVTRESTGT
NAEAGDNNSENDEELTLAQRLAKTHGSEAFKGLIGKGDKPTKTNKTNILI
EKNAKVSPGNKRKRDSGEIIELSDNDDGDSNQAQNKVKTNKSEMSSESLF
KNIKFPQKQSKLLVENKDKPVAKKAKIEKPKTMKPKTDKPKPQKKDAAPK
DKKEAAPKMTKKPAAPKKKEIAENTNHSDDSSEGAVRKERSKRKAAIKTY
DVFSDEEESVKDDDSDFDFNAEKSKASNKKARRISSDSD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001241Topo_IIA
IPR001154TopoII_euk
IPR003594HATPase_C
IPR002205Topo_IIA_A/C
IPR013506Topo_IIA_bsu_dom2
IPR024946Arg_repress_C-like
IPR013758Topo_IIA_A/C_ab
IPR013759Topo_IIA_B_C
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR006171TOPRIM_domain
IPR031660TOPRIM_C
IPR013757Topo_IIA_A_a_sf
IPR018522TopoIIA_CS
IPR013760Topo_IIA-like_dom_sf
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005524ATP binding
GO:0003918DNA topoisomerase type II (ATP-hydrolyzing) activity
GO:0000166nucleotide binding
GO:0003916DNA topoisomerase activity
GO:0016853isomerase activity
Vocabulary: biological process
TermDefinition
GO:0006265DNA topological change
GO:0006259DNA metabolic process