Acyl-CoA synthetase short chain family member 3

Overview
NameAcyl-CoA synthetase short chain family member 3
Smed IDSMED30033523
Length (bp)2003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acyl-CoA synthetase short chain family member 3 (SMED30033523) t-SNE clustered cells

Violin plots show distribution of expression levels for Acyl-CoA synthetase short chain family member 3 (SMED30033523) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033523

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30033523SMESG000043642.1 Contig30559newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033523SMESG000043642.1 Contig30559uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30033523SMESG000043642.1 SMESG000043641.1 Contig6343_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 421.779 bits (1083), Expect = 3.243e-138
Identity = 221/632 (34.97%), Postives = 366/632 (57.91%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            GS Y+  +  S++ PE+ W + A+++ W KP+T  ++N+ SP   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T+T    TY+++L  V  LAGV+V K  ++KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   VE+A+K+ Q  PD  L+YNR N +   +  G+DLDW+ E+  A  H  VP+ S HP+YI+YTSGTTG PK ++  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W   +F  P+ + W Q+E G  +T    G             +S+P +++   +I     ++L    +G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   ++ D   T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  + ++L  A
Sbjct:   59 GSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV---MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:HGNC Symbol;Acc:HGNC:24723])

HSP 1 Score: 413.69 bits (1062), Expect = 4.038e-135
Identity = 220/632 (34.81%), Postives = 365/632 (57.75%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            GS Y+  +  S++ PE+ W + A+++ W KP+T  ++N+ SP    F  G +N+ YN +D+H+ +G GD +AIIY+  +T+T    TY+++L  V  LAGV+V K  ++KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   VE+A+K+ Q  PD  L+YNR N +   +  G+DLDW+ E+  A  H  VP+ S HP+YI+YTSGTTG PK ++  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W   +F  P+ + W Q+E G  +T    G             +S+P +++   +I     ++L    +G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   ++ D   T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  + ++L  A
Sbjct:   59 GSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSP-STRFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV---MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS1 (acyl-CoA synthetase short chain family member 1 [Source:HGNC Symbol;Acc:HGNC:16091])

HSP 1 Score: 240.35 bits (612), Expect = 3.116e-69
Identity = 183/634 (28.86%), Postives = 308/634 (48.58%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKE-VIWTKPYTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAA-VPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSP---IHNVWGQSELGPLVTGYHYGYYRPNYDES--------MPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSL--LYMANGKQWTMPVNVEKPHVFKEIYDV 1904
            +Y  +   +  +P   W  LA++ ++W  PY +V   + S   I WF GG++N+S NCLD+HV     + VA+I+E     T  R+TY++LL     LA  +  +  V +GDRV +Y PV+   VAAMLAC RIGAV+ VIF+    + +A ++   + K+VIT N G   GR ++ K+ V++A+K    +  + LV +R  TD    +   D+  E E+    P  A   + S   ++++YTSG+TG PK +V      ++      K V   +  D F   +D GWI+G + + YGPL  G T +L+E  P+   A     + + R  +  F   PT  R++ K       K     L+ +   GE  N E  +W+ ++       + + W Q+E G +         RP+ + +         P F I P +++ K      +   G + + +   P  A TIY +HQ+++D +F  YPGY+ T D     + G  Q+  R + +I IS   +    IE+    +  +  +AV+     + G+   AF+ VK D    ++ V++ +  +V  K+  +      ++V  LPK R+GK++R  L  +  +  ++      +E P +  EI  V
Sbjct:   57 SYPALSAQAAREPAAFWGPLARDTLVWDTPYHTVWDCDFSTGKIGWFLGGQLNVSVNCLDQHVRKS-PESVALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAVHTVIFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTV-QHVLVAHR--TDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFMLYTSGSTGMPKGIVHTQAGYLLYAALTHKLVFDHQPGDIFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNA-GRYWETVERLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINCEAWEWLHRVVGDSRCTLVDTWWQTETGGICIA-----PRPSEEGAEILPAMAMRPFFGIVPVLMDEKGSVVEGSNVSGALCI-SQAWPGMARTIYGDHQRFVDAYFKAYPGYYFTGDGAYRTEGGYYQITGRMDDVINISGHRLGTAEIEDAIADHPAVPESAVIGYPHDIKGEAAFAFIVVK-DSAGDSDVVVQELKSMVATKIAKYAVPDEILVVKRLPKTRSGKVMRRLLRKIITSEAQELGDTTTLEDPSIIAEILSV 677          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 231.491 bits (589), Expect = 7.381e-66
Identity = 175/639 (27.39%), Postives = 294/639 (46.01%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTDPAKMVN---------------------GKDLDWETEIKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN 1838
              Y ++++ S+ +P + W ++AKE  W  P        +  +        W  G   N+ YN LD++V +   GD VA  +E      + ++TY QLL  V   + V+  K  ++KGDRV +Y P+  + V AMLAC RIGA++ ++F+    + + E++  +   L+ITT+  Y   + +  KE  ++A++  Q   F    C+V   L      M +                     G DL W   ++ A         ++  P++I+YTSG+TG+PK +V   G  ++      KYV     +D FW  +D GWI+G + +TYGPL  G T +L+EG P T   +  +  I++++ V  F + PT  R++ K   E   K     L+ +   GE  N E   W  ++  +   PI + + Q+E G       P  T    G        + P F + P I+N   EE       G ++ K P  P    T+Y NH+++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    +     E   + + +K+G           P LPK R+GK++R  L  +A 
Sbjct:   45 QRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPG------SATFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQ-IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQ 672          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Match: ACSS2 (acyl-CoA synthetase short chain family member 2 [Source:HGNC Symbol;Acc:HGNC:15814])

HSP 1 Score: 226.868 bits (577), Expect = 3.795e-64
Identity = 177/652 (27.15%), Postives = 295/652 (45.25%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTDPAKM----------------VNGK------------------DLDWETEIKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN 1838
              Y ++++ S+ +P + W ++AKE  W  P        +  +        W  G   N+ YN LD++V +   GD VA  +E      + ++TY QLL  V   + V+  K  ++KGDRV +Y P+  + V AMLAC RIGA++ ++F+    + + E++  +   L+ITT+  Y   + +  KE  ++A++  Q   F    C+V   L      M                V GK                  DL W   ++ A         ++  P++I+YTSG+TG+PK +V   G  ++      KYV     +D FW  +D GWI+G + +TYGPL  G T +L+EG P T   +  +  I++++ V  F + PT  R++ K   E   K     L+ +   GE  N E   W  ++  +   PI + + Q+E G       P  T    G        + P F + P I+N   EE       G ++ K P  P    T+Y NH+++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    +     E   + + +K+G           P LPK R+GK++R  L  +A 
Sbjct:   45 QRYRELHRRSVEEPREFWGDIAKEFYWKTPCPGPFLRYNFDVTKGKIFIEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTQITYHQLLVQVCQFSNVL-RKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQGKLKEKSKRVQPQISWNQGIDLWWHELMQEAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTVGGYMLYVATTFKYVFDFHAEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDVNRLWSIVDKYKVTKFYTAPTAIRLLMKFGDEPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGAQRCPIVDTFWQTETGGHMLTPLPGATPMKPG------SATFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHERFETTYFKKFPGYYVTGDGCQRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPKLTEELKKQ-IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQ 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 181.8 bits (460), Expect = 1.141e-48
Identity = 157/622 (25.24%), Postives = 289/622 (46.46%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIK-NEDSPIPIWF----DGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCH-VRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---------FIPDYCLVYNRLNTDPAKMVNGKDLD--WETE-IKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFS----SPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            +Y D+Y+ SI+  ++ W  ++ E+ + +  +  ++ N DS     F    DG + N+SYNCL++++  GYG+ +A I+E      +   TY +L   V   + V+  + H V++GD V LY P+  +   AMLAC RIGA++ V+F+    + +A ++     ++++T +  +   + I  K   + A  L+           + ++     + +      V+  D+   +++E +K A   + V  ++S  P++I+YTSG+TG+PK +   T   +       KY    +  D +W  +D GWI+G + + YGPL+ G   I YEG P T    + +  + +++ V    + PT  R +  L  +       K LK I   GE  N     W+ K       S +   W     G ++T             +MP F  +P ++++  E ++  G     +      P     IY + Q+++  +   + GY+ T D    ++DG L +  R + ++ +S   +    IE   + +E +  AAVV     + G  P AF+ +   + I   +++  + +LV +K+G           P LPK R+GK+ R  L  +A G +
Sbjct:   29 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDA--EGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERIN-EKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSE 644          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 181.415 bits (459), Expect = 1.697e-48
Identity = 157/622 (25.24%), Postives = 289/622 (46.46%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIK-NEDSPIPIWF----DGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCH-VRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---------FIPDYCLVYNRLNTDPAKMVNGKDLD--WETE-IKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFS----SPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            +Y D+Y+ SI+  ++ W  ++ E+ + +  +  ++ N DS     F    DG + N+SYNCL++++  GYG+ +A I+E      +   TY +L   V   + V+  + H V++GD V LY P+  +   AMLAC RIGA++ V+F+    + +A ++     ++++T +  +   + I  K   + A  L+           + ++     + +      V+  D+   +++E +K A   + V  ++S  P++I+YTSG+TG+PK +   T   +       KY    +  D +W  +D GWI+G + + YGPL+ G   I YEG P T    + +  + +++ V    + PT  R +  L  +       K LK I   GE  N     W+ K       S +   W     G ++T             +MP F  +P ++++  E ++  G     +      P     IY + Q+++  +   + GY+ T D    ++DG L +  R + ++ +S   +    IE   + +E +  AAVV     + G  P AF+ +   + I   +++  + +LV +K+G           P LPK R+GK+ R  L  +A G +
Sbjct:   39 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDA--EGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERIN-EKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSE 654          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: acs-19 (Acetyl-coenzyme A synthetase [Source:UniProtKB/TrEMBL;Acc:Q65ZB8])

HSP 1 Score: 181.415 bits (459), Expect = 1.697e-48
Identity = 157/622 (25.24%), Postives = 289/622 (46.46%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIK-NEDSPIPIWF----DGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCH-VRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---------FIPDYCLVYNRLNTDPAKMVNGKDLD--WETE-IKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFS----SPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            +Y D+Y+ SI+  ++ W  ++ E+ + +  +  ++ N DS     F    DG + N+SYNCL++++  GYG+ +A I+E      +   TY +L   V   + V+  + H V++GD V LY P+  +   AMLAC RIGA++ V+F+    + +A ++     ++++T +  +   + I  K   + A  L+           + ++     + +      V+  D+   +++E +K A   + V  ++S  P++I+YTSG+TG+PK +   T   +       KY    +  D +W  +D GWI+G + + YGPL+ G   I YEG P T    + +  + +++ V    + PT  R +  L  +       K LK I   GE  N     W+ K       S +   W     G ++T             +MP F  +P ++++  E ++  G     +      P     IY + Q+++  +   + GY+ T D    ++DG L +  R + ++ +S   +    IE   + +E +  AAVV     + G  P AF+ +   + I   +++  + +LV +K+G           P LPK R+GK+ R  L  +A G +
Sbjct:   39 SYHDLYRSSINDADEFWRTVSSELHFEQGTSKGLEWNFDSKAGNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIFEGNEPTDTSTWTYNELHAQVVQFSAVL--RSHGVKRGDVVALYLPMIPELAVAMLACARIGAMHSVVFAGFSAESLAARVVDARCRVLVTADGVFRGAKPIGLKSIADAAAVLASQEDVKVEAIIMVEHLKRVTKPDGVELPKVDYTDITVIYDSEMLKCAGVDSPVEWMDSEDPLFILYTSGSTGKPKGIQHTTAGYMTYAYATTKYTFDAQEDDVYWCTADCGWITGHSYLLYGPLMNGLKGIWYEGVP-TYPTPSRMWDVTDKYGVTKLYTSPTAARALMALGNQWLESSSRKTLKVIGTVGEPINPAAWMWLYKQVGLSNVSIVDTYWQTETGGHMITCLPGATPMKPGAAAMPFFGASPVLLDA--EGRVIEGPGEGSLCFDRAWPGMMRGIYGDEQRFVKTYLAPFNGYYFTGDGARRDEDGYLWITGRVDDLMNVSGHLLSTAEIESALVAHEKVAEAAVVAAPHDIKGSFPYAFVTLNVGERIN-EKLVAELKKLVREKIGALAVPDVIQEAPGLPKTRSGKVTRRILRKIAEGSE 654          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: mec-18 (pep chromosome:WBcel235:X:4271169:4274229:-1 gene:WBGene00003179.1 transcript:C52B9.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-18)

HSP 1 Score: 82.0333 bits (201), Expect = 4.798e-16
Identity = 127/585 (21.71%), Postives = 234/585 (40.00%), Query Frame = 3
Query:  234 LDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTN------------IGYEPGRTIKYKEHVEDAIKLSQFIPDYC----------------LVYNRLN------------TDPAKMVNGKDLDWETEIKTA---TPHAAVPLES---NHPMYIIYTSGTTGEPKALVMGTGNSIVT-DKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGI-CIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINP------KIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAV-IVPELPKNRAGKLLRYSL 1823
            +  +G ++AI+       + ++  Y ++    E +    + +  V  G RV +    T Q +   LAC+ IG   V +      D I   +  +E   +I  N                 G  IK+   +ED +   +   D                  +   ++N            T P   V+G+  +   +++++   +     P++     +P+ I++TSGTTG  KA  +   + I+   +  L   G V+ K+ F +      I G  +  Y  L+ G ++ L     ++K++     + +  + + V    P     M    +  D K P   L+ + C G    +       S++        +G +ELG + T        P  DE + +   NP      K++N +T++       G+II+   + P  +   YKN +   +LF     G+  T D G  ++ G + VL R + II+   T IC   +E V   +  + + AVV   D VTG+VP AF+      P+        + + V+ K+  F   +  V  + E+P++  GK+LR +L
Sbjct:   27 ISAHGSNLAIVD----VDSGKQWRYSEIRNWCE-MCATRLKELQVTSGSRVAVITGTTGQAIFVHLACSIIGCSAVAVNGWNAVDEIWTLVDLSEATHLIVENQFMQKADDVRRKAQMRGGGRIKHVRQIEDVLTAERINVDSARKRSIDVKQKPPLVKEMSLAKINLTPVLPEDIADLTSPVSEVSGQSKELNGDVESSVVDSEEVQTPIQQVSGQNPLLILFTSGTTGLAKAAELSHRSLIINIQQISLPLYGPVQTKERFLLPLSIAHIYG-IVSAYYALINGASLYL-----ISKQSNRLFMETLVNNQINVMHITPAIVHWMATDAIVDDYKTP--NLRSVLCAGAPIDSNSAAAMKSRLNIKDFRQSFGMTELGGICT------MSPYLDEKIESVG-NPLPGMLFKVVNWETKQLCLPRQPGQIIV---LGPQVSPCYYKNPKATSELF--DATGFVKTGDAGFYDEVGRIYVLDRIKDIIKCKGTMICPSEVELVLRAHAGIDDCAVVGRQDHVTGEVPAAFVVKNAQHPL---LASAEVRQYVSGKIATFKELRGGVFFISEIPRSVCGKILRRNL 583          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Match: sur-5 (Acetoacetyl-CoA synthetase [Source:UniProtKB/Swiss-Prot;Acc:Q21166])

HSP 1 Score: 77.0258 bits (188), Expect = 2.255e-14
Identity = 102/510 (20.00%), Postives = 218/510 (42.75%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAK--EVIWTKPYTSVIKN--EDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTN-IGYEP---GRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKT-----ATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYV--GGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFS--SPIHNVWGQSE-LGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPIS--PSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDD-GSLQVL 1514
            ++Y + ++ +       W++L K  +V   + Y  VI +  + +  P WF+G  +N + N +++    G   D+A++   ++  T    TY  L   V  +A  + N   +  GD V  + P T   + A+ A   +GA +        P  + ++     PK++ T N + Y+     +T K  E V++   L + +      +  +  D  K           E KT       P    P+  + P++++++SGTTG PKA+V   G +++  K+  +++  G  ++ D  + ++  GW+    ++++  L    +++L++  PL  +    + KI  +    + G     +    +L +  +      ++  +   G     E   +I+   +  + I ++ G ++ +G  V G       P   + +    ++ K  N   EE + +   G ++  TP    PS  L    + +KY D +F +   ++   D+  +N   G +++L
Sbjct:   74 ADYREFHRFTCDNYGIFWEDLLKLSDVKLHQNYNQVIDHNLKINERPRWFNGATLNYTENVIER----GTATDIAVL-NASIEETVTEYTYDNLRKDVYRIATSLRNYG-IGPGDTVCGFVPNTYDTLVAVFATAAVGAAWCSASVDFGPAGVLDRFRQVHPKVLFTVNHVTYKKKLIDQTDKINEIVKELPTLEKIV--VSDTFTSVKFDATKYNQSDKFSSLEEFKTPIADVVLPFVYTPVPFSDPLFVMFSSGTTGIPKAMVHTVGGTLL--KHIEEHLVQGDSKKHDRMFFYTTCGWMMYNWMISF--LYSKGSVVLFDECPLAPDTHI-IMKIAAKTQSTMIGMGAKLYDEYLRLQIPFNTLYDLSKIHTVYSTGSPLKKECFAYINTYIAPGALIASISGGTDIIGCFVGGIKSLSITPGECQCL-FLGMDIKSFNYMDEEIINSDEQGELVCVTPFPSMPSHFLND-TDGKKYRDAYFARLEPFWAHGDFVRVNHSTGGVEML 568          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0346110)

HSP 1 Score: 369.777 bits (948), Expect = 1.143e-118
Identity = 215/645 (33.33%), Postives = 350/645 (54.26%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIP-DYCLVYNRLNTDP--AKMVNGKDLDWETEIKTA---TPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPY------KQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIA-FLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLP 1937
            Y   Y+ S+  P   W+E    + W +P+  V+ N + P   W+ GG +N  YN +D+H+L G G +VA+I++  LT T  R+TYQ+L   +  LAG +  K  V KGDRV++Y P+  + + AMLA  R+GA++ V+F       +  ++   EPKLVI +N+G EPG+ + Y + +  AI +S++ P    +++ R N  P   K+    D+ W   +K A    P A VP+E+N P+YI+YTSGTT +PK ++   G  +V   Y L+ + G+     +W  SD GW+ G + + YGPL +G T ++YEGKP       +  +II+++ V    S+PT FR++++    AD  + Y      K L+ I I GE  + E + WI K F  P+ N W Q+E G  VT    G+ +    P Y   +P    + KI+ +   E      +GRI LK P+ P    T+YKN + +  L+F K+PGY+DTMD G  ++ G + V +R + +I ++   +    +E+  L++  +++ AV  + +   GQVP+  ++ V+N K  T+ ++   II+L+   VG    F+    V  LP+ R+GK +R ++   A  ++  +P  ++   VF EI   L   GY  + P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRR----ADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEA-QTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKK-TDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: CG6432 (gene:FBgn0039184 transcript:FBtr0084606)

HSP 1 Score: 369.777 bits (948), Expect = 1.143e-118
Identity = 215/645 (33.33%), Postives = 350/645 (54.26%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIP-DYCLVYNRLNTDP--AKMVNGKDLDWETEIKTA---TPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPY------KQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIA-FLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLP 1937
            Y   Y+ S+  P   W+E    + W +P+  V+ N + P   W+ GG +N  YN +D+H+L G G +VA+I++  LT T  R+TYQ+L   +  LAG +  K  V KGDRV++Y P+  + + AMLA  R+GA++ V+F       +  ++   EPKLVI +N+G EPG+ + Y + +  AI +S++ P    +++ R N  P   K+    D+ W   +K A    P A VP+E+N P+YI+YTSGTT +PK ++   G  +V   Y L+ + G+     +W  SD GW+ G + + YGPL +G T ++YEGKP       +  +II+++ V    S+PT FR++++    AD  + Y      K L+ I I GE  + E + WI K F  P+ N W Q+E G  VT    G+ +    P Y   +P    + KI+ +   E      +GRI LK P+ P    T+YKN + +  L+F K+PGY+DTMD G  ++ G + V +R + +I ++   +    +E+  L++  +++ AV  + +   GQVP+  ++ V+N K  T+ ++   II+L+   VG    F+    V  LP+ R+GK +R ++   A  ++  +P  ++   VF EI   L   GY  + P
Sbjct:   28 YLKAYRQSVQNPAAFWEEQGNLLDWDRPWEKVLDNSNPPFTKWYVGGYLNACYNSIDRHILAGRGSNVALIHDSPLTGTLRRVTYQELYDQIVLLAGGLA-KLGVVKGDRVVIYMPLIPETIIAMLAIVRLGAIHSVVFGGFAARELCSRIEHVEPKLVIASNVGVEPGKVVPYLDILHSAISMSRWRPPQRNIIFRRDNVSPDTTKLDPLTDVLWSDILKMAEGERPIACVPIEANDPLYILYTSGTTDKPKGVLRTIGGHLVALVYTLRTLYGINPGHTWWAASDMGWVVGHSYICYGPLCLGATSVMYEGKPDRTPDPGQYFRIIDQYQVRSIFSVPTSFRVIRR----ADPDISYGRQYSMKSLRAIFIAGEHCDYETKSWIEKTFKVPVLNHWWQTETGSAVTATCLGFQQNLSPPTYSTGLPLMGYDVKILKADGSEA-QTSELGRIALKLPLPPGNMATLYKNEELFRTLYFQKFPGYYDTMDAGYKDERGYIFVTARDDDVINVAGHRLSTSSLEDAVLRHPDVVDVAVFGVPEATKGQVPLCLYIPVENCKK-TDAKLSTEIIKLIRDVVGPIAAFRLVTSVNNLPRTRSGKTMRKAMADFARNERVVLPATIDDASVFIEIRRALNQLGYAMTAP 665          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0333126)

HSP 1 Score: 237.269 bits (604), Expect = 1.567e-68
Identity = 173/623 (27.77%), Postives = 297/623 (47.67%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKP--------YTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSER-MTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIP---DYCLVYNRLNT----------DPAKMVNGKDLDWETEIKTATPHAAVP--LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQW----ISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
            Y+  Y+ S+  P + W  +AK+  W  P        Y   I     PI I W +G   N+ YN LD++V +G GD +A  +E        R +TY++LL  V   A V+ +   +RKGDRV +Y P+ ++   AMLAC RIGAV+ ++F+   PD +AE++   + KL+IT +  +   + +  K   + A++  + +    + C+V + L            +     + +D  W  E++   P A  P  +++  P++++YTSG+TG+PK ++  T   ++      K V   +  D +W   D GWI+G T + YGPL  G T +++EG P           +I+++ V  F + PT  R + K      +K     LK +   GE  N E   W    I K   S +   W     G ++T             S P F + P +++    E    G  G ++   P  P    T+Y NH+++ D +F+K+PGY+ T D    + DG L +  R + ++ +S   +    +E V  ++  +  +AVV    PV G+    F+   N+  + + ++I ++ ++V +++G F         P LPK R+GK++R  L  +A
Sbjct:   26 YQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISK--GPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFP-GNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGE-GYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFI-TPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIA 640          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078413)

HSP 1 Score: 237.269 bits (604), Expect = 1.567e-68
Identity = 173/623 (27.77%), Postives = 297/623 (47.67%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKP--------YTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSER-MTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIP---DYCLVYNRLNT----------DPAKMVNGKDLDWETEIKTATPHAAVP--LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQW----ISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
            Y+  Y+ S+  P + W  +AK+  W  P        Y   I     PI I W +G   N+ YN LD++V +G GD +A  +E        R +TY++LL  V   A V+ +   +RKGDRV +Y P+ ++   AMLAC RIGAV+ ++F+   PD +AE++   + KL+IT +  +   + +  K   + A++  + +    + C+V + L            +     + +D  W  E++   P A  P  +++  P++++YTSG+TG+PK ++  T   ++      K V   +  D +W   D GWI+G T + YGPL  G T +++EG P           +I+++ V  F + PT  R + K      +K     LK +   GE  N E   W    I K   S +   W     G ++T             S P F + P +++    E    G  G ++   P  P    T+Y NH+++ D +F+K+PGY+ T D    + DG L +  R + ++ +S   +    +E V  ++  +  +AVV    PV G+    F+   N+  + + ++I ++ ++V +++G F         P LPK R+GK++R  L  +A
Sbjct:   26 YQKFYQESLDNPAEFWSRVAKQFHWETPADQDKFLKYNFNISK--GPISIKWMEGASTNLCYNLLDRNVRNGLGDQIAYYWEGNHPDDYSRGLTYRKLLEEVCRFANVLKDH-GIRKGDRVSIYMPMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFP-GNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGE-GYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFI-TPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIA 640          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Match: AcCoAS (gene:FBgn0012034 transcript:FBtr0078414)

HSP 1 Score: 175.252 bits (443), Expect = 3.499e-47
Identity = 131/498 (26.31%), Postives = 235/498 (47.19%), Query Frame = 3
Query:  399 PVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIP---DYCLVYNRLNT----------DPAKMVNGKDLDWETEIKTATPHAAVP--LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQW----ISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
            P+ ++   AMLAC RIGAV+ ++F+   PD +AE++   + KL+IT +  +   + +  K   + A++  + +    + C+V + L            +     + +D  W  E++   P A  P  +++  P++++YTSG+TG+PK ++  T   ++      K V   +  D +W   D GWI+G T + YGPL  G T +++EG P           +I+++ V  F + PT  R + K      +K     LK +   GE  N E   W    I K   S +   W     G ++T             S P F + P +++    E    G  G ++   P  P    T+Y NH+++ D +F+K+PGY+ T D    + DG L +  R + ++ +S   +    +E V  ++  +  +AVV    PV G+    F+   N+  + + ++I ++ ++V +++G F         P LPK R+GK++R  L  +A
Sbjct:    2 PMILELPIAMLACARIGAVHSIVFAGFSPDSLAERMFDCKAKLLITADGAWRGEKPLYLKALCDTALEKVEEMGHSVEKCIVVSHLKRVTPCQPDHVEEEIPWTDDRDYWWHEEMEDKEP-ACYPEWMDAEDPLFMLYTSGSTGKPKGVLHTTAGYLLYAATTFKIVFDYKPGDIYWCTGDVGWITGHTYVVYGPLANGATSVIFEGTPFFP-GNDRYWSVIDKYKVTQFYTAPTAIRALMKFGEGPVLKHNLSGLKVLGSVGEPINPEAWLWYYKYIGKEQCSIVDTFWQTETGGHVITPLPGATPMKPGSASFPFFGVKPTLLDECGIEIKGEGE-GYLVFSQPW-PGMMRTLYNNHERFEDTYFSKFPGYYCTGDGARRDADGYLWITGRVDDMLNVSGHLMSTAEVESVLTEHPRVAESAVVSRPHPVKGECLYCFI-TPNENEVFDQKLISDLKKMVRERIGPFAMPDVIQNAPGLPKTRSGKIMRRVLRKIA 494          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 400.979 bits (1029), Expect = 4.524e-131
Identity = 216/624 (34.62%), Postives = 358/624 (57.37%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADI-KL-PYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVT----GYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
            YED + L+  +P+  W E A  + W + +T  + N D   P WF GG++N+ YN +D+HV +G GD  A+IY+  +T T + +TY+++   V  LAGV+V K  V+ GD V++Y P+  Q +  MLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   VE A++LS   P   L+YNR + +         LDWE E+ TA PH  V + ++HP+Y++YTSGTTG PK +V  +G   V   + +  V G+   + +W  SD GW+ G + + YGPLL G T +LYEGKP+         ++++ H  A   + PT  R +++   +A+  KL P  +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+   ++  P  T+G I++K P+ P AAL++++NH  + +L+FTK+ GY+DTMD G ++++G L +++RS+ +I ++   +  G +EE  L +  +++ AVV L+D + G VP+A   ++ND   + +++++ +++LV   +G    F+    V  LPK R+GK+ R SL  + N K + +   +E P VFK+I  +L
Sbjct:    2 YEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPKGVVRDSGGYAVMLNWTMSNVYGLAPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDMQQVKPR-TLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 623          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:ZFIN;Acc:ZDB-GENE-060503-816])

HSP 1 Score: 382.489 bits (981), Expect = 3.119e-123
Identity = 211/625 (33.76%), Postives = 347/625 (55.52%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADI-KL-PYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYG----YYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
             YED + L+  +P+  W E A  + W + +T  + N D   P WF GG++N+ YN +D+HV +G GD  A+IY+  +T T + +TY+++   V  LAGV+V K  V+ GD V++Y P+  Q +  MLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   VE A++LS   P   L+YNR + +         LDWE E+ TA PH  V + ++HP+Y++YTSGTTG PK                            +W  SD GW+ G + + YGPLL G T +LYEGKP+         ++++ H  A   + PT  R +++   +A+  KL P  +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+   ++  P  T+G I++K P+ P AAL++++NH  + +L+FTK+ GY+DTMD G ++++G L +++RS+ +I ++   +  G +EE  L +  +++ AVV L+D + G VP+A   ++ND   + +++++ +++LV   +G    F+    V  LPK R+GK+ R SL  + N K + +   +E P VFK+I  +L
Sbjct:   83 TYEDAFGLARDKPDTFWSEAALGITWFERWTKTLDNTDLVFPKWFVGGKLNVCYNAVDRHVENGRGDQAAVIYDSPVTGTKQVITYREVQEQVSRLAGVLV-KHGVKMGDLVVIYMPMVPQAMFTMLACARIGATHSLIFGGFASKELSSRIDHAKPKLLVTASFGIEPGRLVEYIPLVEKALELSTHKPHKVLIYNRPSMEKVSTRPDLTLDWEEEMSTARPHDCVSVSAHHPLYVLYTSGTTGSPKV---------------------------WWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDPGAFFRVMSEHGTACMFTAPTAIRAIRQQDPQAEHGKLYPLNRLRNLFVAGERCDIETLEWAKKSFGVPVLDHWWQTESGSSITASCVGLGCSLAPPPGTAGKPVPGYNVTVIDDDMQQVKPR-TLGNIVVKLPLPPGAALSLWQNHMLFKELYFTKFTGYYDTMDAGFVDEEGFLYIMARSDDVINVAGHRLSTGALEESVLLHPAVVDCAVVGLEDSLKGHVPLALCVLRNDCKESEDDLVKGLVKLVRDTIGPVAAFRKVFFVKALPKTRSGKIPRSSLANLVNQKPYKISPTIEDPEVFKDIEKML 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss1 (acyl-CoA synthetase short chain family member 1 [Source:ZFIN;Acc:ZDB-GENE-050320-139])

HSP 1 Score: 268.855 bits (686), Expect = 6.225e-80
Identity = 193/618 (31.23%), Postives = 301/618 (48.71%), Query Frame = 3
Query:   36 QMLGSNYEDVYKLSISQPEKIWDELAKE-VIWTKPYTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCH-VRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAA-VPLESNHPMYIIYTSGTTGEPKALVMGTGN----SIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
             + G NY D+Y+LS+  PE  W  +AKE + WTKP+  V   + S   I WF GG++N+S NCLD HV +     VA+I+E     T ER+TY++LL +   LA  +  K H V++G+RV +Y PV+   VAAMLAC RIGAV+ V+F+    + +A ++   + K VIT N G   GR    K  V+ A+K     P    V+    T+ +  +   D+  E  +   +   A  P+ES   ++++YTSG+TG+PK +V         + +T +Y   Y  G    D F   +D GWI+G + + YGPL  G T +L+E  P+         + + R  +  F   PT  R++ K       K     LK +   GE  N E   W   +      P+ + W Q+E G       P   G      RP      P F I P+++  K +    N   G + +  P  P  A TI+ +HQ+++D +F  Y G + T D     +DG  Q+  R + +I IS   +    IE+   ++  +   AV+ +   + G+VP AF+ +K         V+  +  LV  K+  +    + ++V  LPK R+GK++R  L  +A
Sbjct:   56 HLSGRNYADLYELSVKDPENFWGSIAKERLAWTKPFDQVSDCDISSGKINWFLGGQLNVSVNCLDVHVAND-PSRVALIWEKDEPGTEERITYRELLEMTCRLANTL--KSHGVQRGERVAIYMPVSPMAVAAMLACARIGAVHTVVFAGFSSEALAGRIQDAQCKFVITCNQGVRGGRVFDLKSTVDKAVK---SCPSVRHVFVAKRTNNSVPMGKLDIPLEEVMAGQSSECAPEPMESEEMLFMLYTSGSTGKPKGIVHTQAGYLLYASLTHQYVFDYTPG----DVFGCVADIGWITGHSYVVYGPLCNGATSVLFESTPVYPNP-GRYWETVQRLRINQFYGAPTAIRLLLKYEESWVKKYDRSSLKTLASVGEPINHEAWDWFHNVVGDGRCPLVDTWWQTETGGVCIAPLPAEPGAE---IRPAM-AMRPFFGIKPELLGEKGQIITGNDVNGALCISQPW-PGMARTIFGDHQRFVDAYFKPYQGQYFTGDGAYRTEDGYYQITGRMDDVINISGHRLGTAEIEDALDEHPDVPETAVIGIPHEIKGEVPFAFVVLKESAAENQQAVVNELRHLVASKIAKYAVPDHFLVVKRLPKTRSGKIMRRILRKVA 657          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 233.417 bits (594), Expect = 6.460e-67
Identity = 178/635 (28.03%), Postives = 305/635 (48.03%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLD-GYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTD----------PAKMVNGK---------DLDWETEIKTATPHAA-VPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
             Y+++Y  S+  PE+ W ++AK+  W   YT    + +  +          +G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V   A V+ ++  V+KGDRV +Y P+ ++ V AMLAC RIGAV+ ++F+    + + E++  ++  L+IT +  Y   + I  K   ++A+K  +   F  + C++   L  +          PAK              D+ W + I  A+     V  +S  P++I+YTSG+TG+PK ++      ++      K V      D +W  +D GWI+G + +TYGPL  G T +L+EG P T   ++ + +I+++++V+ F + PT  R++ K   +   K     LK +   GE  N E  QW   +      P+ + + Q+E G       P  T    G        + P F + P I+N   EE L   + G ++ K P  P    T+Y NH ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + ND    N ++   + + V +K+G           P LPK R+GK++R  L  +A
Sbjct:   29 KYKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRACPDLQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPG------SATFPFFGVVPAILNESGEE-LEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTL-NDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIA 652          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 227.639 bits (579), Expect = 1.046e-64
Identity = 179/652 (27.45%), Postives = 306/652 (46.93%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLD-GYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTD----------PAKMVNGKDLDWETE---IKTATPHAAVP------------------------LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA 1835
             Y+++Y  S+  PE+ W ++AK+  W   YT    + +  +          +G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V   A V+ ++  V+KGDRV +Y P+ ++ V AMLAC RIGAV+ ++F+    + + E++  ++  L+IT +  Y   + I  K   ++A+K  +   F  + C++   L  +          PAK     DL  E +   ++   P   VP                         +S  P++I+YTSG+TG+PK ++      ++      K V      D +W  +D GWI+G + +TYGPL  G T +L+EG P T   ++ + +I+++++V+ F + PT  R++ K   +   K     LK +   GE  N E  QW   +      P+ + + Q+E G       P  T    G        + P F + P I+N   EE L   + G ++ K P  P    T+Y NH ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + ND    N ++   + + V +K+G           P LPK R+GK++R  L  +A
Sbjct:   29 KYKELYIKSVESPEEFWADVAKDFFWKTKYTGKFLDYNFDVTKGEIYIKCMEGATTNICYNVLDRNVHERKLGDRVAFYWEGNEPGDEKTVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSSESLCERIMDSQCCLLITADGFYRGDKLINLKLIADEALKKCRDKSFPVEKCIMLKHLTKEDEASSGSLSPPAKRAC-PDLQQEKQKERVRKVRPPPQVPWNPEVDMCWHSLIGGASEECEPVWCDSEDPLFILYTSGSTGKPKGVLHTVSGYMLYTASTFKMVFDYHSDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGSDPVHKYKRTSLKILGTVGEPINPEAWQWYYNVVGEKRCPVVDTFWQTETGGHVMTPLPAATPMKPG------SATFPFFGVVPAILNESGEE-LEGPSEGYLVFKQPW-PGVMRTVYGNHLRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGRPHPVKGESLYCFVTL-NDGINYNQKLEAELKKQVREKIGAIATPDYIQNAPGLPKTRSGKIMRRVLRKIA 668          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 446.817 bits (1148), Expect = 1.175e-147
Identity = 229/626 (36.58%), Postives = 368/626 (58.79%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK + +   +E P VFK + D +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 435.647 bits (1119), Expect = 3.658e-143
Identity = 223/607 (36.74%), Postives = 358/607 (58.98%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 689          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 430.254 bits (1105), Expect = 1.690e-141
Identity = 225/609 (36.95%), Postives = 359/609 (58.95%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMV--NGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     MV   G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   81 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPN-----MVCNAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 416.772 bits (1070), Expect = 3.376e-136
Identity = 219/607 (36.08%), Postives = 348/607 (57.33%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK                            +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKV---------------------------WWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 662          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Match: ACSS3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:100489184])

HSP 1 Score: 417.157 bits (1071), Expect = 3.917e-136
Identity = 214/603 (35.49%), Postives = 347/603 (57.55%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G          P       +     ++ L    +    L+ P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGL---GNSLKPPAGQAGKPVPGYNGKQNLRKLLLATYPLRLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 683          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 417.542 bits (1072), Expect = 8.392e-137
Identity = 219/632 (34.65%), Postives = 366/632 (57.91%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            G  Y+  +  S++ PE+ W + A+++ W KP+T  +++   P   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T T   ++Y+++L  V  LAGV+V K  V+KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   +E+A+++ Q  PD  L+Y+R N +   +++G+DLDWE E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T    G             + +P +++   +I     ++L   ++G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   +K D   +  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  I +VL  A
Sbjct:   54 GGEYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNV---MILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss3 (acyl-CoA synthetase short-chain family member 3 [Source:MGI Symbol;Acc:MGI:2685720])

HSP 1 Score: 304.294 bits (778), Expect = 1.806e-95
Identity = 145/401 (36.16%), Postives = 238/401 (59.35%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVT 1241
            G  Y+  +  S++ PE+ W + A+++ W KP+T  +++   P   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T T   ++Y+++L  V  LAGV+V K  V+KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   +E+A+++ Q  PD  L+Y+R N +   +++G+DLDWE E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T
Sbjct:   54 GGEYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPIT 453          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss1 (acyl-CoA synthetase short-chain family member 1 [Source:MGI Symbol;Acc:MGI:1915988])

HSP 1 Score: 241.891 bits (616), Expect = 5.411e-70
Identity = 185/633 (29.23%), Postives = 308/633 (48.66%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKE-VIWTKPYTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVP--LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELGPLVTGYHYGYYRPNYDES--------MPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXL-VTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSL--LYMANGKQWTMPVNVEKPHVFKEI 1895
            +Y  +   +  +P   W  LA++ ++W  PY +V   +     I WF GG++N+S NCLD+HV     + +A+I+E     T  R+TY++LL     LA  +  +  V +GDRV +Y PV+   VAAMLAC RIGA++ V+F+    + +A ++   + K VIT N G   GR ++ K+ V++A+K    +  + LV +R  TD    +   D+  E E+    P    P  + S   ++++YTSG+TG PK LV      ++      K V   +  D F   +D GWI+G + + YGPL  G T +L+E  P+  +A     + + R  +  F   PT  R++ K       K     L+ +   GE  N E  +W+ K+       + + W Q+E G +         RP+ D +         P F I P +++ K    L  G V   +  +   P  A TIY +HQ+++D +F  YPGY+ T D     + G  Q+  R + +I IS   +    IE+    +  +   AV+     + G+   AF+ +K++  I++  ++ N ++L V  K+  +      ++V  LPK R+GK++R  L  +  + G+       +E P V  EI
Sbjct:   50 SYPALSAQAAQEPAAFWGPLARDTLVWDTPYHTVWDCDFRTGKIGWFLGGQLNVSVNCLDQHVQKSP-ETIALIWERDEPGTEVRITYRELLETTCRLANTL-KRHGVHRGDRVAIYMPVSPLAVAAMLACARIGAIHTVVFAGFSAESLAGRINDAKCKAVITFNQGLRGGRVVELKKIVDEAVKSCPTV-QHVLVAHR--TDTKVPMGSLDIPLEQEMAKEAP-VCTPESMSSEDMLFMLYTSGSTGTPKGLVHTQAGYLLYAAMTHKLVFDYQPGDVFGCVADIGWITGHSYVVYGPLCNGATTVLFESTPVYPDA-GRYWETVQRLKINQFYGAPTAVRLLLKYGDAWVKKYDRSSLRTLGSVGEPINHEAWEWLHKVVGDGRCTLVDTWWQTETGGICIA-----PRPSEDGAEILPGMAMRPFFGIVPVLMDEKG-NVLEGGDVSGALCISQAWPGMARTIYGDHQRFVDAYFRAYPGYYFTGDGAHRTEGGYYQITGRMDDVINISGHRLGTAEIEDAMADHPAVPETAVIGYPHDIKGEAAFAFIVLKDN--ISDENMVVNELKLSVATKIAKYAVPDQILVVKRLPKTRSGKVMRRLLRKIITSRGQDLGDTTTLEDPSVITEI 667          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 222.631 bits (566), Expect = 6.949e-63
Identity = 175/639 (27.39%), Postives = 296/639 (46.32%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTK--PYTSVIKNEDSP----IPIWFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRL-------NTDPAKMV--------------NGKDLDWETEIKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN 1838
              Y ++++ S+ +P + W  +AKE  W    P   +  N D         W  G   N+ YN LD++V +   GD VA  +E      + ++TY++LL  V   + V+  K  ++KGDRV +Y P+ ++ V AMLAC R+GA++ ++F+    + + E++  +   L+ITT+  Y   + +  KE  +++++  +   F    C+V   L       N  P++                 G DL W   ++ A         ++  P++I+YTSG+TG+PK +V   G  ++      KYV     +D FW  +D GWI+G + +TYGPL  G T +L+EG P T      +  I++++ V  F + PT  R++ K   +   K     L+ +   GE  N E   W  ++  S   PI + + Q+E G       P  T    G        S P F + P I+N   EE       G ++ K P  P    T+Y NH ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    +     E   + + +K+G           P LPK R+GK++R  L  +A 
Sbjct:   45 QRYRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPG------SASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQ-IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQ 672          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Match: Acss2 (acyl-CoA synthetase short-chain family member 2 [Source:MGI Symbol;Acc:MGI:1890410])

HSP 1 Score: 219.164 bits (557), Expect = 1.851e-61
Identity = 177/652 (27.15%), Postives = 298/652 (45.71%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTK--PYTSVIKNEDSP----IPIWFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRL-------NTDPAKM---------VNGK------------------DLDWETEIKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN 1838
              Y ++++ S+ +P + W  +AKE  W    P   +  N D         W  G   N+ YN LD++V +   GD VA  +E      + ++TY++LL  V   + V+  K  ++KGDRV +Y P+ ++ V AMLAC R+GA++ ++F+    + + E++  +   L+ITT+  Y   + +  KE  +++++  +   F    C+V   L       N  P++          V GK                  DL W   ++ A         ++  P++I+YTSG+TG+PK +V   G  ++      KYV     +D FW  +D GWI+G + +TYGPL  G T +L+EG P T      +  I++++ V  F + PT  R++ K   +   K     L+ +   GE  N E   W  ++  S   PI + + Q+E G       P  T    G        S P F + P I+N   EE       G ++ K P  P    T+Y NH ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    +     E   + + +K+G           P LPK R+GK++R  L  +A 
Sbjct:   45 QRYRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTKGKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQFSNVL-RKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDSSCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPSQSPPVKRPCPDVQGKLREKSKCIRPQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPKGVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFEGIP-TYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPINPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPG------SASFPFFGVAPAILNESGEELE-GEAEGYLVFKQPW-PGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCDGHTFSPTLTEELKKQ-IREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQ 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A0A0G2K047|ACSS3_RAT (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acss3 PE=1 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 1.530e-138
Identity = 223/632 (35.28%), Postives = 367/632 (58.07%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            G  Y+  +  S++ PE+ W + A+++ W KP+T  ++N   P   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T T   ++Y+++L  V  LAGV+V K  V+KGD V++Y P+  Q + AMLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   +E+A+++ Q  PD  L+YNR N +   +++G+DLDWE E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T    G             + +P +++   +I     ++L   ++G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   +K D   T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  I +VL  A
Sbjct:   55 GGEYKTHFAASVADPERFWGKAAEQISWYKPWTKTLENRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYAMLACARIGAIHSLIFGGFASKELSTRIDHVKPKVVVTASFGIEPGRKVEYMPLLEEALRIGQHKPDRLLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNV---MILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVTDCAVVGKEDPLKGHVPLALCVLKKDVNATEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q9H6R3|ACSS3_HUMAN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens OX=9606 GN=ACSS3 PE=1 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.558e-137
Identity = 221/632 (34.97%), Postives = 366/632 (57.91%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            GS Y+  +  S++ PE+ W + A+++ W KP+T  ++N+ SP   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T+T    TY+++L  V  LAGV+V K  ++KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   VE+A+K+ Q  PD  L+YNR N +   +  G+DLDW+ E+  A  H  VP+ S HP+YI+YTSGTTG PK ++  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W   +F  P+ + W Q+E G  +T    G             +S+P +++   +I     ++L    +G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   ++ D   T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  + ++L  A
Sbjct:   59 GSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV---MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q5REB8|ACSS3_PONAB (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii OX=9601 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.679e-137
Identity = 220/632 (34.81%), Postives = 366/632 (57.91%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            GS Y+  +  S++ PE+ W + A+++ W KP+T  ++N+ SP   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T+T    TY+++L  V  LAGV+V K  ++KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   VE+A+K+ Q  PD  L+YNR N +   +  G+DLDW+ E+  A  H  VP+ S HP+YI+YTSGTTG PK ++  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W   +F  P+ + W Q+E G  +T    G             +S+P +++   +I     ++L    +G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G + V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   ++ D   T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  + ++L  A
Sbjct:   59 GSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTSWFVEGMLNVCYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLV-KHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLNWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTETGSPITASCVGLGNSKTPPPGQAGKSVPGYNV---MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGAIEESILSHGTVADCAVVGKEDPLKGHVPLALCVLRKDINATEEQVLEEIVKHVRQNIGPVAAFRNAVFVKQLPKTRSGKIPRSALSAIVNGKPYKITSTIEDPSIFGHVEEMLKQA 686          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|Q14DH7|ACSS3_MOUSE (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus OX=10090 GN=Acss3 PE=1 SV=2)

HSP 1 Score: 417.542 bits (1072), Expect = 5.870e-136
Identity = 219/632 (34.65%), Postives = 366/632 (57.91%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            G  Y+  +  S++ PE+ W + A+++ W KP+T  +++   P   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T T   ++Y+++L  V  LAGV+V K  V+KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PK+V+T + G EPGR ++Y   +E+A+++ Q  PD  L+Y+R N +   +++G+DLDWE E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T    G             + +P +++   +I     ++L   ++G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   +K D   +  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  I +VL  A
Sbjct:   54 GGEYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTDTKATISYKEVLEQVSKLAGVLV-KQGVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHAKPKVVVTASFGIEPGRKVEYIPLLEEALRIGQHRPDRVLIYSRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKCVPGYNV---MILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDVNASEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVLKQA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Match: sp|A7MB45|ACSS3_BOVIN (Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus OX=9913 GN=ACSS3 PE=2 SV=1)

HSP 1 Score: 412.535 bits (1059), Expect = 5.958e-134
Identity = 222/632 (35.13%), Postives = 362/632 (57.28%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINA 1916
            G  Y+  +  S++ PE+ W + A+++ W KP+T  ++N  SP   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T+T   +TY+++L  V  LAGV+V K  V+KGD V++Y P+  Q + AMLAC RIGA++ +IF       ++ ++   +PKLVIT + G EPGR ++Y   VE+A+++ Q  PD  L+YNR +TD   +  G  LDW+ E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T    G             +S+P +++   +I     ++L    +G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G + V+SR + +I ++   I  G +EE  L    + + AVV  +D + G +P+A   +K D   T   V+E I++ V + +G    F+ AV V +LPK R+GK+ R +L  + NGK + +   +E P +F+ I  +L  A
Sbjct:   58 GGEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENRHSPSTSWFVEGMLNICYNAIDRHIENGKGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLV-KHGVKKGDTVVIYMPMIPQAMYAMLACARIGAIHSLIFGGFASKELSTRIDHAKPKLVITASFGIEPGRKVEYVPLVEEALRIGQHKPDKVLIYNRPHTDMVPLAPGYYLDWDEELSKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWSMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGKSVPGYNV---MILDDNMQKLKARCLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYVYVMSRVDDVINVAGHRISAGALEESILSLGIVADCAVVGKEDSLKGHIPLALCVLKKDINTTEEHVLEEIVKHVRQTIGPVAAFRKAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVSPTIEDPGIFEHIEAMLKQA 685          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A5G3KCT6 (Acyl-CoA synthetase short chain family member 3 OS=Xenopus tropicalis OX=8364 GN=acss3 PE=4 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 1.845e-144
Identity = 229/626 (36.58%), Postives = 368/626 (58.79%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK + +   +E P VFK + D +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFKYVEDAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A1L8GY84 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=acss3 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 9.253e-144
Identity = 226/626 (36.10%), Postives = 371/626 (59.27%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
            +NY+ V++ S+ QPE++W E ++++ W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AII++  +T   + +TY+++   V  LA V+ +K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  L+Y+R N   A++++ +DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  T    V   + +  V G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   +A++  P+   + + + + GE  + E  +W  KIF+ P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + D++F K+PGY+DTMD G  +DDG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   +KN    T  ++   I+  V + +G    F+  VIV +LPK R+GK+ R +L  + NGK + +   +E P VF+ + + +
Sbjct:   85 ANYDHVFESSVQQPERVWGEASEKISWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQTAIIHDSPVTGIKQAITYREIYEQVSRLASVL-SKYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPNKILIYSRPNMKEARLMDDRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSTAGYTVMLNWTMSAVYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPDAEMGKPFSLTKFRTLFVAGERCDVETLEWSRKIFNVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNNMQEAKPN-TLGNIVVKLPLPPGAFATLWKNDAMFKDIYFQKFPGYYDTMDAGYKDDDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKDVADCAVVALEDPLKGHVPLALCVLKNGVGQTKEKIESEIVASVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSYKIGSTIEDPDVFRSVEEAV 708          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A5G3KE57 (Acyl-CoA synthetase short chain family member 3 OS=Xenopus tropicalis OX=8364 GN=acss3 PE=4 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 5.744e-140
Identity = 223/607 (36.74%), Postives = 358/607 (58.98%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     +  G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   85 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPNMKEVPLKAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 689          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A5G3KEF2 (Acyl-CoA synthetase short chain family member 3 OS=Xenopus tropicalis OX=8364 GN=acss3 PE=4 SV=1)

HSP 1 Score: 430.254 bits (1105), Expect = 2.654e-138
Identity = 225/609 (36.95%), Postives = 359/609 (58.95%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMV--NGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYR----PNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQW 1850
            +NYE +++ S+ +PEK+W E A  + W KP++ ++ N + P   WF  GE+N+ YN +D+H+  G GD  AIIY+  +T+T + +TY+++   V  LA V+  K  V+KGDRV++Y P+  Q   AMLAC RIGA++ +IF       +A ++   +PKL+IT + G EPGR ++Y   VE A+++++  P+  ++Y+R N     MV   G+DLDW  EI  A PH  VP+ S HP+Y++YTSGTTG PK +V  +    V   + +  + G+   D +W  SD GW+ G + + YGPLL G T +LYEGKP+     +   ++++ H VA   + PT  R +++   EA++  P+   + + + + GE  + E  +W  +IF  P+ + W Q+E G  +T    G       P      P    N KI+++  +E  PN T+G I++K P+ P A  T++KN   + DL+FTK+PGY+DTMD G  ++DG + VLSR + +I ++   +  G IEE  L ++ + + AVV L+DP+ G VP+A   ++N    T  ++   I+ LV + +G    F+  VIV +LPK R+GK+ R +L  + NGK +
Sbjct:   81 ANYEHIFQSSVQEPEKVWGEAAGNIAWFKPWSKIMDNSNPPFTKWFIDGELNICYNAVDRHIESGRGDQPAIIYDSPVTNTKQAITYKEIYEQVSRLASVLC-KYGVKKGDRVVIYMPMIPQATYAMLACARIGAIHSLIFGGFASKELAVRIDHAKPKLIITASFGIEPGRKVEYVPLVERALEIAEHKPEKIVIYSRPN-----MVCNAGRDLDWTEEISKAHPHDCVPVSSEHPLYVLYTSGTTGLPKGVVRSSAGYTVMLNWTMSSIYGLNPGDVWWAASDLGWVVGHSYICYGPLLHGNTSVLYEGKPVGTPDASAYFRVLSEHGVAAMFTAPTALRAIRQQDPEAELGKPFSLTKFRTLFVAGERCDVETLEWSRQIFKVPVLDHWWQTETGSPITATCIGLGNSLKPPAGQAGKPVPGYNVKILDNDMQEANPN-TLGNIVVKLPLPPGAFATLWKNDAMFQDLYFTKFPGYYDTMDAGYKDEDGYIYVLSRVDDVINVAGHRLSAGAIEESVLLHKAVADCAVVGLEDPLKGHVPLALCVLRNGVDKTTEKIENEIVALVREHIGPVAAFRKVVIVKQLPKTRSGKIPRSTLSALVNGKSY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Match: A0A3Q0CNP1 (acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mesocricetus auratus OX=10036 GN=Acss3 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 8.799e-137
Identity = 222/629 (35.29%), Postives = 368/629 (58.51%), Query Frame = 3
Query:   45 GSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYK--QLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVL 1907
            G  Y+  +  S++ PE+ W + A+++ W KP+T  +++   P   WF  G +N+ YN +D+H+ +G GD +AIIY+  +T+T   +TY+++L  V  LAGV+VN+  V+KGD V++Y P+  Q +  MLAC RIGA++ +IF       ++ ++   +PKLV+T + G EPGR ++Y   +E+A+++ Q  PD  L+YNR N +   +++G+DLDWE E+  A  H  VP+ S HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYEGKP+         +++  H VA   + PT  R +++    A +   Y   + K + + GE  + E  +W  K+F  P+ + W Q+E G  +T    G             + +P +++   +I     ++L   ++G I++K P+ P A   ++KN + +  L+F K+PGY+DTMD G ++++G L V+SR + +I ++   I  G IEE  L +  + + AVV  +DP+ G VP+A   +K D  +T  +V+E I++ V + +G    F+NAV V +LPK R+GK+ R +L  + NGK + +   +E P +F  I +VL
Sbjct:   54 GGEYKTHFAASVADPERFWGKAAEQISWYKPWTKTLESRYPPSTSWFVEGMLNICYNAIDRHIENGQGDKIAIIYDSPVTNTKATITYKEVLEQVSKLAGVLVNQ-GVKKGDTVVIYMPMIPQAIYTMLACARIGAIHSLIFGGFASKELSTRIDHVKPKLVVTASFGIEPGRKVEYVPLLEEALRIGQHRPDRVLIYNRPNMEKVPLMSGRDLDWEEEMAKAQSHDCVPVVSEHPLYILYTSGTTGLPKGVVRPTGGYAVMLNWTMSSIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKKVFRVPVLDHWWQTETGSPITASCIGLGNSKTPPPGQAGQCVPGYNV---MILDDNMQKLKARSLGNIVVKLPLPPGAFSGLWKNQEAFKHLYFEKFPGYYDTMDAGYMDEEGYLYVMSRVDDVINVAGHRISAGAIEESVLSHGTVADCAVVGKEDPLKGHVPLALCVLKKDINVTEEQVLEEIVKHVRQSIGPVAAFRNAVFVKQLPKTRSGKIPRSTLSALVNGKPYKVTPTIEDPSIFGHIEEVL 678          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000043882.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:22941:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000043882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.121 bits (614), Expect = 6.835e-71
Identity = 119/306 (38.89%), Postives = 179/306 (58.50%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYE 971
            YE  ++ +  +PE+ W E A+ V W   +   +       P WF GGE+NM YN +D+HV  G G+  AII++  +T + +  TY+++   V  LAGV+V K  VRKGD V++Y P+  Q +  MLAC RIGA + +IF       ++ ++   +PKL++T + G EPG+ ++Y   VE A++LS   P   L+YNR   +   M +G  LDW+ E+ TA P   V + S+HP+Y++YTSGTTG PK +V  TG   V   + +  V G+   + +W  SD GW+ G + + Y PLL G T +LYE
Sbjct:  167 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNRPGMERVAMSSGLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 471          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: ENSAMXT00000036840.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000552.1:6561:23509:-1 gene:ENSAMXG00000036566.1 transcript:ENSAMXT00000036840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 232.646 bits (592), Expect = 7.644e-69
Identity = 118/306 (38.56%), Postives = 177/306 (57.84%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYE 971
            YE  ++ +  +PE+ W E A+ V W   +   +       P WF GGE+NM YN +D+HV  G G+  AII++  +T + +  TY+++   V  LAGV+V K  VRKGD V++Y P+  Q +  MLAC RIGA + +IF       ++ ++   +PKL++T + G EPG+ ++Y   VE A++LS   P   L+YNR    P  +     LDW+ E+ TA P   V + S+HP+Y++YTSGTTG PK +V  TG   V   + +  V G+   + +W  SD GW+ G + + Y PLL G T +LYE
Sbjct:   68 YEGAFRGARDEPERFWGEAARGVSWFTSWEKTLDCSHPAFPRWFVGGELNMCYNAVDRHVESGRGEQPAIIHDSPVTGSKQIFTYREVQDEVSRLAGVLV-KHGVRKGDLVVIYMPMVPQAMFTMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLLVTASFGVEPGQRVEYIPLVEKALELSSHKPHKVLIYNR----PGMVRPCLGLDWDEEMATARPQDCVGVPSDHPLYVLYTSGTTGTPKGVVRDTGGYAVILNWTMNSVYGLNPGEVWWAASDLGWVVGHSYICYAPLLHGNTTVLYE 368          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 235.343 bits (599), Expect = 1.233e-67
Identity = 179/641 (27.93%), Postives = 309/641 (48.21%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTD------------PAK------MVNGK---DLDWETEIKTATPHAA-VPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            N++++Y  S+  PE+ W ++AKE  W   +T    + +  +          +G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V   A V+ ++  V+KGDRV +Y P+ ++ V AMLAC RIGAV+ ++F+    + + E++  +   L+IT +  Y   + I  K   ++A++  +   F  + C+V   L+ +            PAK       V  K   D+ W + ++ A+     V  ES  P++I+YTSG+TG+PK ++      ++      K V      D +W  +D GWI+G + +TYGPL  G T +L+EG P T   ++ + +I+++++V+ F + PT  R++ K   +   K     LK +   GE  N E  QW   +      P+ + + Q+E G       P  T    G        + P F + P I+N   EE L     G ++ K P  P    T++ NHQ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    T     E   + V +K+G           P LPK R+GK++R  L  +A+ ++
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPG------SATFPFFGVVPAILNESGEE-LEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQ-VREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQR 658          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:NCBI gene;Acc:103041660])

HSP 1 Score: 228.409 bits (581), Expect = 4.983e-65
Identity = 178/657 (27.09%), Postives = 308/657 (46.88%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPI------WFDGGEINMSYNCLDKHVLDG-YGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQ---FIPDYCLVYNRLNTD------------PAKMV---------NGK----------------DLDWETEIKTATPHAA-VPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            N++++Y  S+  PE+ W ++AKE  W   +T    + +  +          +G   N+ YN LD++V +   GD VA  +E       + +TY++LL  V   A V+ ++  V+KGDRV +Y P+ ++ V AMLAC RIGAV+ ++F+    + + E++  +   L+IT +  Y   + I  K   ++A++  +   F  + C+V   L+ +            PAK            G                 D+ W + ++ A+     V  ES  P++I+YTSG+TG+PK ++      ++      K V      D +W  +D GWI+G + +TYGPL  G T +L+EG P T   ++ + +I+++++V+ F + PT  R++ K   +   K     LK +   GE  N E  QW   +      P+ + + Q+E G       P  T    G        + P F + P I+N   EE L     G ++ K P  P    T++ NHQ++   +F K+PGY+ T D    + DG   +  R + ++ +S   +    +E   +++E +  AAVV    PV G+    F+ + +    T     E   + V +K+G           P LPK R+GK++R  L  +A+ ++
Sbjct:   29 NFKELYVKSVESPEEFWGDVAKEFFWKTKHTGQFLDYNFDVTKGEIFVKCMEGATTNICYNVLDRNVYEKKLGDRVAFYWEGNEPGDEKIVTYRELLQQVCKFANVLKSQ-GVKKGDRVSIYMPMVVELVVAMLACARIGAVHSIVFAGFSAESLCERIIDSRCSLLITADGFYRGDKLINLKLIADEALQKCRDKSFPVERCIVLKHLSKEEHESLSLGSLSPPAKRSCPDLQQEKQKGNVRKVRSIPKVPWKPEVDVCWHSLMEGASDECEPVWCESEDPLFILYTSGSTGKPKGVLHTVSGYMLYTATTFKLVFDYHPDDIYWCTADIGWITGHSYITYGPLANGATSVLFEGLP-TYPDVSRMWEIVDKYHVSKFYTAPTAIRLLMKYGNDPVHKYKRSSLKILGTVGEPINPEAWQWYYNVVGEGRCPVVDTFWQTETGGHVLTPLPAATPLKPG------SATFPFFGVVPAILNESGEE-LEGPNEGYLVFKQPW-PGVMRTVFGNHQRFETTYFKKFPGYYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGTPHPVKGESLYCFVTLADGMNYTTTLEAELKKQ-VREKIGAIATPDYIQNAPGLPKTRSGKIMRRLLRKIASNQR 674          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Match: acss2l (acetyl-coenzyme A synthetase, cytoplasmic-like [Source:NCBI gene;Acc:107197877])

HSP 1 Score: 213.001 bits (541), Expect = 1.372e-59
Identity = 174/643 (27.06%), Postives = 299/643 (46.50%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVI------KNEDSPIPIWFDGGEINMSYNCLDKHVLD-GYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDP-------AKMVNGKDLD-------------WETEIKTATPHAAVP--LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELG-------PLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVG-----DFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            +Y  +YK SI +PE+ W ++A+E  W +P +  +        +      + +G + NM YN LD++VLD   G  VA  +E         +TY QLL  V   A  +  +  V+KGDRV +Y P+  + V +MLAC RIGAV+ ++F+    + +AE++   +  +++T +  Y   + IK K+  ++A+       D+C   N L           A  ++G D               W  E          P  +E+  P++I+YTSG+TG+PK ++      ++      KYV    R D +W  +D GWI+G + +TYGPL  G T +L+EG P+    +    +II ++ V+ F + PT  R++ K   E   K     L+ +   GE  N E   W          P+ + + Q+E G       P  T    G        ++P F + P I+N   EE       G ++ + P  P     +Y N +++ + +F K+PG++ T D    + DG   +  R + ++ +S   +    +E    ++  +  AAVV     + G+    F+ +K+ +   +  + E   + V +K+G     DF+  +NA   P LPK R+GK++R  L  +A  ++
Sbjct:   31 SYLALYKKSIEEPEEFWRDVAQEFYWKEPPSGQMLQYNFDATKGKVYVKFMEGAKTNMCYNVLDRNVLDRNLGSRVAFHWEGNSPDHHMTITYSQLLKQVCRCANAL-KQMGVKKGDRVAIYLPMIPELVYSMLACARIGAVHSIVFAGFSSESLAERIMDAQCTVLVTADGVYRGDKLIKLKQISDEAL-------DHCREKNSLTVRKCLVVKHHAFRIHGNDTCNKLQTLWNAECDVWWDEAVEGVSDECDPEWMEAEDPLFILYTSGSTGKPKGVLHTIAGYLLYTSLTFKYVFDHHRDDVYWCTADIGWITGHSYITYGPLANGATSVLFEGIPVHPH-VGRFWEIIEKYRVSKFYTAPTAIRLLMKYGREPLSKYDLSSLRVLGTVGEPINPEAWLWYHDAVGQGRCPVVDTFWQTETGGHVLTPLPAATPLKPG------SATLPFFGVLPIILNEHGEELE-GEAEGYLVFQKPW-PGIMRGVYGNQERFENTYFKKFPGFYVTGDGCRRDKDGYYWITGRIDDMLNVSGHLLSTSEVEAALSEHSAVAEAAVVSRPHTIKGECLYCFVTLKDCREFNHTLLEELKRK-VREKIGPIATPDFI--QNA---PALPKTRSGKIMRRVLRQIARNEK 650          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006895.1 (pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-1 gene:ENSPMAG00000006232.1 transcript:ENSPMAT00000006895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.834 bits (782), Expect = 3.990e-97
Identity = 166/479 (34.66%), Postives = 266/479 (55.53%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAV-FGSMPTFFRIM-----KKLCLEADIKLP-YKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYG----YYRP--NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKY 1451
            Y+  +KL+ S+PE+ W E AK V WTK +  V+ +  SP   WF  G++NM YN LD+HV  G GD  AII++  +T   + +TY+Q L+ V  LA V+V K  V+KGDRV++Y P+  Q + AMLAC RIGA++ +IF       +A ++   +  +V++ + G EPGR + YK  +E A+ ++   P+  LVY+R     A ++ G+D+ W+ E+  A PH  VP+ S+HP+YI+YTSGTTG PK +V  TG   V   + +  + G++  + +W  SD GW+ G + + YGPLL G T +LYE  P          ++  +H + + F   P    I       +L     IK P   + + + + GE  + E   W    F+ P+ + W Q+E G  +T    G     Y P     +S+P + +  ++++S  +E    G +G I++K P++P    T+++N+QKY D +F  +
Sbjct:    1 YDAAFKLAKSEPERFWAEAAKGVAWTKSWDRVLDDSKSPYTRWFVDGQLNMCYNALDRHVEAGRGDQAAIIHDSPVTGIIQTITYRQALSEVTRLASVLV-KNGVQKGDRVVIYMPMIPQAMFAMLACARIGAIHSLIFGGFASKELAVRINHAKVSMVLSASFGIEPGRQVAYKPLLEAALDIATHKPEKVLVYSRPGMARASLIPGRDMCWQEEVSAAKPHDCVPVSSDHPLYILYTSGTTGAPKGVVRPTGGHAVMLNWSMSAIYGLKPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEPAPPVSPPPKVFYEVDEKHGLNLCFIPSPRSHYISLPMSNPQLLYHLYIKTPCVPRFRSMFVAGEICDKETLNWGKATFNVPLLDHWWQTETGSAITATCTGLGGSLYPPAGQCGKSVPGYDV--RVVDSNNQES-KRGNLGNIVVKLPLAPGCMATLWENNQKYEDTYFKSF 475          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: acss2 (acyl-CoA synthetase short chain family member 2 [Source:ZFIN;Acc:ZDB-GENE-040718-388])

HSP 1 Score: 130.568 bits (327), Expect = 6.838e-33
Identity = 102/396 (25.76%), Postives = 184/396 (46.46%), Query Frame = 3
Query:  669 VNGKDLDW-ETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELGPLVTGYHYGY--YRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN 1838
             +G+D  W E     +T       ++  P++++YTSG+TG+PK ++  T   ++      K V  +  +D +W  +D GWI+G + + YGPL  G T +L+EG P   +A     + + ++ V+ F + PT  R++ K      +K   + L+ +   GE  N E   W+  +      PI + + Q+E G  V     G    +P    ++P F + P I++ + EE L     G ++ K P  P    T++ +H++    +F K+PGY+ T D    + DG   +  R++ ++ +S   +    +E   L +  +  AAVV     + G+    F+ + +   +      E     V +K+G           P LPK R+GK++R  L  +A 
Sbjct:    9 TSGRDSWWHELMCGASTTCEPAWCDAEDPLFVLYTSGSTGKPKGVLHTTAGYLLFVATTHKLVFDIRPQDVYWCTADIGWITGHSYIVYGPLANGVTSVLFEGIPTFPDA-GRFWQTVEKYAVSKFYTAPTAVRLLMKHGDAFVLKHSRRSLRVLGTVGEPINREAWHWLHGVVGGGRCPIVDTFWQTETGGHVLTPLPGATPLKPG-SATLPFFGVEPAILDERGEE-LRGEAEGFLVFKRPW-PGILRTVFGDHERLEATYFGKFPGYYATGDGCRRDKDGYYWITGRTDDMLNVSGHLLSTAEVESALLSHGSVAEAAVVGRPHALKGESLYCFVTLNHGLELNPCLAAELKKR-VREKIGPIATPDFIQSAPSLPKTRSGKIMRRLLRKIAQ 399          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005866.1 (pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gene:ENSPMAG00000005307.1 transcript:ENSPMAT00000005866.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 8.914e-9
Identity = 26/60 (43.33%), Postives = 41/60 (68.33%), Query Frame = 3
Query:  297 RMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSS 476
            ++TY++LL  V   + V+++   V KGDRV +Y P+  + V AMLAC R+GAV+ ++ SS
Sbjct:   37 QITYKELLDQVCKCSNVLLSH-GVGKGDRVAIYMPMITELVVAMLACARVGAVHSIVVSS 95          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 281.182 bits (718), Expect = 2.371e-85
Identity = 192/622 (30.87%), Postives = 315/622 (50.64%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVI-WTKPYTSV-IKNEDSPIP-----IWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKT-ATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGI-CIG--GETSNAELRQWISKIFSS---PIHNVWGQSELGP-LVTGYHYGY--YRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXX------LVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQ 1847
            +Y+ ++K SI  P K +   A + + W+KP+  V I +  +  P      WF  G++N  YNC+D+H L    +  AII+E         +TY++LL  V  +A V+     VRKGD V +Y P+  + +  +LA +RIGA++ V+F+    + + +++   + K+VITT+     G+ I+ K  V+DA++ +  +  + LVY + N         +DLDW TE K   T +   P++S  P++++YTSG+TG PK +   T   ++     ++Y     ++D F+   D GWI+G T + YGPLL GC  +++EG P      +    II+ H V  F   PT  R++K+     D  +    LK + C+G  GE   AE+ +W S+       PI + + Q+E G  LVT    G    +P    S P F I+  +++  T E+L       ++      PS A TI+KNH +YLD +   YPGY+ T D    + DG + +L R + ++ +S   +    IE   +++  +   AVV  +D +TGQ   AF+ +KN    +     E           V K +G F   K  ++V +LPK R+GK++R  L  +  G+ 
Sbjct:   75 DYQRLHKESIEDPAKFFGSKATQFLNWSKPFDKVFIPDPKTGRPSFQNNAWFLNGQLNACYNCVDRHALKT-PNKKAIIFEGDEPGQGYSITYKELLEEVCQVAQVLTYSMGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRGGKVIETKRIVDDALRETPGV-RHVLVYRKTNNPSVAFHAPRDLDWATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPN-YSRYWDIIDEHKVTQFYVAPTALRLLKR---AGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPG-SASFPFFGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVGFNDDLTGQAVAAFVVLKNKSSWSTATDDELQDIKKHLVFTVRKDIGPFAAPKLIILVDDLPKTRSGKIMRRILRKILAGES 689          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 263.462 bits (672), Expect = 4.600e-79
Identity = 186/621 (29.95%), Postives = 316/621 (50.89%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVI-WTKPYTSV----IKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEI-KTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSP---IHNVWGQSELGPLVTGYHYGYY--RPNYDESMPNFSINPKIINSKTEEQLPNGTV-GRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKND-----------KPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGK 1844
            +Y+++Y+ SI++PEK +D++AKE + W  PYT V    + N D     WF  G++N SYNC+D+H      D  A+IYE      ++ +T+ +LL  V  +AGV+     V+KGD V +Y P+  + V AMLA  RIGA++ V+F+      + +++     K+VIT + G   G+TI  K+ V++ +     +    LV+ R  T+   M  G+D  W  E  K  T    V  ++  P++++YTSG+TG PK +V  TG  ++      +YV  +  +D  +   D GWI+G T   YGPL +G   I++E  P   +      +II RH    F   PT  R++K++      K     L+ +   GE  + +L +W  +   +    I +   Q+E G  +     G    +P    ++P F IN  II+  T  +L    V G + +K+P  PS A +++ +H +Y+D +   YPG++ T D    + DG   +  R + ++ +S   +    IE     +E +  AAVV + D +TGQ  +A++ +K+            + IT + +   +I  V  ++G F   K  ++V +LP+ R+GK++R  L  +A+ +
Sbjct:   39 HYQEMYQQSINEPEKFFDKMAKEYLHWDAPYTKVQSGSLNNGDVA---WFLNGKLNASYNCVDRHAF-ANPDKPALIYEADDESDNKIITFGELLRKVSQIAGVL-KSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEGLNGVDLV-SRILVFQRTGTEGIPMKAGRDYWWHEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPD-YGRYWRIIQRHKATHFYVAPTALRLIKRVGEAEIAKYDTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPG-SATVPFFGINACIIDPVTGVELEGNDVEGVLAVKSPW-PSMARSVWNHHDRYMDTYLKPYPGHYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGIPDELTGQTVVAYVSLKDGYLQNNATEGDAEHITPDNLRRELILQVRGEIGPFASPKTIILVRDLPRTRSGKIMRRVLRKVASNE 650          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO49293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH51])

HSP 1 Score: 413.305 bits (1061), Expect = 1.637e-135
Identity = 211/632 (33.39%), Postives = 362/632 (57.28%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPY--KQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP------NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGY 1922
             Y++ +K S+  PE  WD++A+ + W KPYT V+ N   P   WF GGE+N  +NCLD+H+ +G G  +A+IY+  ++   E  +YQ L  LV   AG + N  +V KGDRV++Y P+  Q V AMLAC RIGA++ V+F       +A ++   EP++++T + G EP R + YK  V++AIK+S F P   ++Y R +     ++ G+D+ W+  ++ A PH  VP+ +  P+YI+YTSGTTG+PK +V   G   V   + +K + GV   + +W  SD GW+ G + + Y PL  GCT +L+EGKP+         ++I +H V    + PT  RI++    +A++   Y     + + + GE  + +  QW  +  S+P+++ W Q+E G  +T +  G  RP         +++P +++  KI+     E    G +G+I +K P+ P    T+++  +++   +F KYPGY+D+ D G++++DG + +++R++ +I ++   I    +EE  ++  ++++AA + L D + G VP+ F+ V     +   ++I+ + + V + VG    FK AVIVP LPK R+GK +R  L  + +G+ + +   ++ P    +I DVLI+ GY
Sbjct:   56 TYDEAFKQSVEDPEGFWDDVAQGIDWYKPYTKVVDNATPPFTKWFPGGELNTCFNCLDRHIENGIGGRIALIYDSPVSGKIEMYSYQNLQRLVAKFAGAL-NSLNVGKGDRVVIYMPMVPQAVIAMLACARIGAIHSVVFGGFAAAELARRIEHAEPRVIVTASCGIEPSRIVTYKPLVDEAIKISSFKPSTVVLYQR-DQCTGDIIPGRDITWDQVMERAEPHDCVPVLATDPLYILYTSGTTGDPKGIVRRNGGHAVALNWSMKNIYGVNPGEVWWAASDLGWVVGHSYIVYAPLFNGCTTVLFEGKPVGTPDAGAFFRVIEQHKVISMFTAPTAIRIIRTEDPKAELIRQYDLSHFRDMFLAGEHLDKDTMQWARRAISAPVYDNWWQTESGWAITAHTVGLGRPMDEKLETTGKAVPGYNV--KILREDMTEA-DRGELGQICVKLPMPPGTMGTLWRADERFKKTYFEKYPGYYDSSDAGVMDEDGYVSIMARTDDVINVAGHRISTKSLEEGMMKPSFVVDAACIGLKDGIKGHVPLGFVIVDKTVSMKKEDMIKEVKKSVREFVGPVAAFKTAVIVPALPKTRSGKTVRGILAKIVHGEPYKVTPTMDNPQCLDQIKDVLISEGY 682          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO39135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAZ3])

HSP 1 Score: 249.98 bits (637), Expect = 2.429e-74
Identity = 174/570 (30.53%), Postives = 283/570 (49.65%), Query Frame = 3
Query:  180 WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCH-VRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGK-DLDWETEIKTATPHAA--VPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSP---IHNVWGQSELGPLVTGYHYGYYRPNYDES--------MPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGK 1844
            WF GGEIN+S NC+D H +  + +  A+I+E       E ++Y QL  +V  +A ++  KCH V+KGD V LY PV+   VAAMLAC RIGA + V+F+    D +A ++   + + VIT N     GR I  K  V+DA+  S  +     V  R     A++  GK D+  E E     P      P++S  P++++YTSG+TG+PK +V      ++  K   KY    ++ D F   +D GWI+G + + YGPL  G T +L+E  P T        +++ R  +  F   PT  R++ K       K     LK +   GE  N E   W + +       + + W Q+E G ++        RP  D S         P F ++P +++ K +E   N   G +  ++ + P    TIY +H+++L+ ++  YPGY+ T D  + + DG  ++  R + ++ +S   +    +E+    +  +   AVV    P+ G+   A+  +K+D  I   +  E + +LV +K+G F   +   +VP LPK R+GK++R  L  +A  K
Sbjct:   12 WFVGGEINVSENCVDHH-MRSHPNRTALIWEKDEPGDVEHVSYIQLYGMVNRMANML--KCHGVKKGDIVCLYMPVSPLAVAAMLACARIGAPHSVVFAGFSADALASRINDAQAETVITANQAVRGGRAIDLKRVVDDAVSKSPGV-KRVFVMKRTG---AQVPMGKLDIPLE-EAMAEQPDECPPEPMDSEDPLFLLYTSGSTGQPKGIVHTQAGYLLYAKLTHKYCFDYKQGDVFGCVADIGWITGHSYVVYGPLANGATTVLFESTP-TYPDPGRYWEMVERLRINQFYGAPTAIRLLLKSGNSWVEKYDRSSLKVLGTVGEPINEEAWHWYNDVVGEKRCTVVDTWWQTETGGILIS-----PRPAPDNSPVKPEFPMRPFFGVDPVLVDEKGKELTGNNVTGALCFRSSV-PGMCRTIYGHHERFLNTYYRPYPGYYFTGDGALRDKDGHYRITGRMDDVVNVSGKRLGTAEVEDAMDNHSAVAETAVVGFPHPIKGEGIYAYATLKDDAQIEPEQFREEVKKLVRQKIGAFAVPEIIQVVPGLPKTRSGKIMRRILRKVAQDK 566          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO42084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2B4])

HSP 1 Score: 229.565 bits (584), Expect = 4.967e-66
Identity = 180/655 (27.48%), Postives = 303/655 (46.26%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKP--------YTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLD-GYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAI---KLSQFIPDYCLVYNRLNTD---------------PAKMVNGK-----DLDW-ETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELGPLVTGYHYGYYRPNYDES-MPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMA-NGKQWTMPVNVEKPHVFKEIYDV 1904
            Y+  YK SI  P   W E+A +  W  P        Y   + N    I  W  G + N+ YN LD++V D G GD VA  +E  +   ++++TY +LL  V   A V+ +K  V+KGDRV +Y P+ ++ V AMLAC R+GAV+ ++F     + +AE++  +  K++IT +  Y   + I  KE  + AI   +   F  + C+V   L  D               P   +        D  W E   + +  H  V +++  P++++YTSG+TG+PK ++   G  ++      +Y       + +W  +D GWI+G + +TYGP+  G   +L+EG P   +       I++++ V+ F + PT  R + K   E       + LK +   GE  N E   W   +       I + + Q+E G  V     G  R     +  P F + P I++ K  E L     G +++K P  P  A TIY NH+++ +++F K+ GY+ T D    +++G   V  R++  + +S   +    IE   ++++ +  AAVV       G+    F  +  +  +    + E   + V  K+G F         P LPK R+GK++R  L  +A N +Q      +  P V   +++ 
Sbjct:   33 YKARYKQSIEDPAGFWGEVASDFFWKVPPKSDHFLKYNFDLDNGSVDIK-WMQGAKTNICYNVLDRNVHDKGLGDTVAFYWEGNVPGDTKQITYGELLKQVCKFANVLESKG-VKKGDRVAIYMPMIMELVIAMLACARLGAVHSIVFGGFSAESLAERILDSTCKILITADASYRGLKMINLKEIADHAIIKCRERSFNVEACIVVRHLGPDKRVPTDPSSSPPPKRPCHQLQTSFDSSIDCWWHEVMAEASDEHDTVWVDAEDPLFMLYTSGSTGKPKGVLHTHGGYMLYTALTFRYSFDYHPGEVYWCTADIGWITGHSYITYGPMANGAISVLFEGTPFYPDC-GRFWDIVDKYKVSKFYTAPTAIRSLMKFGKEIVTSHNLESLKVLGTVGEPINPEAWLWYYHVVGHNKCAIVDTYWQTETGGHVITPLPGATRTRPGAATFPFFGVEPAIVDEKGNE-LEGPCEGFLVIKRPW-PGMARTIYGNHKRFENVYFDKFRGYYTTGDGCKRDENGYYWVTGRTDDCMNVSGHLLSTAQIESALVEHDAVSEAAVVSCPHKEKGEGIYCFATLMENVELDEKLIRELKQK-VRLKIGPFASPDVIQSAPALPKTRSGKIMRRVLRQVAKNDRQTGDLSTIYDPAVVDSLFEA 681          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO37374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG02])

HSP 1 Score: 102.064 bits (253), Expect = 1.333e-22
Identity = 113/495 (22.83%), Postives = 206/495 (41.62%), Query Frame = 3
Query:   51 NYEDVYKLSISQPEKIWDEL--AKEVIWTKPYTSVIKNED--SPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDL----IAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDY------CLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVP-LESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSP--IHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYK--NHQKYLDLFFTKYPGYFDTMDY 1478
            +YE +   S++   + W+       +I ++ Y  VI        IP WF G  +N + N     +L G  +D+A+ Y          +T+QQL   V  LA  +  K  ++ GDRV+ Y P     V AMLA + IGA    I+SS  PD     + ++ +  +PK++ + N     G   K  +H+     + Q +P+         V      + +++ N   L    ++    P      L  NHP++I+Y+SGTTG PK +V   G +++      K  G + + D    ++  GW+    L++   L VG  ++LY+G P        +  +++   + + G+   + + ++   +          L  I   G         ++ K   S   + ++ G +++  L  G++ G   P Y   +   S+   + +   E      + G +I   P  P      +   N  KY   +FTK+ G +   D+
Sbjct:   35 SYEQLRLWSVNHYAEFWEMFWTFSGIIHSQTYDEVIDTTKRIDEIPEWFHGARMNYAEN-----LLQGKDEDIAL-YTAGENQEVRTVTFQQLREKVAVLASAL-GKLGIKMGDRVVGYIPNCALAVEAMLAASSIGA----IWSSTSPDFGVSGVLDRFSQIQPKVMFSVNAVRYNG---KIHDHMAKLDGVVQGLPELEKVVIIPFVGTEEKIEISQIKNSIFLSDLLKLADDRPELEFKQLPFNHPLFIMYSSGTTGPPKCMVHSAGGTLLQHLKEHKLHGNMGKTDIIMYYTTTGWMMWNWLVS--ALAVGAALVLYDGSPFIPSPYV-IWDLVDEIGITILGTGARWLQALEDKHVYPKDSNRLTSLHTILSTGSPLKPASFDYVYKHIKSDLLLGSITGGTDIISLFAGHNTGL--PVYRGEIQARSLGMAVESWNEEGVSVYDSSGELICTKPF-PCMPTHFWNDPNGSKYRKAYFTKFKGVWAHGDF 509          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Match: EDO44212 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW67])

HSP 1 Score: 75.485 bits (184), Expect = 1.855e-14
Identity = 109/426 (25.59%), Postives = 183/426 (42.96%), Query Frame = 3
Query:  429 LACTRIGAVYVVIFSSLEP-DLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKA-----LVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKII----NRHNVAVFGSMPTFFRIMKKLCLEADI-KLPYKQLKGICIGGETSNAE-LRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRP-NYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPG-YFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFL 1664
            LAC+RIG+V +   + L   D++A  L S    +V       +P  T +  + V + I    F  +  + ++R    P K +  +          +T H   P  S+    I +TSGTTG PK         G G+SI T KY+L         D  W  SD GW        YGP + G ++ ++     T E     AK+I     ++ ++     PT +R+M    +  D+ +  +  L+     GE  N E +  W  K     I   +GQ+E   L   +     RP +  +  P + +  ++I+ K  E  P G  G I +   + P   + ++  + +  +   + Y G Y+ T D  + ++DG L  + RS+ +I  +   I    +E   +++  +  AAVV   DPV G+V  AF+
Sbjct:   15 LACSRIGSVIIPGSTQLRSKDILARLLVSRANTIVA------DPA-TAEVVDEVYNKINFLSF--NLIVSFHRKGWLPFKTLYKQ---------ASTVHTCAPTTSDETSIIFFTSGTTGLPKMTQHTHASQGIGHSI-TGKYWLDLCP----DDVHWTVSDPGWAKTAYGCLYGPWIQGASVFIHH----TTEKFE--AKVILDHLQKYPISTMCLPPTAYRMM----IHEDLSRYQFPALRHCLSAGEPLNPEVMVDWKEKT-GLDIREGYGQTETTLLCGTFRCIETRPGSMGKPAPGYDV--RVIDEKCNET-PAGIEGDIAVY--LKPRRPVGLFSEYIEDYERNVSAYRGDYYLTGDRAVRDEDGYLWFIGRSDDVIISAGYRIGPFEVESALIEHPAVAEAAVVSSPDPVRGEVVKAFV 401          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 400.208 bits (1027), Expect = 3.839e-130
Identity = 220/620 (35.48%), Postives = 349/620 (56.29%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEA--DIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYG----YYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEI 1895
            Y   +  +  QP+  W E   ++ W +P+T  +  ED   P WF GG +NM YN +D+HV  G G+  AII++  +T T + +TY +L   V  LAGV+V K  VR+GD V++Y P+  + + AMLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   V+ A+++S   P   L+YNR N +   +     LDW+ E+ +A PH  V L SNHP+Y++YTSGTTG PK +V  T    V  K+ +  + G++  D +W  SD GW+ G + + Y PLL G + ILYEGKP+         ++++ H  +   + PT  R +++    A    K    +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+ + +E  P  T+G I+++ P+ P AAL++++N   +  L+F+K+PGY+DTMD G L++DG L ++SRS+ +I ++   +  G +EE  L +  + + AVV L+D + G +P+A   +KN+   T  +V   I++LV   VG    FKN + V  LPK R+GK+ R SL  + NGK + +   +E P VFK+I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVIDDQMQEVKPR-TLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 672          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 372.474 bits (955), Expect = 3.656e-119
Identity = 209/580 (36.03%), Postives = 330/580 (56.90%), Query Frame = 3
Query:  174 PIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEA--DIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYG----YYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEI 1895
            P  F GG +NM YN +D+HV  G G+  AII++  +T T + +TY +L   V  LAGV+V K  VR+GD V++Y P+  + + AMLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   V+ A+++S   P   L+YNR N +   +     LDW+ E+ +A PH  V L SNHP+Y++YTSGTTG PK +V  T    V  K+ +  + G++  D +W  SD GW+ G + + Y PLL G + ILYEGKP+         ++++ H  +   + PT  R +++    A    K    +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+ + +E  P  T+G I+++ P+ P AAL++++N   +  L+F+K+PGY+DTMD G L++DG L ++SRS+ +I ++   +  G +EE  L +  + + AVV L+D + G +P+A   +KN+   T  +V   I++LV   VG    FKN + V  LPK R+GK+ R SL  + NGK + +   +E P VFK+I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVIDDQMQEVKPR-TLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 697          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 362.073 bits (928), Expect = 7.433e-116
Identity = 214/620 (34.52%), Postives = 335/620 (54.03%), Query Frame = 3
Query:   54 YEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEA--DIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYG----YYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEI 1895
            Y   +  +  QP+  W E   ++ W +P+T  +  ED   P WF GG +NM YN +D+HV  G G+  AII++  +T T + +TY +L   V  LAGV+V K  VR+GD V++Y P+  + + AMLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   V+ A+++S   P   L+YNR N +   +     LDW+ E+ +A PH  V L SNHP+Y++YTSGTTG PK +V  T    V  K+ +  + G++  D +W  SD GW+ G + + Y PLL G + ILYEGKP+         ++++ H  +   + PT  R +++    A    K    +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+ + +E  P  T+G I+++ P+ P AAL++++N   +  L+F+K+PGY+DTMD G L++DG L ++SRS+ +I ++   +  G +EEV                +P       AF     D   T  +V   I++LV   VG    FKN + V  LPK R+GK+ R SL  + NGK + +   +E P VFK+I
Sbjct:   55 YSRAFSAAREQPDVFWGEKGLDIDWFEPWTKTLHVEDPVFPNWFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQ--VSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPKGVVRDTAGYAVMLKWTMSNIYGLKPGDIWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYN--VIDDQMQEVKPR-TLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEEV---------------RNP-------AFAVCVRD---TEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 643          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: acss3 (acyl-CoA synthetase short chain family member 3 [Source:NCBI gene;Acc:101161021])

HSP 1 Score: 350.517 bits (898), Expect = 3.645e-111
Identity = 203/580 (35.00%), Postives = 318/580 (54.83%), Query Frame = 3
Query:  174 PIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEA--DIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGY----YRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEI 1895
            P  F GG +NM YN +D+HV  G G+  AII++  +T T + +TY +L   V  LAGV+V K  VR+GD V++Y P+  + + AMLAC RIGA + +IF       ++ ++   +PKL++T + G EPGR ++Y   V+ A+++S   P   L+YNR N +   +     LDW+ E+ +A PH  V L SNHP+Y++YTSGTTG PK                            +W  SD GW+ G + + Y PLL G + ILYEGKP+         ++++ H  +   + PT  R +++    A    K    +L+ + + GE  + E  +W  K F  P+ + W Q+E G  +T    G       P      P    N  +I+ + +E  P  T+G I+++ P+ P AAL++++N   +  L+F+K+PGY+DTMD G L++DG L ++SRS+ +I ++   +  G +EE  L +  + + AVV L+D + G +P+A   +KN+   T  +V   I++LV   VG    FKN + V  LPK R+GK+ R SL  + NGK + +   +E P VFK+I
Sbjct:  120 PQRFVGGRLNMCYNAVDRHVESGRGEQPAIIHDSPVTGTKKIITYGELQAQVSKLAGVLV-KNGVRQGDLVVIYMPMVPEAMIAMLACARIGAPHSLIFGGFASKELSVRIDHAKPKLMVTASFGVEPGRRVEYIPLVKKALEMSCHRPSKVLIYNRPNMEKVFLSPELSLDWDEEMASARPHECVSLPSNHPLYVLYTSGTTGTPK---------------------------IWWAASDLGWVVGHSYICYAPLLHGNSTILYEGKPVGTPDPGAFFRVLSEHGASSMFTAPTAIRAIRQQDPHAANGKKYALNRLQSLFVAGERCDVETLEWAKKNFGVPVLDHWWQTETGSAITASFMGLGGSLTPPAGQAGKPVPGYNVTVIDDQMQEVKPR-TLGNIVVRLPLPPGAALSLWENKSLFKKLYFSKFPGYYDTMDAGFLDEDGFLYIMSRSDDVINVAGHRLSAGALEESVLLHSAVGDCAVVGLEDSLKGHIPLALCVLKNEVRDTEEKVRTEIVKLVRDTVGPVAAFKNVLFVQGLPKTRSGKIPRSSLSNLINGKPYKVTPTIEDPEVFKDI 670          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Match: ENSORLT00000021863.2 (acyl-CoA synthetase short chain family member 1 [Source:NCBI gene;Acc:101167010])

HSP 1 Score: 240.736 bits (613), Expect = 1.166e-69
Identity = 173/606 (28.55%), Postives = 297/606 (49.01%), Query Frame = 3
Query:   48 SNYEDVYKLSISQPEKIWDELAKEVI-WTKPYTSVIKNEDSPIPI-WFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETE-IKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSS---PIHNVWGQSELGPLVTGYHYGYYRPNY-DESM-------PNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSL 1823
            S    + + S+S  E  W  +A+  + W +P+ +V   + S   I WF GG +N+S NCLD+ V     + VA+I+E     +  R TY++LL +   + G ++ +  VRKGD V +Y P     VA+MLAC RIGA + V+F+    D +AE++   +  +VIT N G   G+  + K+ V+ A+   Q  P    V+  + T+    +  +D+  + E +K         + S   ++++YTSG+TG+PK LV      ++      +YV      D F   +D GWI+G + + YGPL  G T +L+E  P+  +      + + R  +  F   PT  R++ K   +   K     LK +   GE  N E  +W  ++      P+ + W Q+E G +         +P+  DE +       P F I P +++++ +    N T G + +  P  P  A TI+ NH+++++ +   YPGYF T D    +  G  Q+  R + +I +S   I    IE+V  Q   +  +AV+     + GQ   AF+ +K +  I   ++ + +  +V++K+  + C    ++V  LPK R+GK++R  L
Sbjct:   56 SGRAALQEFSVSNSEDFWAAVARHRLSWMQPFHTVQDCDLSRGRIKWFQGGMLNVSVNCLDRQV-HIRPERVALIWERDERGSEVRYTYRELLEMTCRV-GNLLKRHGVRKGDCVTIYMPTCPLAVASMLACARIGAAHNVVFAGFSADALAERIRDAQSSIVITMNQGVRGGKVTELKKTVDTAV---QSCPTVRHVFVAMRTETLVPMTDRDVLMDEEMLKEDVVCEPAAMNSEDVLFLLYTSGSTGKPKGLVHTQAGYLLYAALTQRYVFSYHDGDVFGCVADIGWITGHSYIVYGPLANGATTVLFESTPVYPDP-GRYWETVERLKINQFYGAPTAIRLLLKYGDQWVNKYDRSSLKTLGSVGEPINTEAWEWYHRVVGEGRCPVVDTWWQTETGGICIA-----PKPSEPDEEIVPGMAMRPFFGIKPVLMDTEGKVLTANNTSGALCIAQPW-PGMARTIHNNHERFIETYCQPYPGYFFTGDGAYRSPKGYYQITGRLDDVINVSGHRIGTAEIEDVVNQCSAVAESAVIGYSHDIKGQGIYAFVVLKKNMKIKEEDLYKQLNSVVSEKIAKYACPDFILLVKRLPKTRSGKIMRRVL 649          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043642.1 (SMESG000043642.1)

HSP 1 Score: 1267.29 bits (3278), Expect = 0.000e+0
Identity = 637/637 (100.00%), Postives = 637/637 (100.00%), Query Frame = 3
Query:   39 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLEQL 1949
            MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLSRSESIIEISSTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITNNEVIENIIELVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLEQL
Sbjct:    1 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLSRSESIIEISSTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITNNEVIENIIELVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLEQL 637          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043641.1 (SMESG000043641.1)

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 441/635 (69.45%), Postives = 509/635 (80.16%), Query Frame = 3
Query:   39 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLE 1943
            ML  NYE+++KLSI+ PEK+WDELAKEV+W+KPYTSVIK++D PIP WF GGEINMSYNCLDKHVLDGYGDDVAIIYECT+T+T+E++TYQQLLTLVE LAGVMVNKCH+ KGDRVLLYFPVTIQG+AAMLACTRIGAVYVVIFS   PDLIA ++  TEPKLVITTNI YEPG TI YKE VE A K+ QF P Y LVYNR NT PAKMV GKD DWETEIKTATPHAAVPLESNHPM+I YTSGTTGEPK  VMGTGNSIVTDKYFLKYVGG++RK+CFWM SDFGWISGQTLMTYGPLLVGCT+IL+EGKP+ K    E                                    +QL  I +GGE S+++LRQWIS IFS PI+N+WGQSELGP+ TG   G+ RPNYD  +P  +++ +I+NS T E+LP  TVGR++LKTPI PS ALTIYKNHQ++L  +FTKYPGYFDTMDYGM+ +DGSLQ+LSRS+ +I IS+  ICGG  EEVCLQN+ LLNAAVVPLDDP  GQVPIAFLEV+ DK + N+EVI   I+ VTKK+G F  FKNAVIVPELPKN+ GK+LRYSL  MANG+ W +PV V+ P V+KEIYDVLI AGYKA+LP++
Sbjct:    1 MLSLNYEELHKLSITHPEKVWDELAKEVVWSKPYTSVIKDKDKPIPKWFVGGEINMSYNCLDKHVLDGYGDDVAIIYECTITNTTEKITYQQLLTLVEQLAGVMVNKCHILKGDRVLLYFPVTIQGMAAMLACTRIGAVYVVIFSGFAPDLIAGRMKHTEPKLVITTNIAYEPGTTINYKEQVEKAAKICQFTPAYSLVYNRPNTAPAKMVKGKDFDWETEIKTATPHAAVPLESNHPMFINYTSGTTGEPKGFVMGTGNSIVTDKYFLKYVGGLKRKECFWMLSDFGWISGQTLMTYGPLLVGCTIILFEGKPVNKPNSAE------------------------------------RQL-AIYVGGELSDSDLRQWISNIFSCPIYNLWGQSELGPVATGPLLGFKRPNYDLPLPILTVDLRIVNSDTGEELPKETVGRVLLKTPICPSGALTIYKNHQRFLKSYFTKYPGYFDTMDYGMIMNDGSLQILSRSDDVIHISAARICGGAFEEVCLQNDSLLNAAVVPLDDPTAGQVPIAFLEVRKDKAVNNSEVIAKTIDQVTKKMGSFTLFKNAVIVPELPKNKTGKILRYSLSEMANGRVWKIPVTVDNPQVYKEIYDVLIKAGYKATLPID 598          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 376/633 (59.40%), Postives = 489/633 (77.25%), Query Frame = 3
Query:   39 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLP 1937
            M   N+ D+Y+LSISQPEK+WDEL  EV+W+KPYTSVIK++DSPIP WFDGGEINMSYNCLDKHVLDGYGDDVA+IYEC + + +E+++Y+QLLTLVE+LAGVMVNKCH++KGDRVLLY PVT+QG+AA+LACTRIGAVYVV F    PDLIA ++  TEPKL+ITTN GYEP RT+ YKE V++AI  SQF PDYC+VYNR NT  A M++ +DLDWETEI  ATP+A V LES  P++IIYTSGT GEPK LVM  G  IV++KYF+KYV G+ R+DC+WMF D+GWISGQT MT+GPLL+GC+ ILYEGK L+   +T + KII+++NV  F + PT+FR +K    E DIK    QL+ +CIGGE SN +L++W+S +F  P++++WGQ+ELG + TG   G+   + +   P  S++PK++NS T E LPN T+GR++LK P+ PSAA ++YK+H ++L  +F+KY GY+DTMDYGM+ +DG+LQ+L+R++ +I +S+  ICGG +EEVCL NE L NAA V L+DP+ GQVP AFLE K D+ I N  +I   ++LV K++G F  F   V+V +LPK + GK+LR +L  M NG+ W  P  VE P VF+EIY +LI AGYKASLP
Sbjct:    1 MFDLNFADLYELSISQPEKVWDELGNEVVWSKPYTSVIKDKDSPIPKWFDGGEINMSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISSNGLSPMLSVHPKVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLP 633          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043645.1 (SMESG000043645.1)

HSP 1 Score: 711.449 bits (1835), Expect = 0.000e+0
Identity = 336/578 (58.13%), Postives = 441/578 (76.30%), Query Frame = 3
Query:  204 MSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLP 1937
            MSYNCLDKHVLDGYGDDVA+IYEC + + +E+++Y+QLLTLVE+LAGVMVNKCH++KGDRVLLY PVT+QG+AA+LACTRIGAVYVV F    PDLIA ++  TEPKL+ITTN GYEP RT+ YKE V++AI  SQF PDYC+VYNR NT  A M++ +DLDWETEI  ATP+A V LES  P++IIYTSGT GEPK LVM  G  IV++KYF+KYV G+ R+DC+WMF D+GWISGQT MT+GPLL+GC+ ILYEGK L+   +T + KII+++NV  F + PT+FR +K    E DIK    QL+ +CIGGE SN +L++W+S +F  P++++WGQ+ELG + TG   G+   + +   P  S++PK++NS T E LPN T+GR++LK P+ PSAA ++YK+H ++L  +F+KY GY+DTMDYGM+ +DG+LQ+L+R++ +I +S+  ICGG +EEVCL NE L NAA V L+DP+ GQVP AFLE K D+ I N  +I   ++LV K++G F  F   V+V +LPK + GK+LR +L  M NG+ W  P  VE P VF+EIY +LI AGYKASLP
Sbjct:    1 MSYNCLDKHVLDGYGDDVAVIYECPVINATEKVSYKQLLTLVENLAGVMVNKCHLQKGDRVLLYVPVTVQGIAAILACTRIGAVYVVTFGGFAPDLIAARIKHTEPKLIITTNFGYEPERTVNYKEIVDEAINKSQFCPDYCIVYNRPNTKCATMIDSRDLDWETEIGKATPYAPVALESGDPIFIIYTSGTLGEPKGLVMTVGGFIVSNKYFMKYVLGLNRQDCWWMFGDYGWISGQTTMTFGPLLIGCSTILYEGKELSSHHLTGIGKIIDQNNVTGFSAAPTYFRFLKNKDSEKDIKPSKAQLRFVCIGGELSNTKLKEWVSNVFLCPVYDLWGQTELGIIATGPGLGFKNISSNGLSPMLSVHPKVVNSATGEHLPNETIGRMLLKIPLCPSAASSMYKDHDRFLKTYFSKYDGYYDTMDYGMIKNDGTLQILARADDVISVSAGRICGGALEEVCLMNEDLANAAFVALEDPINGQVPFAFLEKKKDRNINNEALIIESVKLVKKEIGSFTLFHQGVVVHDLPKTKTGKILRKTLYNMLNGQDWKTPATVENPKVFEEIYSILIEAGYKASLP 578          
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Match: SMESG000043652.1 (SMESG000043652.1)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 291/635 (45.83%), Postives = 428/635 (67.40%), Query Frame = 3
Query:   39 MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFDGGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHLAGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPDLIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVYNRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGEPKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGPLLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCLEADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLVTGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISPSAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLXXXXXXXXXXXTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPITXXXXXXXXXXLVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMANGKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLE 1943
            M   ++E +Y LS+ +PEK+WD LA EV+W K Y++VI +  SP+P WF  G+INMS+NCLD+H+ DG GDD+A+I+E  +T T +++TYQ LL  VE L+GV+ ++C+ + GDRVLLYFPV  Q + AMLAC+RIG +Y VI+     + +A+++   EPK+++T+N+G++   T+ YK+ V++AI++SQF  +YC+VYNR N   A M++ +DLDWETE+  A P   +P+ES+HP++IIY+SGTTGEPK  VM TG +IVTDKY +KY+  ++ K+ FWMFSDFGWI+GQT+M+YGPLL+GCT ILYEGKP T     E+A+IIN HNVA F + PT FRI+K        K+    L+ I I GE S++ L +WIS  F+ P++++WGQ+EL  +VT     + +P     +P F I PK+I    E  +     G I+L   +SP  A T++K+ ++Y++ +FT Y G++DT D G + ++G L++LSRS+ II+++S   CGG IEE+CL+N  L++AAVV +D+   GQVP  FL  + D  +   +++    ELV          +N + V +LPK    K+ R SL  M N K + +P  VE  +V+++IY+ L  AG +ASLP E
Sbjct:    1 MWNLSFEKLYDLSLKEPEKLWDSLASEVVWDKKYSAVINHRSSPLPKWFFEGKINMSFNCLDRHINDGRGDDLAVIFESPVTRTVQKITYQSLLESVEKLSGVLADRCNTKAGDRVLLYFPVIPQCLIAMLACSRIGVIYTVIYGGFPAEEVADRIRHIEPKIILTSNVGFDGYNTVDYKQIVDEAIEISQFDVEYCVVYNRGNYPMASMIDIRDLDWETEMMYAVPQRWIPMESDHPLFIIYSSGTTGEPKGFVMTTGAAIVTDKYTIKYLLNIKSKETFWMFSDFGWITGQTVMSYGPLLMGCTTILYEGKPATTPNPQEMARIINEHNVASFMASPTIFRILKNYESIPTFKITINYLRAIYIAGEKSDSNLIRWISDAFNCPVYDIWGQTELNGVVTSPALYFGKPVNSVPVPMFGIKPKLIYPNPE--ILGDAFGEILLTAGLSPVFAETLFKDDKRYIETYFTTYQGFYDTKDCGRMTEEGGLEILSRSDDIIKVNSMRFCGGAIEEICLKNHELVSAAVVGVDNEENGQVPFGFLVKRKDSNVNEKDIMNKTKELVKHHYNGLARLENLIFVADLPKTNTHKISRCSLSAMLNRKIFKIPPTVENRNVYQDIYETLRQAGIEASLPKE 633          
The following BLAST results are available for this feature:
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS33.243e-13834.97acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS34.038e-13534.81acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS13.116e-6928.86acyl-CoA synthetase short chain family member 1 [S... [more]
ACSS27.381e-6627.39acyl-CoA synthetase short chain family member 2 [S... [more]
ACSS23.795e-6427.15acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-191.141e-4825.24Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-191.697e-4825.24Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
acs-191.697e-4825.24Acetyl-coenzyme A synthetase [Source:UniProtKB/Tr... [more]
mec-184.798e-1621.71pep chromosome:WBcel235:X:4271169:4274229:-1 gene:... [more]
sur-52.255e-1420.00Acetoacetyl-CoA synthetase [Source:UniProtKB/Swis... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG64321.143e-11833.33gene:FBgn0039184 transcript:FBtr0346110[more]
CG64321.143e-11833.33gene:FBgn0039184 transcript:FBtr0084606[more]
AcCoAS1.567e-6827.77gene:FBgn0012034 transcript:FBtr0333126[more]
AcCoAS1.567e-6827.77gene:FBgn0012034 transcript:FBtr0078413[more]
AcCoAS3.499e-4726.31gene:FBgn0012034 transcript:FBtr0078414[more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss34.524e-13134.62acyl-CoA synthetase short chain family member 3 [S... [more]
acss33.119e-12333.76acyl-CoA synthetase short chain family member 3 [S... [more]
acss16.225e-8031.23acyl-CoA synthetase short chain family member 1 [S... [more]
acss26.460e-6728.03acyl-CoA synthetase short chain family member 2 [S... [more]
acss21.046e-6427.45acyl-CoA synthetase short chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSS31.175e-14736.58acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS33.658e-14336.74acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS31.690e-14136.95acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS33.376e-13636.08acyl-CoA synthetase short chain family member 3 [S... [more]
ACSS33.917e-13635.49acyl-CoA synthetase short chain family member 3 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acss38.392e-13734.65acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss31.806e-9536.16acyl-CoA synthetase short-chain family member 3 [S... [more]
Acss15.411e-7029.23acyl-CoA synthetase short-chain family member 1 [S... [more]
Acss26.949e-6327.39acyl-CoA synthetase short-chain family member 2 [S... [more]
Acss21.851e-6127.15acyl-CoA synthetase short-chain family member 2 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0A0G2K047|ACSS3_RAT1.530e-13835.28Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q9H6R3|ACSS3_HUMAN1.558e-13734.97Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q5REB8|ACSS3_PONAB1.679e-13734.81Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|Q14DH7|ACSS3_MOUSE5.870e-13634.65Acyl-CoA synthetase short-chain family member 3, m... [more]
sp|A7MB45|ACSS3_BOVIN5.958e-13435.13Acyl-CoA synthetase short-chain family member 3, m... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5G3KCT61.845e-14436.58Acyl-CoA synthetase short chain family member 3 OS... [more]
A0A1L8GY849.253e-14436.10Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A5G3KE575.744e-14036.74Acyl-CoA synthetase short chain family member 3 OS... [more]
A0A5G3KEF22.654e-13836.95Acyl-CoA synthetase short chain family member 3 OS... [more]
A0A3Q0CNP18.799e-13735.29acyl-CoA synthetase short-chain family member 3, m... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000043882.16.835e-7138.89pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036840.17.644e-6938.56pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
acss21.233e-6727.93acyl-CoA synthetase short chain family member 2 [S... [more]
acss24.983e-6527.09acyl-CoA synthetase short chain family member 2 [S... [more]
acss2l1.372e-5927.06acetyl-coenzyme A synthetase, cytoplasmic-like [So... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000006895.13.990e-9734.66pep scaffold:Pmarinus_7.0:GL476378:330410:368976:-... [more]
acss26.838e-3325.76acyl-CoA synthetase short chain family member 2 [S... [more]
ENSPMAT00000005866.18.914e-943.33pep scaffold:Pmarinus_7.0:GL495638:310:2296:-1 gen... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ACS12.371e-8530.87Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
ACS24.600e-7929.95Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO492931.637e-13533.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO391352.429e-7430.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420844.967e-6627.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373741.333e-2222.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442121.855e-1425.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acss33.839e-13035.48acyl-CoA synthetase short chain family member 3 [S... [more]
acss33.656e-11936.03acyl-CoA synthetase short chain family member 3 [S... [more]
acss37.433e-11634.52acyl-CoA synthetase short chain family member 3 [S... [more]
acss33.645e-11135.00acyl-CoA synthetase short chain family member 3 [S... [more]
ENSORLT00000021863.21.166e-6928.55acyl-CoA synthetase short chain family member 1 [S... [more]
back to top
BLAST of Acyl-CoA synthetase short chain family member 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043642.10.000e+0100.00SMESG000043642.1[more]
SMESG000043641.10.000e+069.45SMESG000043641.1[more]
SMESG000043645.10.000e+059.40SMESG000043645.1[more]
SMESG000043645.10.000e+058.13SMESG000043645.1[more]
SMESG000043652.10.000e+045.83SMESG000043652.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033523 ID=SMED30033523|Name=Acyl-CoA synthetase short chain family member 3|organism=Schmidtea mediterranea sexual|type=transcript|length=2003bp
TAATAATAAAAGTTCTATTTACATTCAAATAATATCAGATGTTAGGTTCA
AATTACGAAGATGTATATAAACTTTCTATTTCACAACCGGAAAAGATATG
GGATGAATTAGCAAAAGAGGTGATTTGGACTAAGCCGTATACGTCGGTCA
TAAAGAATGAAGACTCCCCAATTCCGATATGGTTTGACGGAGGAGAAATC
AACATGTCGTACAATTGCTTAGATAAACACGTCCTGGACGGGTACGGAGA
CGACGTGGCCATTATTTATGAGTGCACACTAACGCATACAAGTGAAAGAA
TGACTTACCAACAACTATTAACATTAGTTGAACATTTGGCAGGGGTGATG
GTTAATAAATGCCATGTGCGAAAAGGAGATCGAGTTTTACTATACTTTCC
CGTCACAATCCAGGGAGTGGCGGCCATGTTGGCCTGCACGCGGATTGGTG
CAGTCTACGTTGTCATATTCAGCTCATTAGAACCCGATTTGATAGCTGAA
AAACTAACATCTACGGAGCCTAAATTAGTAATAACAACCAACATAGGTTA
TGAACCTGGAAGAACCATTAAATACAAAGAACATGTTGAGGATGCCATTA
AATTATCTCAGTTTATTCCAGATTATTGTCTTGTTTATAACAGACTAAAT
ACTGATCCAGCTAAAATGGTAAATGGGAAAGATTTAGATTGGGAAACTGA
AATCAAAACCGCTACTCCTCATGCTGCGGTTCCACTGGAATCCAACCATC
CTATGTACATAATTTATACATCGGGAACAACTGGTGAACCCAAAGCACTA
GTCATGGGGACTGGCAATTCTATAGTTACTGATAAGTATTTCTTAAAATA
TGTTGGAGGTGTGGAAAGAAAGGACTGTTTTTGGATGTTCAGTGATTTTG
GATGGATATCTGGTCAAACTCTAATGACTTATGGGCCTTTACTTGTCGGA
TGTACGATGATACTTTACGAAGGGAAACCATTAACAAAGGAAGCTATGAC
AGAAGTGGCCAAAATTATAAATCGACATAATGTTGCTGTGTTTGGCTCCA
TGCCTACGTTTTTTAGAATCATGAAAAAGTTATGCCTTGAGGCCGATATA
AAGCTTCCATACAAACAACTAAAAGGAATTTGCATTGGAGGCGAGACATC
GAATGCGGAATTGAGACAATGGATCTCGAAAATATTTTCATCTCCAATAC
ATAACGTGTGGGGTCAAAGTGAATTGGGTCCGTTGGTTACGGGTTATCAT
TATGGATACTATAGACCGAATTACGATGAATCTATGCCAAATTTTTCTAT
TAATCCGAAAATCATAAATAGCAAAACTGAAGAGCAGCTACCAAATGGAA
CTGTTGGAAGAATTATACTTAAAACCCCAATTTCTCCTTCGGCCGCTTTG
ACAATATATAAAAATCATCAAAAATATTTAGATTTATTTTTCACGAAATA
TCCAGGATATTTTGACACTATGGATTATGGCATGCTTAACGATGATGGCA
GTTTGCAAGTTCTTTCTAGGTCTGAGAGCATAATTGAAATTTCTTCAACT
TACATTTGTGGAGGAGTTATTGAGGAAGTTTGTTTGCAAAACGAATATTT
ACTCAACGCAGCAGTTGTCCCGTTGGATGACCCGGTAACAGGTCAAGTTC
CTATAGCTTTTCTCGAAGTAAAAAATGACAAACCTATTACTAATAATGAA
GTTATAGAAAATATTATTGAGCTCGTTACCAAAAAAGTGGGGGATTTTGT
CTGTTTCAAAAATGCAGTTATAGTTCCAGAGTTACCGAAAAATAGGGCTG
GGAAACTTTTGAGATATTCGCTTTTGTACATGGCTAACGGAAAACAATGG
ACAATGCCTGTGAATGTCGAGAAGCCGCATGTTTTTAAAGAAATTTATGA
TGTCCTTATTAATGCTGGATATAAAGCATCTTTGCCTTTAGAACAGCTTT
AGAAAACATAGAAAAAAATTATAATTTATATTTTAATTTTTGGTTGCGGT
AGA
back to top

protein sequence of SMED30033523-orf-1

>SMED30033523-orf-1 ID=SMED30033523-orf-1|Name=SMED30033523-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=638bp
MLGSNYEDVYKLSISQPEKIWDELAKEVIWTKPYTSVIKNEDSPIPIWFD
GGEINMSYNCLDKHVLDGYGDDVAIIYECTLTHTSERMTYQQLLTLVEHL
AGVMVNKCHVRKGDRVLLYFPVTIQGVAAMLACTRIGAVYVVIFSSLEPD
LIAEKLTSTEPKLVITTNIGYEPGRTIKYKEHVEDAIKLSQFIPDYCLVY
NRLNTDPAKMVNGKDLDWETEIKTATPHAAVPLESNHPMYIIYTSGTTGE
PKALVMGTGNSIVTDKYFLKYVGGVERKDCFWMFSDFGWISGQTLMTYGP
LLVGCTMILYEGKPLTKEAMTEVAKIINRHNVAVFGSMPTFFRIMKKLCL
EADIKLPYKQLKGICIGGETSNAELRQWISKIFSSPIHNVWGQSELGPLV
TGYHYGYYRPNYDESMPNFSINPKIINSKTEEQLPNGTVGRIILKTPISP
SAALTIYKNHQKYLDLFFTKYPGYFDTMDYGMLNDDGSLQVLSRSESIIE
ISSTYICGGVIEEVCLQNEYLLNAAVVPLDDPVTGQVPIAFLEVKNDKPI
TNNEVIENIIELVTKKVGDFVCFKNAVIVPELPKNRAGKLLRYSLLYMAN
GKQWTMPVNVEKPHVFKEIYDVLINAGYKASLPLEQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR032387ACAS_N
IPR025110AMP-bd_C
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 634..637
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 499..626
e-value: 3.2E-11
score: 45.4
NoneNo IPR availablePANTHERPTHR43347FAMILY NOT NAMEDcoord: 4..623
NoneNo IPR availableCDDcd05967PrpEcoord: 6..619
e-value: 0.0
score: 538.44
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 5..623
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 67..501
e-value: 2.5E-64
score: 217.4
IPR025110AMP-binding enzyme, C-terminal domainPFAMPF13193AMP-binding_Ccoord: 511..589
e-value: 3.6E-13
score: 50.3
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 35..495
e-value: 1.3E-70
score: 240.2
IPR032387Acetyl-coenzyme A synthetase, N-terminal domainPFAMPF16177ACAS_Ncoord: 6..60
e-value: 2.5E-16
score: 59.3
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 241..252