Metalloendopeptidase

Overview
NameMetalloendopeptidase
Smed IDSMED30033494
Length (bp)2513
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metalloendopeptidase (SMED30033494) t-SNE clustered cells

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30033494) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metalloendopeptidase (SMED30033494) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metalloendopeptidase (SMED30033494) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033494

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30033494h1SMcG0021404 SmedASXL_004972SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30033494h1SMcG0021404 SmedASXL_004972SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033494h1SMcG0021404 dd_Smed_v4_3177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033494h1SMcG0021404 dd_Smed_v4_3177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033494h1SMcG0021404 dd_Smed_v4_3177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033494h1SMcG0021404 dd_Smed_v4_3177_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033494h1SMcG0021404 Contig49545uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033494h1SMcG0021404 Contig49545newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30033494h1SMcG0021404 dd_Smed_v6_3177_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 122.479 bits (306), Expect = 7.847e-28
Identity = 67/229 (29.26%), Postives = 119/229 (51.97%), Query Frame = 1
Query:   43 TIHSSYGI--PRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            T+H++     PRV+RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+V HELGH +G  HE  RPDR+QH+  I EN+Q   +  F ++E+         +DF SIM Y+   FS+  F   +     D      I ++  LS  D+     LY+C       Q ++GN+
Sbjct:  135 TLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIE-RTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNF 362          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 115.931 bits (289), Expect = 5.124e-27
Identity = 66/217 (30.41%), Postives = 111/217 (51.15%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGN 714
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +  +  D      I ++  LS  D+     LY+C       Q S+GN
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIE-RSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGN 359          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 117.087 bits (292), Expect = 4.053e-26
Identity = 66/217 (30.41%), Postives = 111/217 (51.15%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGN 714
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +  +  D      I ++  LS  D+     LY+C       Q S+GN
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIE-RSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGN 359          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 117.087 bits (292), Expect = 4.588e-26
Identity = 66/217 (30.41%), Postives = 111/217 (51.15%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGN 714
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +  +  D      I ++  LS  D+     LY+C       Q S+GN
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIE-RSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGN 359          
BLAST of Metalloendopeptidase vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 105.916 bits (263), Expect = 6.352e-23
Identity = 58/209 (27.75%), Postives = 107/209 (51.20%), Query Frame = 1
Query:  100 NKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGF--PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
             ++W   +IP++   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH +G  HE  RPDR++H+  + EN+Q   +  F ++E    +     +DF SIM Y+   FS+  F   +  K   +   P      + LS  D+     LY+C       Q S+GN+
Sbjct:  127 ERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLE-RTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEPQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPPIGQRTR-LSKGDIAQARKLYKCPACGETLQDSTGNF 333          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-7 (Zinc metalloproteinase nas-7 [Source:UniProtKB/Swiss-Prot;Acc:P55113])

HSP 1 Score: 117.857 bits (294), Expect = 3.419e-28
Identity = 70/210 (33.33%), Postives = 109/210 (51.90%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNT 696
            R KR   +   KLW    IPY     +S  ++  L KA++ Y  +TC++FV  Q     ++L I K + CFS++G + +G Q+L+L   C +Y  ++HE+ H +G  HE  R DR+  I  I +N+   A   F +++ +    +  P+D++SI+ Y   AFSKNGFP  L    S        + +D S  D+  IN +Y C    S T
Sbjct:   76 RHKRNGVSRAAKLWPNARIPYAISPHYSPHERALLAKAVKQYHEKTCIRFVPRQTG-EPDYLFIGKVDGCFSEVG-RTSGVQVLSLDNGCMEYATIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAFSKNGFPTMLPKVKSATIG----NARDFSDVDISKINRMYNCPVEKSVT 279          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-4 (Zinc metalloproteinase nas-4 [Source:UniProtKB/Swiss-Prot;Acc:P55112])

HSP 1 Score: 115.546 bits (288), Expect = 1.686e-27
Identity = 65/192 (33.85%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  103 KLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            + W  N IPY   + +    +  +  A+  Y  +TC+KFV   P+ H ++L I   E C+S +G +  G+Q ++L   C Q G +VHEL H +G  HE  R DR+ +I  + +NV   A   FE    N     + P+D+ SIM Y PYAFS +G    +   S        +   D+   DV+ IN LY C
Sbjct:  102 RRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDEGCYSLVG-KTGGKQPVSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSERMGQRVKFSDI---DVRKINKLYNC 289          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-4 (Zinc metalloproteinase nas-4 [Source:UniProtKB/Swiss-Prot;Acc:P55112])

HSP 1 Score: 115.161 bits (287), Expect = 1.686e-27
Identity = 65/192 (33.85%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  103 KLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            + W  N IPY   + +    +  +  A+  Y  +TC+KFV   P+ H ++L I   E C+S +G +  G+Q ++L   C Q G +VHEL H +G  HE  R DR+ +I  + +NV   A   FE    N     + P+D+ SIM Y PYAFS +G    +   S        +   D+   DV+ IN LY C
Sbjct:  102 RRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDEGCYSLVG-KTGGKQPVSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSERMGQRVKFSDI---DVRKINKLYNC 289          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-4 (Zinc metalloproteinase nas-4 [Source:UniProtKB/Swiss-Prot;Acc:P55112])

HSP 1 Score: 113.62 bits (283), Expect = 2.565e-27
Identity = 65/192 (33.85%), Postives = 96/192 (50.00%), Query Frame = 1
Query:  103 KLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            + W  N IPY   + +    +  +  A+  Y  +TC+KFV   P+ H ++L I   E C+S +G +  G+Q ++L   C Q G +VHEL H +G  HE  R DR+ +I  + +NV   A   FE    N     + P+D+ SIM Y PYAFS +G    +   S        +   D+   DV+ IN LY C
Sbjct:  102 RRWPNNEIPYTLSSQYGSYARSVIANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDEGCYSLVG-KTGGKQPVSLDSGCIQVGTIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGPYAFSGSGKKTLVPKKSGSERMGQRVKFSDI---DVRKINKLYNC 289          
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Match: nas-6 (Zinc metalloproteinase nas-6 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3S9])

HSP 1 Score: 110.923 bits (276), Expect = 3.424e-26
Identity = 71/207 (34.30%), Postives = 112/207 (54.11%), Query Frame = 1
Query:   64 IPRVKRALGAYNNK--LWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            +P       A  NK   W G +IPY  D +FS ++   L+KA +SY+  TC++F K +     ++L I KG  C+SQ+G +  G+Q ++L + C  + ++VHEL H++G  HE  R DR+ HI+   +N+    K  F+ I +    L    +D++SIM Y   AFS+NG    ++   +  T +   +  DLS  D+  IN LY C
Sbjct:   64 LPEGPVLFNALKNKQLTWEGGVIPYEMDTAFSPNEIKILEKAFDSYRRTTCIRFEKREGQ--TDYLNIVKGYGCYSQVG-RTGGKQEISLGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKINWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSRNGRNT-IETVENGFTQVIGTA-MDLSPLDIVKINKLYSC 265          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tld (gene:FBgn0003719 transcript:FBtr0084691)

HSP 1 Score: 120.168 bits (300), Expect = 2.396e-27
Identity = 74/230 (32.17%), Postives = 114/230 (49.57%), Query Frame = 1
Query:   64 IPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIE-KGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKN---------GFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYV 720
            I R +RA+     + W   +IPY  D  FS + K   ++A+  ++  TC+KFV+  PN+HAN++    K   C S +G    G Q +++ + C ++G+++HELGHTIG  HE  R DR++HI     N+    +  F++ S     L   P+D  SIM Y+  +FSK+         G P    +    R        K LS  D+   N LY+C       Q +SG+ V
Sbjct:  131 IQRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQR--------KRLSRGDIVQANLLYKCASCGRTYQQNSGHIV 352          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084690)

HSP 1 Score: 117.857 bits (294), Expect = 1.657e-26
Identity = 71/222 (31.98%), Postives = 111/222 (50.00%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIE-KGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGF---PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYV 720
            RV RA+ A   ++W   +IPY  D +FS   K   + A+  ++  TC+KFV+  P IH N++    +   C S +G +  G Q +++ + C ++G+VVHELGH +G  HE  RPDR +H+     N+ +     F + S +        +D+ SIM Y+   FSK  +    + ++M    R  I       LS  D+   N LY+C K     Q SSG + 
Sbjct:  516 RVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIG--QRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFA 735          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0339252)

HSP 1 Score: 117.857 bits (294), Expect = 1.657e-26
Identity = 71/222 (31.98%), Postives = 111/222 (50.00%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIE-KGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGF---PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYV 720
            RV RA+ A   ++W   +IPY  D +FS   K   + A+  ++  TC+KFV+  P IH N++    +   C S +G +  G Q +++ + C ++G+VVHELGH +G  HE  RPDR +H+     N+ +     F + S +        +D+ SIM Y+   FSK  +    + ++M    R  I       LS  D+   N LY+C K     Q SSG + 
Sbjct:  516 RVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIG--QRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFA 735          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084689)

HSP 1 Score: 117.857 bits (294), Expect = 1.657e-26
Identity = 71/222 (31.98%), Postives = 111/222 (50.00%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIE-KGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGF---PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYV 720
            RV RA+ A   ++W   +IPY  D +FS   K   + A+  ++  TC+KFV+  P IH N++    +   C S +G +  G Q +++ + C ++G+VVHELGH +G  HE  RPDR +H+     N+ +     F + S +        +D+ SIM Y+   FSK  +    + ++M    R  I       LS  D+   N LY+C K     Q SSG + 
Sbjct:  516 RVARAVTAKKERIWDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVERDPEIHPNYIVFTVRSCGCCSFVGKRGNGPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNMLSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIG--QRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFA 735          
BLAST of Metalloendopeptidase vs. Ensembl Fly
Match: CG5715 (gene:FBgn0039180 transcript:FBtr0084634)

HSP 1 Score: 103.99 bits (258), Expect = 4.460e-24
Identity = 57/193 (29.53%), Postives = 101/193 (52.33%), Query Frame = 1
Query:  109 WTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQP-NIHANWLKIEKGEN-CFSQIGMQNTGEQLLTLSKAC-RQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYKL-FNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            W G ++PY     F+  +  N+  A + Y  +TC++F   +P     +++ I  G++ C+S IG     +++   S  C R YG  +HEL H +G  HE  R +R+ ++R + +N++ E  + FE  S+  +  F   +D+ S+M YSP +F++NG P    + ++          K  S  DV+ IN +Y+C
Sbjct:  105 WPGGVVPYEIKGPFTSQELGNINHAFKEYHTKTCVRF---KPRTTEKDYISIGSGKSGCWSSIGRLGGRQEVNLQSPNCLRTYGTPIHELMHALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNGQPTLKALRATSDASQMG-QRKGFSAGDVRKINAMYKC 293          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 121.324 bits (303), Expect = 1.467e-27
Identity = 67/218 (30.73%), Postives = 114/218 (52.29%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   K+W G +IPY+   +F+ S +  L++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNF 369          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 121.324 bits (303), Expect = 1.467e-27
Identity = 67/218 (30.73%), Postives = 114/218 (52.29%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   K+W G +IPY+   +F+ S +  L++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNF 369          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 121.324 bits (303), Expect = 1.467e-27
Identity = 67/218 (30.73%), Postives = 114/218 (52.29%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   K+W G +IPY+   +F+ S +  L++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNF 369          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: hce2l1 (high choriolytic enzyme 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-070912-147])

HSP 1 Score: 104.76 bits (260), Expect = 5.169e-25
Identity = 62/187 (33.16%), Postives = 98/187 (52.41%), Query Frame = 1
Query:  124 IPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIH-ANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQC 675
            +PYI    + D D++ ++  +    + TC+KFV   P  H AN+L I+    C+S +GM    + +   S  C   GV  HEL H +G +HE  R DR++++  + EN+ E  +  F + E+N+    NT +D+ S+M Y  YAFS++G P  +        P   I ++D  S  D+  IN LY C
Sbjct:   39 VPYIMSTLYDDMDRITIETGMLDISSSTCVKFV---PRTHQANFLNIQPRYGCWSYLGMTGGSQTVSLQSPGCMWSGVASHELMHALGFVHEQSRSDRDRYVSILWENIIENQRHNFRKYETNN---LNTAYDYSSVMHYGRYAFSEDGGPTIIPKPD----PYIPIGQRDGPSILDIHKINILYNC 215          
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Match: hce2l1 (high choriolytic enzyme 2-like 1 [Source:ZFIN;Acc:ZDB-GENE-070912-147])

HSP 1 Score: 106.301 bits (264), Expect = 6.020e-25
Identity = 63/188 (33.51%), Postives = 99/188 (52.66%), Query Frame = 1
Query:  124 IPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIH-ANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCG 678
            +PYI    + D D++ ++  +    + TC+KFV   P  H AN+L I+    C+S +GM    + +   S  C   GV  HEL H +G +HE  R DR++++  + EN+ E  +  F + E+N+    NT +D+ S+M Y  YAFS++G P  +        P   I ++D  S  D+  IN LY CG
Sbjct:   97 VPYIMSTLYDDMDRITIETGMLDISSSTCVKFV---PRTHQANFLNIQPRYGCWSYLGMTGGSQTVSLQSPGCMWSGVASHELMHALGFVHEQSRSDRDRYVSILWENIIENQRHNFRKYETNN---LNTAYDYSSVMHYGRYAFSEDGGPTIIPKPD----PYIPIGQRDGPSILDIHKINILYNCG 274          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: lrrc59 (leucine rich repeat containing 59 [Source:Xenbase;Acc:XB-GENE-963187])

HSP 1 Score: 117.857 bits (294), Expect = 1.877e-26
Identity = 70/237 (29.54%), Postives = 118/237 (49.79%), Query Frame = 1
Query:   31 LIFLTIHSSYGIP----RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSD---RTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            L+FL    + G      R  RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +  +  +   R PI   +   LS  D+     LY+C       Q S+GN+
Sbjct:   72 LLFLVAAPNSGTTHRKIRTPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFIE-RTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRENIQPGQEYNFLKMEPGEVNSLGESYDFDSIMHYARNTFSRGMFLDTILPSRDENGLRPPIGQRTR--LSKGDIAQARKLYRCPACGETLQESTGNF 305          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007920.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 117.857 bits (294), Expect = 2.110e-26
Identity = 65/218 (29.82%), Postives = 112/218 (51.38%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV+RA  +   ++W G +IPY    +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH +G  HE  RPDR++H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +     D +    I ++  LS  D+     LY+C       Q S GN+
Sbjct:   82 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNF 298          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007703.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 117.472 bits (293), Expect = 2.547e-26
Identity = 65/218 (29.82%), Postives = 112/218 (51.38%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV+RA  +   ++W G +IPY    +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH +G  HE  RPDR++H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +     D +    I ++  LS  D+     LY+C       Q S GN+
Sbjct:   31 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNF 247          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007882.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 117.472 bits (293), Expect = 2.695e-26
Identity = 65/218 (29.82%), Postives = 112/218 (51.38%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV+RA  +   ++W G +IPY    +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH +G  HE  RPDR++H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +     D +    I ++  LS  D+     LY+C       Q S GN+
Sbjct:   41 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNF 257          
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Match: ENSXETT00000007740.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 117.472 bits (293), Expect = 2.719e-26
Identity = 65/218 (29.82%), Postives = 112/218 (51.38%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV+RA  +   ++W G +IPY    +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH +G  HE  RPDR++H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +     D +    I ++  LS  D+     LY+C       Q S GN+
Sbjct:   37 RVRRAATSRTERIWPGGVIPYAIAGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDEHVSIIRENIQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSVRPTIGQRIRLSQGDIAQAKKLYKCPACGETLQDSGGNF 253          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 119.398 bits (298), Expect = 6.139e-27
Identity = 64/218 (29.36%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV+RA  +   ++W G +IPY+   +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+V HELGH +G  HE  RPDR+QH+  I EN+Q   +  F ++E+         +DF SIM Y+   FS+  F   +     D      I ++  LS  D+     LY+C       Q ++GN+
Sbjct:  143 RVRRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRRDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNF 359          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 117.472 bits (293), Expect = 2.321e-26
Identity = 67/217 (30.88%), Postives = 110/217 (50.69%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGN 714
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F + + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I EN+Q   +  F ++E          +DF SIM Y+   FS+  F   +  +  D      I ++  LS  D+     LY+C       Q SSGN
Sbjct:  144 RVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKHTCVTFTE-RSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDNHVTIIRENIQPGQEYNFLKMEPGEVNSLGERYDFDSIMHYARNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESSGN 359          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Tll2 (tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044])

HSP 1 Score: 111.694 bits (278), Expect = 1.236e-24
Identity = 52/163 (31.90%), Postives = 92/163 (56.44%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFS 555
            RV+RA  +   ++W G +IPY+   +F+ + +   ++A+  ++  TC+ FV+ + +  +  +   +   C S +G +  G Q +++ K C ++G+V HELGH +G  HE  RPDR+QH+  I EN+Q   +  F ++E+         +DF SIM Y+   FS
Sbjct:  143 RVRRATTSRTERIWPGGVIPYVIGGNFTGTQRAIFKQAMRHWEKHTCVTFVE-RTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFS 304          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 105.916 bits (263), Expect = 8.435e-23
Identity = 59/209 (28.23%), Postives = 107/209 (51.20%), Query Frame = 1
Query:  100 NKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGF--PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
             ++W   +IP++   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR++H+  + EN+Q   +  F ++E    +     +DF SIM Y+   FS+  F   +  K   +   P      + LS  D+     LY+C       Q S+GN+
Sbjct:  132 ERVWPDGVIPFVIGGNFTGSQRAVFRQAMRHWEKHTCVTFLE-RTDEDSYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDRHVSIVRENIQPGQEYNFLKMEVQEVESLGETYDFDSIMHYARNTFSRGIFLDTIVPKYEVNGVKPSIGQRTR-LSKGDIAQARKLYKCPACGETLQDSTGNF 338          
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Match: Mep1b (meprin 1 beta [Source:MGI Symbol;Acc:MGI:96964])

HSP 1 Score: 91.2781 bits (225), Expect = 2.183e-18
Identity = 59/207 (28.50%), Postives = 101/207 (48.79%), Query Frame = 1
Query:   97 NNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYK-LFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISE--------KDLSFWDVKAINDLYQCGKNCS 690
            ++K W  + IPY+ ++S   + K  +  A E Y+ +TC+ F  +     AN++ + KG  C+S +G  + G+Q L++   C +   V HE  H +G  HE  R DR+ ++  + + +Q   +  F I ++      N P+D+ S+M YS  AF           N ++ T +  ISE         D S +D+  +N LY C  + S
Sbjct:   68 DHKRWP-HTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWSG--EANYISVFKGSGCWSSVGNIHAGKQELSIGTNCDRIATVQHEFLHALGFWHEQSRADRDDYVIIVWDRIQPGKEHNFNIYNDSVSDSLNVPYDYTSVMHYSKTAFQ----------NGTESTIVTRISEFEDVIGQRMDFSDYDLLKLNQLYNCTSSLS 261          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|Q9Y6L7|TLL2_HUMAN (Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.768e-27
Identity = 67/229 (29.26%), Postives = 119/229 (51.97%), Query Frame = 1
Query:   43 TIHSSYGI--PRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEK-DLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            T+H++     PRV+RA  +   ++W G +IPY+   +F+ S +   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+V HELGH +G  HE  RPDR+QH+  I EN+Q   +  F ++E+         +DF SIM Y+   FS+  F   +     D      I ++  LS  D+     LY+C       Q ++GN+
Sbjct:  135 TLHAAAKTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIE-RTDEESFIVFSYRTCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNF 362          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P55113|NAS7_CAEEL (Zinc metalloproteinase nas-7 OS=Caenorhabditis elegans OX=6239 GN=nas-7 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 4.350e-27
Identity = 70/210 (33.33%), Postives = 109/210 (51.90%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNT 696
            R KR   +   KLW    IPY     +S  ++  L KA++ Y  +TC++FV  Q     ++L I K + CFS++G + +G Q+L+L   C +Y  ++HE+ H +G  HE  R DR+  I  I +N+   A   F +++ +    +  P+D++SI+ Y   AFSKNGFP  L    S        + +D S  D+  IN +Y C    S T
Sbjct:   76 RHKRNGVSRAAKLWPNARIPYAISPHYSPHERALLAKAVKQYHEKTCIRFVPRQTG-EPDYLFIGKVDGCFSEVG-RTSGVQVLSLDNGCMEYATIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLSKTSYYGQPYDYKSILHYDSLAFSKNGFPTMLPKVKSATIG----NARDFSDVDISKINRMYNCPVEKSVT 279          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P98068|SPAN_STRPU (Protein SpAN OS=Strongylocentrotus purpuratus OX=7668 GN=SPAN PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.006e-27
Identity = 76/245 (31.02%), Postives = 123/245 (50.20%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPN-----IHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCG--KNCSNT-QCSSGNYVDKNCACQTPEMFSNRRCVD 777
            R KR    Y ++ W+  IIPY+ ++S S    L ++ A++ ++  TCL+F     +      H +++   +G  C+S +G   T +Q +++   C  +G +VHE+GH IG  HE  RPDR+++I    ENVQ   +  F   +       N  +D  SIM Y  Y FS NG P    ++    + +       LS  D++  N +Y+C   ++CSN  +C +G Y D +C C  P  +S   C D
Sbjct:   89 RKKRKATIYESQRWSYKIIPYVIESSSSGQSSL-IRSAMDHWEQNTCLRFEPLTSSHSSRLGHTSYISFFRGNGCWSHVGRSFTNQQQISIGPQCGYFGTIVHEIGHAIGFHHEQSRPDRDEYINVHFENVQSGREHNFAKYTWGSVTSSNVEYDVGSIMHYGGYGFSSNGRPTITTIDPRLNSRLG--QRTALSAADIELANRIYECDDVEDCSNADECLNGGYHDADCDCVCPSSYSGDLCQD 330          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|O57460|TLL1_DANRE (Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.108e-26
Identity = 67/218 (30.73%), Postives = 114/218 (52.29%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   K+W G +IPY+   +F+ S +  L++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:  153 RVPRAATSRAEKIWPGGVIPYVIGGNFTGSQRAMLKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFIKMEPGDVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNF 369          
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Match: sp|P25723|TLD_DROME (Dorsal-ventral patterning protein tolloid OS=Drosophila melanogaster OX=7227 GN=tld PE=2 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 2.402e-26
Identity = 74/230 (32.17%), Postives = 114/230 (49.57%), Query Frame = 1
Query:   64 IPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIE-KGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKN---------GFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYV 720
            I R +RA+     + W   +IPY  D  FS + K   ++A+  ++  TC+KFV+  PN+HAN++    K   C S +G    G Q +++ + C ++G+++HELGHTIG  HE  R DR++HI     N+    +  F++ S     L   P+D  SIM Y+  +FSK+         G P    +    R        K LS  D+   N LY+C       Q +SG+ V
Sbjct:  131 IQRRRRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQR--------KRLSRGDIVQANLLYKCASCGRTYQQNSGHIV 352          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A4Z2CRQ3 (Metalloendopeptidase OS=Schistosoma japonicum OX=6182 GN=EWB00_008126 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 3.312e-116
Identity = 235/729 (32.24%), Postives = 357/729 (48.97%), Query Frame = 1
Query:   28 CLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNS-----------FSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEK--------GENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSN--TQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGN------HSDTSTIEFL--------CKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTC----STNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINN--RVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETC------EHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFC 2070
            C  F+ I++ + + R++R+LG  + KLW   I+PYI ++            F+  D L ++KA+   + ETC++F       ++  L   K           C+S +GM     QLL L   CR  G ++HEL H +G++HE+MRPDR+Q++   +EN+ +     F+ I+ +   L +  FDFQSI LY P+ F+ NG PVW  + S +  P+F I EK LSF D   +N LYQC +NC N    C+ G + +K C C     ++  RC DD N  + C  A   N CY+E   A   CR+TCGRCFR G  G  +PP   C D+++D C+    +G+C+ D WTK+ C+ SCN C +       ++T  ++          C +R++   CE +AE+G C  NPGFM + C  SCG C         A +  APCRNY  D  CDA+ +E KC GTTLK CLGSC KCG NY R            +   N+   +EC+D  S C ++ N  +C+  K  M   C K+C  C  + C + D  +VC+A+ QRG C        RC ++C            +CKD  +L +    +  N  +    Q  +    +   P I   T+ S    + V   N  + +          +  +     Y N++++ +       +P   +     C+++    +CN+W  TGYC  N  ++ + C K C  C
Sbjct:   20 CQQFIMINAIH-LTRLQRSLGMKSIKLWPNGIVPYIIEDVDTTRNNEFSEYFTKLDVLLIKKAMSIIEEETCIQFYDLTSRTNSRTLNDRKLIRIKGRGQTGCYSSLGMVRRKHQLLRLGPTCRTVGQILHELLHALGVMHEIMRPDRDQYVILHEENIDKSYLEEFKKIKEHQSILTDRKFDFQSISLYDPFTFTSNGNPVWEPIVSLNDIPLFSIGEKYLSFEDTVGLNRLYQCDRNCPNQSIPCAPGEFRNKQCICTNATKYAFDRCHDDANQTEYCKTAVSNNKCYDEAKYAIPFCRRTCGRCFRAGSIGISTPPRKICRDVEIDLCENYVKEGYCHFDGWTKLNCQYSCNLCPSAHVVERQAETGDVKAYLEAYRKGDCFNRYDDLRCEVFAERGDCRKNPGFMSSQCTQSCGLCPQIDKQPTNATRLQAPCRNYIDDQRCDALAKEGKCYGTTLKQCLGSCNKCGDNYPRQTTESPHDTTTINTNNNSLLLIECEDQSSLCLHYKNTVECKTNKIIMLEMCPKTCGSCETE-CIDIDPSNVCNALVQRGHCNLSKAHTLRCMKSC-----------GKCKDKKTLEV-SNFMSDNIISVSTPQTTMTVEKVIINPNITTETITSANMSSPVNSANSSNTKPILNNSKMSSIVSKLTGMQYRNKSLIPKVVAKRTYIPSEYSIDKQECVDLYPKSSCNAWKKTGYC--NFSHVSKLCLKTCHLC 732          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A075A698 (Metalloendopeptidase OS=Opisthorchis viverrini OX=6198 GN=T265_00313 PE=4 SV=1)

HSP 1 Score: 371.318 bits (952), Expect = 4.070e-114
Identity = 210/580 (36.21%), Postives = 308/580 (53.10%), Query Frame = 1
Query:   22 VYCLIFLTIHSSY---GIPRVKRALGAYNNKLWTGNIIPYI----------TDNSFSDSDKLNLQKAIESYQAETCLKF--------VKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHY-KLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQ--CSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCG-------NHSDTSTIEFL-------CKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTA-----KKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVE 1632
            +  L+ LT+ +S       R KR+L   + K W   ++PYI          ++++FS+ DK+ +QKA+++ + ETC+KF         K  P +  +W      ++C++ +GM   G+  + L+  CR  G ++HEL HT+GLLHE+MRPDRN++I   +EN+ +  K  F+I+   Y  L++  FDFQSI LY P++F+ +  PVW        TP+F + EKDLSF D  AIN LY C  NC+  +  C+   ++   C C+T E ++ RRC DD  +   C +A E N CY+  I A   CRKTCGRCFR G +G  SPP  +CVD++  QC R   +G+CY D WTK++C++SC  C                E+L       C +R +   C  +AE G C  NP FM + CALSCG C     +     +     CRN   D  C+A+  E+KC G TLK C+ SCG C    + +    T  +   + A   R +CKD  + C + A  G C    E M+  C  SC FC    C + D   +C  V +RG C   AG A+RC ++C +C+ +
Sbjct:   10 IIVLLLLTVVTSRCEARTLRQKRSLALKHVKTWPNGVVPYIIKTHSANSSESEDAFSEIDKILIQKAMDTIEQETCVKFEQIEEGSNRKRSPYVEISW---RNDKHCYATLGMMTEGKNEIVLNSLCRTVGQILHELAHTLGLLHEIMRPDRNEYIVLHEENIAKHYKQEFDIQPALYTHLWDRTFDFQSITLYDPFSFAMSSKPVWEPRKHLKNTPLFPLREKDLSFEDTAAINRLYNCAVNCTQRKRKCNGNAFLTARCRCETAESYAYRRCRDDQAHRDFCSDAIEKNKCYDNAIVAIPFCRKTCGRCFRAGIFGKSSPPMKRCVDLEPKQCPRLIKEGYCYFDAWTKIHCQQSCGLCPPPDVAKRQTYSLDAREYLLAYQTGDCYNRFDDLKCMIFAESGHCKGNPSFMTSYCALSCGNCHKQNNSDLSYLRIAQIGCRNLIDDERCNALASEHKCRGVTLKQCMLSCGVC---RDESPKPTTLPKPTTTPAAKVRRQCKDKSTMCPWLAEHGHCLTKPEQMEQLCPLSCKFCLED-CVDLDPPHICADVKKRGYCIYDAGHASRCAKSCGLCKTQ 582          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A3Q0KFI6 (Metalloendopeptidase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 4.227e-114
Identity = 236/729 (32.37%), Postives = 355/729 (48.70%), Query Frame = 1
Query:   40 LTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDN-----------SFSDSDKLNLQKAIESYQAETCLKFVKYQPNI--------HANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSN--TQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGN------HSDTSTIEFL--------CKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPN-------------APCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINN---RVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFC 2070
            L I ++  + R +R+L   N  LW   I+PYI D+            F+  D L ++KA+   + ETC++F               H   +K      C+S +GM     Q+L L   CR  G ++HEL H +G++HE+MRPDR+Q++   +EN+ +     F+ I+ +   L N  FDFQSI LY P+ F+ NG PVW  + + D  P+F ISEK LSF D   +N LY+C ++CSN  T C  G + +K+C C     ++  RC DD N  K C +A   N CY+E   A   CR+TCGRCFR G  G  +PP   C D++++ C+    +G+C+ D WTK+ C+ SCN C +        +TS +           C +R++   CE +AE+G C  NPGFM + C  SCG C  ++  ++PN             APCRNY  D  CDA+ +E KC GTTLK CLGSC KCG NY+R                N     +EC+D    C Y+ N  +C+  K  M   C K+C  C    C++ DS  VC+ + QRG C        RC+++C IC+  D+K L     + +      +  R    T+ G+    +       +  +TT  S+  + M   ++  +E +      +     ++ +            LP   +     C++     +C +W +TGYC  N  ++ + C K C  C
Sbjct:   25 LLIINATQLTRYQRSLSMKNIILWPNGIVPYIIDDIDKTKSNEFTEYFNKLDVLLIKKAMSIIEEETCIQFYDLTSRTNTRRFYDRHLIRIKGRGQRGCYSSLGMMRNKNQVLRLGPTCRTVGQILHELLHALGVMHEIMRPDRDQYVILHEENIDKSYLEEFKKIKEHQSILTNRKFDFQSISLYDPFTFTSNGNPVWEPIINLDDVPLFSISEKYLSFEDTVGLNRLYKCDRSCSNQSTLCEPGEFRNKHCVCINASKYAFDRCKDDVNETKYCSDAVSKNKCYDEAKYAIPFCRRTCGRCFRAGSIGISTPPKKLCQDVEINMCETYVKEGYCHFDGWTKLNCQYSCNLCPSPDVVKRQVETSDVRAYLEAYRKGDCFNRYDDLRCEVFAERGDCRTNPGFMSSQCTQSCGLCP-DVENQRPNGSYTQSSNTIRLPAPCRNYIDDQRCDALAKEGKCFGTTLKQCLGSCNKCGDNYQRQTTEIPHTTTTNIINNNKSLLSLECEDQSLLCSYYKNTSECKTNKIIMLEMCPKTCESCETN-CEDIDSLSVCNDLVQRGYCNLSKPHTQRCKKSCGICK--DTKVLKTNSSMSNNRTSVIVSNR---TTEIGKIISTTTVAPTNSVTFSTTKDSLNGIEMTSTISRTAEISSRKPSSK---HKFVTKRTY---------LPSEYSEDKQECIDRYPKTSCVAWKNTGYC--NFPHVSKLCLKTCHLC 732          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A504Z493 (Metalloendopeptidase OS=Fasciola gigantica OX=46835 GN=FGIG_02631 PE=4 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 8.717e-112
Identity = 238/717 (33.19%), Postives = 346/717 (48.26%), Query Frame = 1
Query:   64 IPRVKRALGAYNNKLWTGNIIPYITDNS----------FSDSDKLNLQKAIESYQAETCLKFVKYQPN---IHANWLKIEKGEN---CFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHY-KLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQ--CSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCG---------NHSDTSTI-----EFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTA-----KKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNY--ERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPII-----CLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSK 2079
            + R  R+L   N K W G +IPY+              FSD D   + KAI++ + ETC++F+    N   ++ ++++   G N   C +Q+G+ N G   L LS  CR +G ++HEL H +GL+HE+MRPDR+ +I   +EN+  +    F     H  ++++T FDFQS+ LY P+ FS N  PVW      D TP+F + EKDLSF D  AIN LY CG +CS  +  C    Y+ K C C++ E ++ RRC DD  +   C  A E N CY+E   A   CRKTCGRCFR G +G  +PP   C D+D   C +   +GFCY D WT++ C+KSCN C          N+ D  +      E  C +R +   C+ ++++G C  NP FM + CAL+C  C           +   APCRNY  D  CD++ RE KC+G T K CL SC +CG +Y  +R +   T + V K         C D    C      G C++ ++ M+  CAK+C FC  K C++ D   VC  V QRG C     F +RC ++C  C    S   +     +S H  + I  ++                      ++  +  + S +MV   +  S       +ER       NR ++         +P   T + +I     CL+      C SWA +GYC     ++   C   C  C SK
Sbjct:   24 LRRTGRSLSFSNLKTWPGAVIPYLIGAGRNTSRANAWLFSDLDVKLILKAIQTIEEETCVRFIDASQNTSLLNNSYVEFV-GRNEKYCHAQLGVVNDGRHELILSPLCRSFGQILHELTHALGLMHELMRPDRDDYIIVHEENISPDYTEEFRRLMRHQAQMWDTLFDFQSVTLYDPFTFSANSKPVWEPRKPLDNTPLFSLLEKDLSFEDAAAINLLYHCGAHCSKRRVPCRPDEYLTKTCRCESRESYAFRRCKDDRTHRAYCSQAIEHNKCYDETRLAVPFCRKTCGRCFRSGIFGRIAPPHKICRDLDPKHCPKYVKEGFCYFDAWTQLNCQKSCNLCPPFGIAKRQVNNLDARSYLADYQEGKCLNRFDDLKCQIFSDRGDCETNPTFMSSFCALACNNCGNKTMGDLRYLRLNTAPCRNYIDDDRCDSLAREGKCHGITKKQCLASCNQCGNSYWEKRAQIKATSKPVTK---------CFDSSEICPRLVELGDCEQKRDLMERICAKACKFCIAK-CEDLDPPVVCTDVVQRGYCHRTGSFGDRCAKSCGFC----SDIKESTNKSNSGHTGRRIADKS----------------------SSKRVKPVLSYSMVRNSHRTSRPLTAVKQER-------NRPLVMN-------VPSPQTVSTVIGKDEPCLDSRPTSMCRSWARSGYCVH--PHVSNLCKSTCTVCKSK 687          

HSP 2 Score: 75.8702 bits (185), Expect = 3.025e-10
Identity = 101/425 (23.76%), Postives = 154/425 (36.24%), Query Frame = 1
Query: 1237 SYCDAMFRENKCNGTT---LKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDL-VSNCQYFANDGQCQKYKETMKYHCAKSCNFCS----------------------HKLCKNEDSDDVCDAVSQRGLCTAHAGF-ANRCQRTCQIC---QVEDSKSLD----ECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLN-RAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFS-KDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGY-CNKSFTV-TPIKTTVE--------CKNTESDELCESW-RQNYCSVSHIADLCKKTCNIC 2370
            +YC      NKC   T   +  C  +CG+C ++            +A  H I     C+DL   +C  +  +G C  +    + +C KSCN C                          C N   D  C   S RG C  +  F ++ C   C  C    + D + L      C++      C  + R  +C+    ++CL SCN C              S  + +C   DS E C  L E G C+   +    +C K+C  C         P++C +V            GYC     +  + CAK+C FC   K++T   ++ +T  R    S          Y      H     L +     N+   +  P   TV         C ++    +C SW R  YC   H+++LCK TC +C
Sbjct:  285 AYCSQAIEHNKCYDETRLAVPFCRKTCGRCFRS-------GIFGRIAPPHKI-----CRDLDPKHCPKYVKEGFCY-FDAWTQLNCQKSCNLCPPFGIAKRQVNNLDARSYLADYQEGKCLNRFDDLKCQIFSDRGDCETNPTFMSSFCALACNNCGNKTMGDLRYLRLNTAPCRNYIDDDRCDSLAREGKCHGITKKQCLASCNQCGNSYWEKRAQIKATSKPVTKCF--DSSEICPRLVELGDCEQKRDLMERICAKACKFCIAKCEDLDPPVVCTDV---------VQRGYCHRTGSF-GDRCAKSCGFCSDIKESTNKSNSGHTGRRIADKSSSKRVKPVLSYSMVRNSHRTSRPLTAVKQERNRPLVMNVPSPQTVSTVIGKDEPCLDSRPTSMCRSWARSGYCVHPHVSNLCKSTCTVC 684          
BLAST of Metalloendopeptidase vs. TrEMBL
Match: A0A4E0RPD3 (Metalloendopeptidase OS=Fasciola hepatica OX=6192 GN=D915_006491 PE=4 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 4.152e-111
Identity = 240/708 (33.90%), Postives = 349/708 (49.29%), Query Frame = 1
Query:    1 MILETFRVYCLIFLTIHSSYGIP----RVKRALGAYNNKLWTGNIIPYITDNS----------FSDSDKLNLQKAIESYQAETCLKFVKYQPN---IHANWLKIEKGEN---CFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNH-YKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQ--CSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCG---------NHSDTSTI-----EFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTA-----KKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNY--ERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQIC-----------------QVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLC-NQPMIAATTLPSMESVTMVECVNE---DSEET--CEHLKERGLCQSYLNRAVLCRKSCNLC 1923
            M L  F  +  ++L +  S  IP    R  R+L   N K W G I+PY+              FSD D   + KAI++ + ETC++F+    N   ++ ++++   G N   C +Q+G+ N G   L LS  CR +G ++HEL H +GL+HE+MRPDR+ +I   +EN+  +    F     H  +++NT FDFQS+ LY P+ FS N  PVW      D TP+F + EKDLSF D  AIN LY CG +CS  +  C    Y+ K C C++ E ++ RRC DD  +   C  A E N CY+E   A   CRKTCGRCFR G +G  +PP   C D+D   C +   +GFCY D WT++ C+KSCN C          N+ D  +      E  C +R +   C+ ++ +G C  NP FM + CAL+C  C           +   APCRNY  D  CD++ +E KC+G T K CL SC +CG +Y  +R +   T + V +         C D    C      G C++ ++ M+  CAK+C FC  K C++ D   VC  V QRG C     F +RC ++C  C                 ++ D  S    K   S  + +        N  R  R L +     N+P++    +PS ++V+ V   N+   DS  T  C      G C  + + + LC+ +C +C
Sbjct:    1 MKLSVFLAWLGLWLVL--SDPIPSKLRRAGRSLSFSNLKTWPGAIVPYLIGAGRNTSRANAWLFSDLDVKLILKAIQTIEEETCVRFIDASQNTSLLNNSYVEFV-GRNEKYCHAQLGVVNDGRHELILSPLCRSFGQILHELTHALGLMHELMRPDRDDYIIVHEENISPDYTEEFRRLMRHQAQMWNTLFDFQSVTLYDPFTFSANSKPVWEPRKPLDNTPLFSLLEKDLSFEDAAAINLLYHCGAHCSKRRVPCRPDEYLTKTCRCESRESYAFRRCKDDRTHRAYCSQAIEHNKCYDETRLAVPFCRKTCGRCFRSGIFGRIAPPHKICRDLDPKHCPKYVKEGFCYFDAWTQLNCQKSCNLCPPFGIAKRQVNNLDARSYLADYQEGKCLNRFDDLKCQIFSARGDCETNPTFMSSFCALACNNCGNKTMGDLRYLRLNTAPCRNYIDDDRCDSLAKEGKCHGITKKQCLASCNQCGNSYWEKRAQIKATPKPVTR---------CFDSSEICPRLVELGDCEQKRDLMERICAKACKFCIAK-CEDLDPPVVCTDVVQRGYCHRTGSFGDRCAKSCGFCSDMKESTDKSNSSYTGRRIADKSSSKPIKSALSYSVVR--------NGHRTSRPLTAVKQGRNRPLV--MNVPSPQTVSTVIGKNDPCRDSRPTSMCRSWARSGYC-VHPHVSNLCKSTCTVC 684          

HSP 2 Score: 76.6406 bits (187), Expect = 1.700e-10
Identity = 103/431 (23.90%), Postives = 161/431 (37.35%), Query Frame = 1
Query: 1237 SYCDAMFRENKCNGTT---LKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDL-VSNCQYFANDGQCQKYKETMKYHCAKSCNFCS----------------------HKLCKNEDSDDVCDAVSQRGLCTAHAGF-ANRCQRTCQIC---QVEDSKSLD----ECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCN------QPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLN-RAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFS-KDTTISPSTANTHCR--NKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVE--------CKNTESDELCESW-RQNYCSVSHIADLCKKTCNIC 2370
            +YC      NKC   T   +  C  +CG+C ++            +A  H I     C+DL   +C  +  +G C  +    + +C KSCN C                          C N   D  C   S RG C  +  F ++ C   C  C    + D + L      C++      C  + +  +C+    ++CL SCN C       +  I AT  P      +  C   DS E C  L E G C+   +    +C K+C  C         P++C +V            GYC     +  + CAK+C FC   K++T   +++ T  R  +K +S+   S ++     +     R       G         P   TV         C+++    +C SW R  YC   H+++LCK TC +C
Sbjct:  285 AYCSQAIEHNKCYDETRLAVPFCRKTCGRCFRS-------GIFGRIAPPHKI-----CRDLDPKHCPKYVKEGFCY-FDAWTQLNCQKSCNLCPPFGIAKRQVNNLDARSYLADYQEGKCLNRFDDLKCQIFSARGDCETNPTFMSSFCALACNNCGNKTMGDLRYLRLNTAPCRNYIDDDRCDSLAKEGKCHGITKKQCLASCNQCGNSYWEKRAQIKATPKP------VTRCF--DSSEICPRLVELGDCEQKRDLMERICAKACKFCIAKCEDLDPPVVCTDV---------VQRGYCHRTGSF-GDRCAKSCGFCSDMKESTDKSNSSYTGRRIADKSSSKPIKSALSYSVVRNGHRTSRPLTAVKQGRNRPLVMNVPSPQTVSTVIGKNDPCRDSRPTSMCRSWARSGYCVHPHVSNLCKSTCTVC 684          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 122.094 bits (305), Expect = 6.722e-28
Identity = 67/227 (29.52%), Postives = 117/227 (51.54%), Query Frame = 1
Query:   43 TIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            T+ +S G  RV RA  +   ++W G +IPY+   +F+   +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:   80 TLQNSRGKSRVPRAATSRAERIWPGGVIPYVIGGNFTGDQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNF 305          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 120.168 bits (300), Expect = 2.406e-27
Identity = 66/221 (29.86%), Postives = 114/221 (51.58%), Query Frame = 1
Query:   61 GIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            G  RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:  135 GKSRVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNF 354          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 119.783 bits (299), Expect = 3.222e-27
Identity = 65/218 (29.82%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:   58 RVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNF 274          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 119.783 bits (299), Expect = 3.236e-27
Identity = 65/218 (29.82%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:   42 RVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNF 258          
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 119.783 bits (299), Expect = 3.315e-27
Identity = 65/218 (29.82%), Postives = 113/218 (51.83%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            RV RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S GN+
Sbjct:   95 RVPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDISQAKKLYRCPACGETLQDSMGNF 311          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007253.1 (pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1 gene:ENSPMAG00000006538.1 transcript:ENSPMAT00000007253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.242 bits (295), Expect = 1.990e-27
Identity = 67/219 (30.59%), Postives = 110/219 (50.23%), Query Frame = 1
Query:   70 RVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGF--PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            R  RA  A + ++W G +IPYI   +F+ S K   ++A+  ++  TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I  N+Q   +  F ++E          +DF SIM Y+   FS+  F   +  + + S   P      + LS  D+     LY+C       Q S GN+
Sbjct:    9 RAPRAATARSERIWPGGVIPYIVGGNFTGSQKAMFRQAMRHWEKHTCVTFIE-RTDEESYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIKANIQPGQEYNFLKMEPGEVDSLGESYDFDSIMHYARNTFSRGIFLDTILPRPDDSGVRPAIGQRTR-LSQGDIAQARKLYRCPACGETLQESVGNF 225          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004913.1 (pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 gene:ENSPMAG00000004462.1 transcript:ENSPMAT00000004913.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 8.738e-16
Identity = 34/88 (38.64%), Postives = 51/88 (57.95%), Query Frame = 1
Query:  277 CFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYKLFNTPFDFQSIMLYS 540
            C+S +GM   GEQ++++ + C   G V HELGH +G +HE  RPDR+  I  ++ NVQ+     F + S        P+D +S+M YS
Sbjct:    1 CWSFVGMIGVGEQVVSIGRGCEGVGTVAHELGHAVGYVHEQSRPDRDAFISVLEGNVQDGQLPQFAVYSA-TDPRGVPYDLKSVMHYS 87          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001798.1 (pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 gene:ENSPMAG00000001629.1 transcript:ENSPMAT00000001798.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 1.305e-10
Identity = 52/197 (26.40%), Postives = 93/197 (47.21%), Query Frame = 1
Query:  124 IPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYK-----LFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIF--DISEK-DLSFWDVKAINDLYQCGKNCS 690
            IPY  D S   + K  + +A E Y+ +TC+ F  +       ++++ KG  C+S +G  + G+Q L++   C +  VV   L H   L+   +    +  + ++  +    A +G E   + Y+     L N P+D+ S+M Y   AF K   P  +      R P F   I ++ D S +D++ +N LY C ++ +
Sbjct:   17 IPYYLDISLDVNAKGVIMQAFEMYRLKTCIDFKPWAG--EREYIQVIKGSGCWSYVGNLHYGKQELSIGANCDRLLVVPFNLAH---LMDSYLHITTSMLVLFVAGHFTVLA-LGREGNFDKYEDDVTDLQNVPYDYSSMMHYGASAFQKAEEPTIVT-----RIPDFMQVIGQRSDFSKYDLQKLNRLYNCTRSLA 202          
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007988.1 (pep scaffold:Pmarinus_7.0:GL476685:1987009:1991341:1 gene:ENSPMAG00000007221.1 transcript:ENSPMAT00000007988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 6.619e-7
Identity = 46/196 (23.47%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  115 GNI-IPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEE-AKIGFEIESNHYKL--FNTPFDFQSIMLYSPY-AFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKN 684
            GN+ IPY   N +    +  +Q+A+  +   TC++FV       A++L       C+S +G  + G Q+++L + C  + ++ H++   +    E  R +     R +  +      + G+E   N  +    +TP+D+ S++ Y+ Y ++ KN  P  +    ++ T    + +++ LS  DV  +N  Y C K+
Sbjct:   47 GNVYIPYEMYNRYEPEQQRVIQEAMNEFNYRTCVRFVPRHN--EADYLAFYPVMGCYSLMG-HHRGMQIVSLDERCLPFNLLGHKVVCYVRYKAERCRENTGCESRVVPFSAFVACRRAGYEHNFNKEQTNNLDTPYDYGSLLHYNRYTSYQKNRRPTLVPTPETNVT----LGQREKLSDQDVYKVNRFYACSKH 235          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO47261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMF1])

HSP 1 Score: 144.436 bits (363), Expect = 1.153e-37
Identity = 107/414 (25.85%), Postives = 188/414 (45.41%), Query Frame = 1
Query:  100 NKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVY----CKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGT---TLKICLGSCGKC 1317
             ++W   +IPY+ D S S+  K+     ++ ++++TC++FV+ +     ++L I +G +C+S +G +  G++++++   C  + V++HELGH IG  HE  RPDR++++R +  N+ +  +  F ++           +DF SIM Y   AFS+N     L +     TP   ++++     DV  +N +Y+C   C +   S   +  K   C+  + F    C     + K C + +E         ++  +C+     C ++  Y                        G+C+      VY    CK+SC  C +  D S     C+D+H S  C  WA  G C + P +M  +C L+C  C+  +  + P  PC N  PD  CD   +  KC       ++ C  SC  C
Sbjct:    7 KRIWYDGVIPYVIDCSLSELMKVFF--TMKEWESKTCVRFVEREGE--DDYLTIFRGTHCYSTVG-RAKGKRIMSVGNGCEYHHVMLHELGHVIGFWHEQSRPDRDEYVRVLWHNIAKGWENAFLKLSWEAVDTMRVHYDFSSIMHYPFDAFSRNNKRTLLPLIPVKATPYTKLTDR-----DVLKVNLMYKCSTICRDKLYSCKLWA-KQGFCEIRKDFMPTEC---PKSCKICQDKNERT------TTSMPVCKDRTSWCRKWASY------------------------GYCHTKA---VYMLKSCKRSCGICEDPRDPS---LPCEDKHKS--CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGP--PCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 2 Score: 59.6918 bits (143), Expect = 2.210e-9
Identity = 51/188 (27.13%), Postives = 80/188 (42.55%), Query Frame = 1
Query: 1825 EDSEETCEHLKERGLCQSYLN-RAVLCRKSCNLCALPKASTSTPIICLNVEDDET--CNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESW-RQNYCS--VSHIADLCKKTCNIC 2370
             D   +C+   ++G C+   +     C KSC +C      T+T    + V  D T  C  WAS GYC     YM ++C ++C  C        P   +  C +K  S  C+ W + G C     +M  +C  +C  C              C N + DE C+ W +   C+   S++ + C+K+CN C
Sbjct:  194 RDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTS---MPVCKDRTSWCRKWASYGYCHTKAVYMLKSCKRSCGIC------EDPRDPSLPCEDKHKS--CVYWASIGVCDVRPTYMYKHCRLACRVCTPGIK----HEGPPCDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 3 Score: 59.3066 bits (142), Expect = 2.684e-9
Identity = 51/186 (27.42%), Postives = 79/186 (42.47%), Query Frame = 1
Query: 1543 CDAVSQRGLCTAHAGF-ANRCQRTCQICQVEDSK---SLDECKDLDSLHICQEIVRRNQCNTDRG---QRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQ---SYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFC 2070
            C   +++G C     F    C ++C+ICQ ++ +   S+  CKD  S   C++      C+T      + C  SC +C  P     +LP            ED  ++C +    G+C    +Y+ +   CR +C +C         P  C N + DE C+ WA  G C     YM E C K+C  C
Sbjct:  200 CKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTSW--CRKWASYGYCHTKAVYMLKSCKRSCGICEDP--RDPSLPC-----------EDKHKSCVYWASIGVCDVRPTYMYKH--CRLACRVCTPGIKHEGPP--CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNAC 366          

HSP 4 Score: 53.5286 bits (127), Expect = 1.718e-7
Identity = 52/197 (26.40%), Postives = 76/197 (38.58%), Query Frame = 1
Query: 1666 DSLHICQEIVRRNQCNTDRG---QRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQS---YLNRAVLCRKSCNLCALPKASTSTPIICLNVEDD-ETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKS 2235
            D L+ C+   ++  C   +      C  SC +C       TT       +M  C  +D    C      G C +   Y+ ++  C++SC +C  P+  +      L  ED  ++C  WAS G C     YM ++C  AC+ C        P      C NK   E C  W   G C     +M   C +SC  C  S
Sbjct:  195 DKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTT-------SMPVC--KDRTSWCRKWASYGYCHTKAVYMLKS--CKRSCGICEDPRDPS------LPCEDKHKSCVYWASIGVCDVRPTYMYKHCRLACRVCTPGIKHEGPP-----CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPS 369          

HSP 5 Score: 53.5286 bits (127), Expect = 2.121e-7
Identity = 56/196 (28.57%), Postives = 83/196 (42.35%), Query Frame = 1
Query: 1399 CKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHK---------LCKNEDSDDVCDAVSQRGLCTAHAGFANR-CQRTCQICQVEDSKSL------DECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAV-LCRKSCNLCALPK 1935
            C+D + +C+ +A  G C+  K+ M   C KSC  C  K         +CK+  S   C   +  G C   A +  + C+R+C IC+     SL        C    S+ +C   VR     T   + C  +C +C  P I     P         C N+D +E C+H  + G C S  +  +  C+KSCN C   K
Sbjct:  193 CRDKLYSCKLWAKQGFCEIRKDFMPTECPKSCKICQDKNERTTTSMPVCKDRTS--WCRKWASYGYCHTKAVYMLKSCKRSCGICEDPRDPSLPCEDKHKSCVYWASIGVCD--VR----PTYMYKHCRLACRVCT-PGIKHEGPP---------CDNKDPDEECDHWAKLGKCASRPSYMMEKCQKSCNACPPSK 370          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO42421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1T1])

HSP 1 Score: 116.701 bits (291), Expect = 7.288e-30
Identity = 69/202 (34.16%), Postives = 104/202 (51.49%), Query Frame = 1
Query:   82 ALGAYNNKLWTGNIIPYITDNSFSDSDKL--NLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQC 675
            A G+   KLW G ++ Y  D  F  S +    L +AI  Y+  TC++F K   N + +++ I+    C S +G +  G+Q L+LS  C   G ++HELGH +G  HE  RPDR+ ++  + EN++      F   S        TP+D+ SIM Y P  FS NG P  +      + P     ++D LS  D+K +N LY+C
Sbjct:    3 ARGSITQKLWPGGVVVYELDPRFERSSRAMEKLTQAISDYEKYTCIRFRKKTANDN-DYVYIKDRGGCRSHVGRKG-GKQYLSLSSGCWHKGTIIHELGHALGFFHEQTRPDRDDYVTILFENIRLGMASNFMKHSAGEVDSLGTPYDYGSIMHYGPKIFSANGKPTIVA-----KKPGVKFGQRDGLSPIDIKQVNLLYKC 197          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO49969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RET1])

HSP 1 Score: 113.235 bits (282), Expect = 5.463e-29
Identity = 58/169 (34.32%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  172 LQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEI-ESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQC 675
            L+ AI  ++ +TCL+F+  +     ++++   G+ C S +G   TG Q  ++ K C  +G++VHE+GH IGL HE  RPDR+QH++   +NV  +    FE+ ++N       P+D+ S+M Y    FSKNG P  L    S +  I +     +S  D K +N +Y+C
Sbjct:    7 LKGAIAEWERKTCLRFI--ERTTQTDYVEFYYGQGCNSDVGAMKTGRQTTSIGKGCEDHGIMVHEIGHLIGLYHEQNRPDRDQHVKIEFKNVHPQYFYAFEVKDANEVDSRGVPYDYYSVMHYGSKDFSKNGRPTIL----SKKEGITEFGNNHISPLDAKIVNLMYKC 169          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO47851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL03])

HSP 1 Score: 106.686 bits (265), Expect = 1.643e-26
Identity = 67/194 (34.54%), Postives = 96/194 (49.48%), Query Frame = 1
Query:  103 KLWTGNIIPYITDNSFSDSDKLNLQKA-IESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHY-KLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTP-IFDISEKDLSFWDVKAINDLYQC 675
            KLW G IIPY  D S S    + + KA +  ++  TC++FV         ++ I  G  C   +G       LLTL K C  + VV+HELGHTIG  HE  RPDR+++++ + ENV  + +  +   S         P+D+ SIM YS   ++  G     K+    R P I  +    LS  D+K  N LY+C
Sbjct:    1 KLWPGAIIPYKIDPSISKFKHVRIIKAAMREWERVTCVRFVDKTREPIREYVHIHYGVGCRGSVGRWPNTRSLLTLGKWCDNFKVVLHELGHTIGFWHEQNRPDRDKYVKVMLENVIPKWRFAYSRYSRRLIDSLEVPYDYYSIMHYSNKMYALPG-----KITIIPRDPSIKSLGNTGLSALDIKQTNMLYKC 189          
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Match: EDO39627 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9K8])

HSP 1 Score: 108.997 bits (271), Expect = 1.976e-26
Identity = 68/195 (34.87%), Postives = 102/195 (52.31%), Query Frame = 1
Query:  109 WTGNIIPYITD--NSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHAN--WLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIES-NHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCG 678
            WT  ++PY  D   S S      +  AI  Y  +TC++F   +P + ++   LKI KG  C+S +GM    +QL +L+  C   G+V+HE  H +G  HE  RPDR+Q +    EN+++     F+  S N+     TP+D+ S+M Y  YAFSKNG P  +    + +  +     + LS  D K IN  Y+CG
Sbjct:   50 WTNGVVPYELDPSISSSSYAVSVINSAIAEYNQKTCIRF---RPRVPSDKYGLKIFKGGGCWSYVGMSMPTQQL-SLAGGCWSKGIVIHEFAHALGFYHEQSRPDRDQFVEIKTENIRDGVASNFKKHSFNYVTTHGTPYDYGSVMHYGAYAFSKNGKPTIV----AKQPGVILGQRRGLSDIDTKQINIHYRCG 236          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 120.168 bits (300), Expect = 2.048e-27
Identity = 65/221 (29.41%), Postives = 115/221 (52.04%), Query Frame = 1
Query:   61 GIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            G  R+ RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S+GN+
Sbjct:   52 GKSRIPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRCPVCGETLQESTGNF 271          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: tll1 (tolloid like 1 [Source:NCBI gene;Acc:101160961])

HSP 1 Score: 119.783 bits (299), Expect = 3.171e-27
Identity = 65/221 (29.41%), Postives = 115/221 (52.04%), Query Frame = 1
Query:   61 GIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            G  R+ RA  +   ++W G +IPY+   +F+ S +   ++A+  ++ +TC+ F++ + +  +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR+ H+  I +N+Q   +  F ++E         P+DF SIM Y+   FS+  F   +  +  +      I ++  LS  D+     LY+C       Q S+GN+
Sbjct:  151 GKSRIPRAATSRAERIWPGGVIPYVIGGNFTGSQRAMFKQAMRHWEKQTCVTFIE-KTDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDDHVTIIRDNIQPGQEYNFLKMEPGEVNSLGEPYDFDSIMHYARNTFSRGMFLDTILPSRDENGVRPAIGQRTRLSKGDIAQARKLYRCPVCGETLQESTGNF 370          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: bmp1a (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125511])

HSP 1 Score: 117.472 bits (293), Expect = 1.486e-26
Identity = 69/223 (30.94%), Postives = 116/223 (52.02%), Query Frame = 1
Query:   61 GIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGF--PVWLKMNSSD-RTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            G  R KRA  +   ++W   +IPY+   +FS S +   ++A+  ++  TC+ F++ +    +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR++H+  I +N+Q   +  F ++E          +DF SIM Y+   FS+  F   +  + + +  R PI   +   LS  D+     LY+C K   + Q SSGN+
Sbjct:   98 GSQRRKRAATSRPERVWPEGVIPYVISGNFSGSQRAVFRQAMRHWEKHTCVTFIE-RTQEESYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIKDNIQPGQEYNFLKMEPGEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTR--LSKGDIAQARKLYKCSKCGESLQDSSGNF 317          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: bmp1b (bone morphogenetic protein 1 [Source:NCBI gene;Acc:100125512])

HSP 1 Score: 110.153 bits (274), Expect = 3.248e-24
Identity = 61/208 (29.33%), Postives = 109/208 (52.40%), Query Frame = 1
Query:  103 KLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFSKNGF--PVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNY 717
            ++W   IIPY+   +FS S +   ++A+  ++  TC+ F++ +    +  +   +   C S +G +  G Q +++ K C ++G+VVHELGH IG  HE  RPDR++H+  + +N+Q   +  F ++E +        +DF SIM Y+   FS+  F   +  + + +   P      K LS  D+     LY+C +   + Q S+GN+
Sbjct:  106 RVWPNGIIPYMISGNFSGSQRAIFRQAMRHWEKHTCVTFIE-RTTEESYIVFTYRPCGCCSYVGRRGGGPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIVRDNIQAGQEYNFLKMEPDEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPAIGQRTK-LSKGDISQACKLYKCARCGESLQESTGNF 311          
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Match: mc6ast5 (astacin like metallo-protease [Source:NCBI gene;Acc:100049509])

HSP 1 Score: 101.679 bits (252), Expect = 2.224e-23
Identity = 63/204 (30.88%), Postives = 104/204 (50.98%), Query Frame = 1
Query:   97 NNKLWTGNI-----IPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIH-ANWLKIEKGENCFSQIGMQNTGEQLLTL-SKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKD-LSFWDVKAINDLYQCGKN 684
            N  LW  ++     +PYI    + D D++ ++  ++   + TC+KFV   P  H A++L I+    C+S +G Q  G Q L+L +  C   G+  HE  H +G +HE  R DR+ ++  + +N+  +    F  ++ +    N+P+D+ S+M Y  YAFS +G P  +        P   I ++D  S  D+  IN LY CG N
Sbjct:   89 NTCLWPKSVDGFVYVPYIVSPLYDDMDRITIETGMQDIASGTCIKFV---PRTHEAHFLDIQPRYGCWSFLG-QTGGSQTLSLQTPGCMWSGIAAHEFMHALGFVHEQSRSDRDHYVTIVWKNIMPDHAHNFRKQATNN--LNSPYDYSSVMHYGRYAFSGDGGPTIIPRPD----PYIPIGQRDGPSALDLHKINVLYDCGAN 282          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000013804.1 (SMESG000013804.1)

HSP 1 Score: 1630.92 bits (4222), Expect = 0.000e+0
Identity = 787/790 (99.62%), Postives = 789/790 (99.87%), Query Frame = 1
Query:    1 MILETFRVYCLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESWRQNYCSVSHIADLCKKTCNIC 2370
            MILETFRVYCLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDEN+QEEAKIGFEIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMN+SDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYC DHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESWRQNYCSVSHIADLCKKTCNIC
Sbjct:    1 MILETFRVYCLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENIQEEAKIGFEIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNASDRTPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCKDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESWRQNYCSVSHIADLCKKTCNIC 790          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074510.1 (SMESG000074510.1)

HSP 1 Score: 229.565 bits (584), Expect = 1.869e-65
Identity = 183/592 (30.91%), Postives = 271/592 (45.78%), Query Frame = 1
Query:    1 MILETFRVYCLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSFSDSDKL-NLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTL-SKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGF-EIESNHYKLFNTPFDFQSIMLYSPYAFS-KNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNCS-NTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGNHSDT-STIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKC--NGTTLKI-CLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVS--NCQYFANDGQCQKYKETMKYHCAKSCNFCSHK-------LCKNEDSDDVCDAVSQRGLCTAHAGFAN-RCQRTCQIC-QVEDSKSLDE--CKDLDSLHICQEIVRRNQC 1710
            ++L TF + CL   +I       R KRA+ +     WT   IPY  D S  + ++L  L  AI+++  ETC++F K + N   NW+KI  G  C S +GM   GEQ L+L S  CR YG  +HELGH +GLLHE  RP RNQ I    + +QE  +  + E + +    +N P+D QS+M Y   +FS  +G P     NSS    + ++  KDLSF DVK IN  Y+C   C     C    YVDK C C  PE F NRR          C N +E + C ++         K  G C                                 Y   +  V C+K+C+ C  +       + +C++      CE+WA++G+C  NPG+M   C  SCG C   MT       CRN   +  CD +    KC  N   +K+ C  +CG C            + +     +  +   C D +S   C+ +A + +C+   + M+  C K+C  C  K       LC+N  +D +C+  S +  C   A F   RC++TC++C + ++SK +    CKD+ S   C+ +  +  C
Sbjct:   12 VVLLTFNI-CLTLSSI-------RDKRAVISTQATKWTNRTIPYYIDESVFNVEELTQLHDAIDAWNMETCVRFRK-KVNDDINWVKITGGTQCHSFVGMNEEGEQSLSLASPDCRFYGTYLHELGHVLGLLHEHTRPGRNQFIHVHRDKIQEGHEEFYNENDMSELNSYNLPYDLQSVMHYGSKSFSGHDGQPTINVKNSSLTHLLEEVDAKDLSFLDVKIINLHYKCADLCERKVSCPLNGYVDKFCQCHIPETFENRR----------CRNKNEDDWCTDQ---------KKLGNCE--------------------------------YNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFC------------DSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICE--SMKAKCHTDAPFMKLRCKKTCEMCSKGQNSKFITSPPCKDIYSNEKCKSLKSKGHC 529          

HSP 2 Score: 94.7449 bits (234), Expect = 7.917e-20
Identity = 63/192 (32.81%), Postives = 94/192 (48.96%), Query Frame = 1
Query: 1816 CVNEDSEETCEHLKERGLCQ---SYLNRAVLCRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVE---CKNTESDELCESWRQN-YCSVSHIADLCKKTCNIC 2370
            C N + ++TCE+  +RG CQ    Y+N  + C+KSC +C     +  T I C N  ++E C+   S G CFENK YMK NC K C FC SK    + + +   C +K +   C  W     C  +   M+  C ++C  C       P K  ++   C+N  +D +CES +   +     +   CKKTC +C
Sbjct:  314 CRNFEKDKTCENWAKRGECQRNPGYMN--IKCKKSCGICVEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCE------PKKDKIQKPLCRNVYNDSICESMKAKCHTDAPFMKLRCKKTCEMC 497          

HSP 3 Score: 67.3958 bits (163), Expect = 2.988e-11
Identity = 71/303 (23.43%), Postives = 132/303 (43.56%), Query Frame = 1
Query: 1069 CKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTC-STNMTAKKPNAPCRNYSPDSYCDAMFRENKC--NGTTLKI-CLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVS--NCQYFANDGQCQKYKETMKYHCAKSCNFCSHK-----------LCKNEDSDDVCDAVSQRGLCTAHAGFANR-CQRTCQICQVEDSKSLDE-CKDLDSLHICQEIVRRNQCNTD---RGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKS 1911
            C++++    C D  + G C  N  +M  NC  +C  C        K    CRN+  D  C+   +  +C  N   + I C  SCG C               V +      +++C++ +    C    ++G+C + K  MK +C K+C FC  K           LC ++ S+  C   ++   C  ++    + C++TC+ C+ +  K     C+++ +  IC+ +  + +C+TD      RC  +C +C++         + + +T   C +  S E C+ LK +G C+ Y    +LC ++
Sbjct:  264 CRNKNEDDWCTDQKKLGNCEYNSKYMSVNCRKTCDKCYKYKAIFDKGKKICRNFEKDKTCENWAKRGECQRNPGYMNIKCKKSCGIC---------------VEEMTTPMTQIDCRNKLEEEKCDRLMSNGKCFENKNYMKVNCQKTCGFCDSKTLIFTSTQSPELCFDKLSERTCKRWAKNNECEINSKLMQKMCRKTCKNCEPKKDKIQKPLCRNVYNDSICESM--KAKCHTDAPFMKLRCKKTCEMCSKGQ-------NSKFITSPPCKDIYSNEKCKSLKSKGHCERY---PILCLRN 539          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074521.1 (SMESG000074521.1)

HSP 1 Score: 196.438 bits (498), Expect = 6.002e-56
Identity = 112/291 (38.49%), Postives = 163/291 (56.01%), Query Frame = 1
Query:   34 IFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITD-NSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQNTGEQLLTL-SKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFEIESNHYKL-FNTPFDFQSIMLYSPYAF-SKNGFPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNC-SNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRY 891
             F+  H   G  R KRA+   +   W   +IPY  D N+F++ +  +LQ AI ++  ETC+ F + +     NW+KI  G+NC+S +GM    EQ + L S  CR YG+ +HELGH IGL HE +R  R+ +++ ++EN+Q E    F+  +    L F+ PFD QSIM Y P +F ++ G P    +N S    + ++ EKDLSF D K +N  Y+C   C  N  CS+G Y+D+ C C TPE F +RRC  D N+   C+   +   C       S  CRKTC +CF++
Sbjct:   17 FFIVFHD--GTTRSKRAVVVKSADQWPDGVIPYYIDRNAFNEEEVSSLQDAINTWNFETCVHF-RLKRESDRNWVKITGGQNCYSIVGMDYFAEQEVNLASPGCRHYGLYLHELGHAIGLDHEHLRSIRDDYLKIVEENIQAENVDLFKKNNKSDTLDFDMPFDLQSIMHYGPLSFINEKGEPSIQVINESMIHLLLEVHEKDLSFLDAKVVNLYYKCADRCFQNVTCSAGGYIDQYCQCHTPESFESRRC-QDKNDESWCIEQQKKGHCELRNKYMSFNCRKTCEKCFKH 303          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000073667.1 (SMESG000073667.1)

HSP 1 Score: 135.576 bits (340), Expect = 9.838e-35
Identity = 94/273 (34.43%), Postives = 136/273 (49.82%), Query Frame = 1
Query:  100 NKLWTGNIIPY-ITDNSFSDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGM-QNTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQEEAKIGFE-IESNHYKLFNTPFDFQSIMLYSPYAFSK---NG--FPVWLKMNSSDRTPIFDISEKDLSFWDVKAINDLYQCGKNC-SNTQCSSGN-YVDKNCACQTPEMFSNRRCVDDTNNMK-NCLNASETNICYNEPISASVMCRKTCGRCF 885
            NK W    I Y I    F   +   L  A++ YQ ETCLKF   + +   + +       C + +G  +  G Q + L   CR YG+ +HELGHTIGL HE   PDR+  +    +NV    K+ F  I  +   +F  P+D QS+M Y  +AF+K   NG      +  N   +  ++ +  KDLSF DVK IN +Y+C  +C  N  CS  + ++ K+C C+T + F+NRRC D  N+ +   L A        E       CRKTC +C+
Sbjct:   46 NKRWENATIVYQIVLTDFRKDEIDGLLNAMDIYQKETCLKFRPAKFSDQYSVIIRRGSGGCNAILGQDRKKGTQTVNLGIGCRWYGLFLHELGHTIGLHHEHQHPDRDIGVSVQWDNVDPSMKVWFNTISRDDVSMFGVPYDMQSVMHYGQWAFAKTDANGKSLTTIIAKNPEFQRYLYYVWMKDLSFGDVKRINLMYKCNDHCPKNIPCSERDGFITKDCKCETKQNFANRRCYDVFNSSECQRLKADCDKTGTYEQYYVFTNCRKTCRKCY 318          
BLAST of Metalloendopeptidase vs. Planmine SMEST
Match: SMESG000074522.1 (SMESG000074522.1)

HSP 1 Score: 133.65 bits (335), Expect = 1.380e-31
Identity = 148/554 (26.71%), Postives = 230/554 (41.52%), Query Frame = 1
Query:  799 CLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVD-IDVDQCQRKKDDGFCYVD-TWTKVYCKKSCNTCGNHSDTSTI------------EFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKC--NGTTLKI-CLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCS-----HKLCKNEDSDDVCDAVSQRGLCTAHAGFA-NRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQ---RCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVL-CRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESW-RQNYCSVS--HIADLCKKTCNIC 2370
            CL+ ++ N C   P     MC+K+C  C         +  P KC +  D   C      G C  +  + +  CKKSC  CG     +T             E LC++++    CE++  KG+C+ NP FM   CA SC  C    T    ++ C+N   D+ C+ +    +C  N + +++ C  +C  C               +     +N+ ++     S C  ++  G+CQK    M  +CAKSCN C       K C N   +D C+  S  G C+ +  F    C ++C  C+       + C +++    C +  +  +C+ +       C  SCN C                    CVN   +  CE   +RG CQ      ++ C KSC  C   +        C+N  +D  CN W+S G C +N +YM  NCAK+CK C S+            C N      C  W + G C  +  +M +NC +SC  C  S T         C N  SD+ CE+W ++  C+ +  ++   C K+CN C
Sbjct:   37 CLSWADANECTKNPNFMHKMCKKSCKLCI--------TKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKE--TKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVNCAKTCFNCN------------ASIVDKPCVNSYMD-----SECDKWSKLGECQKNPNYMLLNCAKSCNNCDLIPSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQNDSN-CVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYC-----------KFNKDLQKNCVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSDRE-------CVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSE----------RECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSCKSSNTDKGT-----CSNINSDKECENWSKRGECAKNPKYMLINCAKSCNSC 529          

HSP 2 Score: 122.094 bits (305), Expect = 5.955e-28
Identity = 146/570 (25.61%), Postives = 232/570 (40.70%), Query Frame = 1
Query:  664 LYQCGKNCSNTQCSSGNYVDKNCACQTPEMFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVD-QCQRKKDDGFCYVD-TWTKVYCKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGT---TLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCSHK-----LCKN-EDSDDVCDAVSQRGLCTAHAGFA-NRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQC-NTDRGQR--CLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVL---CRKSCNLCALPKASTSTPII---CLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESWR 2310
            L  C K+C+N + S  N  D NC               + N    C   S+   C   P    V C K+C  C    D          CV+   D +C+     G C  +  +  V C KSC +C +  +       C + HN   C  W+  G+C  NP +M  NCA SC +C +          C N   D+ C       +C       L  C  SC  C           +  +      IN+  EC++       ++  G+C K  + M  +CAKSCN C         C N   ++D C   S++G C+ +  F    C ++C +C+  +      C++LD    C+   +  +C N ++  +  C  SC  CN             + T V+C +   E++C+  K+ G C  + N   +   C ++C  C + K     P++   C N++ +E CN+W + G C +N  YM  NCAKACK C   D           C +  +   C+ W A+G C      M++ C ++CG C++      +     C+N  +D +C  W+
Sbjct:  297 LENCAKSCNNCKTSQQN--DSNCV--------------NINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYCKFNKDLQKN------CVNTHKDSECESWSKRGECQKNPKYMLVNCAKSCKSCDSDRE-------CVNTHNDAECNKWSSMGECQKNPKYMLVNCAKSCKSCDSER-------ECLNTHNDAECSKWSSMGECTKNPKYMLVNCAKSCNSC---------KSSNTDKGTCSNINSDKECEN-------WSKRGECAKNPKYMLINCAKSCNSCESATQLPTACTNIHKNEDECRKWSEKGECSKNPNFMLENCAKSCNVCKFNNE--TKGCRNLDPNSDCESWKQAGECLNNEKYMKVQCGKSCGRCN-------------AKTYVDCKDIYQEDSCKAWKDLGEC--FKNPVFMLSKCSQTCGSCDMEK----NPVVVETCKNIDSNENCNTWQTAGECEKNPNYMLVNCAKACKTCQKDDA----KNVEKKCDDVYSDVSCLKWKAEGLCEKQSLVMKVKCSKTCGTCDQLKNNQTM-----CQNAYNDAICTKWK 784          

HSP 3 Score: 118.242 bits (295), Expect = 8.500e-27
Identity = 145/542 (26.75%), Postives = 224/542 (41.33%), Query Frame = 1
Query:  826 CYNEPISASVMCRKTCGRCFRYGDYGNGSPPPYKCVDIDVDQ-CQRKKDDGFCYVDT-WTKVYCKKSCNTCGNHSDTSTIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKI---CLGSCGKCGKNYERNEPNKTEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNFCS-HKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQS---YLNRAVLCRKSCNLCALPKA-STSTPI----ICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIK----------TTVECKNTESDELCESW-RQNYCSV--SHIADLCKKTCNIC 2370
            C   P    + C+++CG+C +        P    C+++D D+ C++   +  C  ++ +    C KSCN C + S   T   +C +  N   CE W++ G C  N  +M   CA SC  C+  +T   P+  C N   DS C+ +    +C   ++ +   C  SCG C    E+   NKT   + K  A             C  +   G C  Y + M  HC KSC  CS +  CKN  ++ VCD  +  G C  ++ F        Q+C     KS   C DL +L +       N+ N+D                                C N+  + +CE  K+ G C+    ++N    C KSC  C    A STS P+    +C N   ++ C+ W   G C  N ++M+ NCA++C  C +   ++        C+N  T E C+     G C  +   M   C  +C  CN SF V P++          +  +C N   D  C  W RQ  C +  S++   C+K+C  C
Sbjct:  789 CTKNPNFMLIQCKESCGKCEKL-------PKNTNCINLDNDKNCEKWAGENECTKNSKYMLERCFKSCNNCSSSSSAKTPSEVCSNLANDTDCESWSKAGHCEKNVSYMLKFCAKSCKACNRLITTSLPSINCVNKLNDSTCETLKILGQCEKNSIFMIEKCGKSCGSCRPAKEKTSENKTCLNLYKDDA-------------CDLWKKAGYCHIYPKFMLSHCLKSCGQCSEYSECKNLYNNIVCDKWAAEGECLKNSKF------MIQLCL----KSCGRCYDLKNLKV-------NRTNSDG-------------------------------CENKYGDWSCEAWKQVGECERNPIFMNDQ--CSKSCGTCFKSTATSTSGPLRMSSVCKNFYSNKLCDEWTKNGDCKSNSDFMRINCARSCNSCQNLKFSLK-----VKCQNILTKEKCLKLKKAGECEKNSKQMAELCAYTCHKCNLSF-VKPMEINQNPTKMRSSKFKCDNRAGDFQCSYWARQKQCELNASYMRLFCQKSCGAC 1254          

HSP 4 Score: 97.0561 bits (240), Expect = 2.949e-20
Identity = 108/417 (25.90%), Postives = 174/417 (41.73%), Query Frame = 1
Query: 1144 MKANCALSCGTCSTNMTAKKPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNKTEQEVAKSHAI---NNRVECKDLVSN--CQYFANDGQCQKYKETMKYHCAKSCNFC--------------------SHKLCKNEDSDDVCDAVSQRGLCTAHAGFAN-RCQRTCQICQVEDSKSLDECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMESVTMVECVNEDSEETCEHLKERGLCQSYLNRAVL-CRKSCNLCALPKASTSTPIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPSTANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTPIKTTVECKNTESDELCESWRQ 2313
            M+ NCA +CG C T+           +   D  C  ++ EN C      +      +C KN     PN   +   KS  +       +C +   N  C  ++  G+C+  ++ M+ +C KSC FC                    +  LC+N+  D  C+    +G CT +  F   +C ++C  C+     +   CK+++  + C+++  R +C  +     +N          A T      S+    CVN   +  C+   + G CQ   N  +L C KSCN C L     S    C N+  ++ C  W++ G C +N ++M ENCAK+C  C +          +++C N   +  C  W   G C  + ++M +NC +SC YC   F     K  V   NT  D  CESW +
Sbjct:    1 MELNCAKACGKCGTDSDGF------LDPDKDDDCKDVYEENSC------LSWADANECTKN-----PNFMHKMCKKSCKLCITKEPEKCTNQYDNLSCYVWSQTGECESNRKYMEKNCKKSCKFCGGSKMQTTTTPSLSVITMPSNETLCQNKYGDKYCEEFKSKGECTKNPDFMFIQCAKSCSKCKETKPGNDSLCKNIEKDNNCEQLKIRGECLRNVSYMRVN---------CAKTCFNCNASIVDKPCVNSYMDSECDKWSKLGECQKNPNYMLLNCAKSCNNCDLI---PSDGKDCFNIYRNDKCEKWSNAGECSKNPKFMLENCAKSCNNCKTSQQN------DSNCVNINKNSECDKWSQMGECSKNPNYMLVNCAKSCNYC--KFNKDLQKNCV---NTHKDSECESWSK 377          
The following BLAST results are available for this feature:
BLAST of Metalloendopeptidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TLL27.847e-2829.26tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844][more]
TLL15.124e-2730.41tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL14.053e-2630.41tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
TLL14.588e-2630.41tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843][more]
BMP16.352e-2327.75bone morphogenetic protein 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nas-73.419e-2833.33Zinc metalloproteinase nas-7 [Source:UniProtKB/Sw... [more]
nas-41.686e-2733.85Zinc metalloproteinase nas-4 [Source:UniProtKB/Sw... [more]
nas-41.686e-2733.85Zinc metalloproteinase nas-4 [Source:UniProtKB/Sw... [more]
nas-42.565e-2733.85Zinc metalloproteinase nas-4 [Source:UniProtKB/Sw... [more]
nas-63.424e-2634.30Zinc metalloproteinase nas-6 [Source:UniProtKB/Sw... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tld2.396e-2732.17gene:FBgn0003719 transcript:FBtr0084691[more]
tok1.657e-2631.98gene:FBgn0004885 transcript:FBtr0084690[more]
tok1.657e-2631.98gene:FBgn0004885 transcript:FBtr0339252[more]
tok1.657e-2631.98gene:FBgn0004885 transcript:FBtr0084689[more]
CG57154.460e-2429.53gene:FBgn0039180 transcript:FBtr0084634[more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll11.467e-2730.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.467e-2730.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll11.467e-2730.73tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
hce2l15.169e-2533.16high choriolytic enzyme 2-like 1 [Source:ZFIN;Acc:... [more]
hce2l16.020e-2533.51high choriolytic enzyme 2-like 1 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc591.877e-2629.54leucine rich repeat containing 59 [Source:Xenbase;... [more]
ENSXETT00000007920.12.110e-2629.82tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007703.12.547e-2629.82tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007882.12.695e-2629.82tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
ENSXETT00000007740.12.719e-2629.82tolloid like 2 [Source:NCBI gene;Acc:105947755][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tll26.139e-2729.36tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Tll12.321e-2630.88tolloid-like [Source:MGI Symbol;Acc:MGI:106923][more]
Tll21.236e-2431.90tolloid-like 2 [Source:MGI Symbol;Acc:MGI:1346044][more]
Bmp18.435e-2328.23bone morphogenetic protein 1 [Source:MGI Symbol;Ac... [more]
Mep1b2.183e-1828.50meprin 1 beta [Source:MGI Symbol;Acc:MGI:96964][more]
back to top
BLAST of Metalloendopeptidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6L7|TLL2_HUMAN3.768e-2729.26Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=... [more]
sp|P55113|NAS7_CAEEL4.350e-2733.33Zinc metalloproteinase nas-7 OS=Caenorhabditis ele... [more]
sp|P98068|SPAN_STRPU5.006e-2731.02Protein SpAN OS=Strongylocentrotus purpuratus OX=7... [more]
sp|O57460|TLL1_DANRE1.108e-2630.73Dorsal-ventral patterning tolloid-like protein 1 O... [more]
sp|P25723|TLD_DROME2.402e-2632.17Dorsal-ventral patterning protein tolloid OS=Droso... [more]
back to top
BLAST of Metalloendopeptidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CRQ33.312e-11632.24Metalloendopeptidase OS=Schistosoma japonicum OX=6... [more]
A0A075A6984.070e-11436.21Metalloendopeptidase OS=Opisthorchis viverrini OX=... [more]
A0A3Q0KFI64.227e-11432.37Metalloendopeptidase OS=Schistosoma mansoni OX=618... [more]
A0A504Z4938.717e-11233.19Metalloendopeptidase OS=Fasciola gigantica OX=4683... [more]
A0A4E0RPD34.152e-11133.90Metalloendopeptidase OS=Fasciola hepatica OX=6192 ... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll16.722e-2829.52tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll12.406e-2729.86tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll13.222e-2729.82tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll13.236e-2729.82tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
tll13.315e-2729.82tolloid-like 1 [Source:NCBI gene;Acc:474335][more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007253.11.990e-2730.59pep scaffold:Pmarinus_7.0:GL476910:54360:144194:-1... [more]
ENSPMAT00000004913.18.738e-1638.64pep scaffold:Pmarinus_7.0:GL478359:22377:26907:1 g... [more]
ENSPMAT00000001798.11.305e-1026.40pep scaffold:Pmarinus_7.0:GL485204:1983:11197:1 ge... [more]
ENSPMAT00000007988.16.619e-723.47pep scaffold:Pmarinus_7.0:GL476685:1987009:1991341... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metalloendopeptidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO472611.153e-3725.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424217.288e-3034.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499695.463e-2934.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478511.643e-2634.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396271.976e-2634.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metalloendopeptidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tll12.048e-2729.41tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
tll13.171e-2729.41tolloid like 1 [Source:NCBI gene;Acc:101160961][more]
bmp1a1.486e-2630.94bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
bmp1b3.248e-2429.33bone morphogenetic protein 1 [Source:NCBI gene;Acc... [more]
mc6ast52.224e-2330.88astacin like metallo-protease [Source:NCBI gene;Ac... [more]
back to top
BLAST of Metalloendopeptidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013804.10.000e+099.62SMESG000013804.1[more]
SMESG000074510.11.869e-6530.91SMESG000074510.1[more]
SMESG000074521.16.002e-5638.49SMESG000074521.1[more]
SMESG000073667.19.838e-3534.43SMESG000073667.1[more]
SMESG000074522.11.380e-3126.71SMESG000074522.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033494 ID=SMED30033494|Name=Metalloendopeptidase|organism=Schmidtea mediterranea sexual|type=transcript|length=2513bp
ATGATATTAGAGACTTTTAGAGTTTATTGTTTAATATTTTTAACAATACA
TTCAAGTTATGGGATACCTCGAGTGAAAAGAGCTTTAGGAGCCTACAATA
ATAAACTATGGACTGGGAATATTATTCCTTACATTACTGATAACAGCTTT
TCAGATTCCGATAAATTAAATTTGCAAAAGGCTATAGAATCCTATCAAGC
AGAAACGTGTTTAAAGTTCGTCAAATATCAACCAAATATACATGCAAATT
GGCTTAAAATTGAAAAAGGAGAAAATTGTTTTTCACAAATTGGAATGCAA
AACACGGGAGAACAGCTACTTACTCTTTCAAAGGCGTGCCGTCAATATGG
AGTTGTGGTTCATGAATTGGGTCACACTATAGGATTACTGCATGAAATGA
TGCGACCGGATAGAAATCAGCATATTCGGTATATAGATGAAAACGTACAG
GAAGAAGCCAAAATAGGATTTGAAATAGAATCAAACCATTATAAATTGTT
TAATACTCCTTTTGATTTTCAATCTATAATGCTGTATTCTCCTTATGCTT
TCTCAAAAAATGGTTTTCCTGTGTGGCTAAAAATGAATTCTTCCGACCGA
ACTCCGATATTTGATATCAGTGAAAAAGATCTTAGTTTTTGGGATGTTAA
AGCTATAAACGATTTATATCAATGCGGAAAAAATTGCTCAAATACTCAAT
GCTCTTCTGGTAATTACGTGGATAAGAATTGCGCTTGCCAAACACCGGAA
ATGTTCTCTAATCGCAGATGCGTAGATGATACAAATAATATGAAAAACTG
TCTAAACGCATCTGAAACAAATATATGCTACAATGAACCTATTTCTGCAA
GTGTAATGTGTCGGAAAACATGTGGACGTTGTTTTCGTTATGGAGATTAT
GGAAATGGATCTCCTCCACCATACAAATGTGTTGACATTGATGTGGATCA
GTGTCAAAGGAAAAAAGACGACGGTTTCTGCTATGTAGACACATGGACAA
AGGTTTATTGTAAAAAAAGTTGTAATACCTGCGGAAATCATTCAGATACA
AGCACAATTGAATTTTTATGTAAAGACAGGCATAATTCTCATTTATGCGA
AGATTGGGCAGAAAAAGGTCAATGTTCTATCAATCCTGGATTCATGAAAG
CTAACTGTGCCCTTTCCTGCGGGACGTGTTCAACAAACATGACAGCAAAA
AAACCAAATGCCCCTTGCCGAAATTATTCACCTGATTCCTACTGTGATGC
AATGTTCAGAGAAAATAAATGCAATGGAACTACTTTGAAGATTTGCTTGG
GATCTTGTGGAAAATGTGGAAAAAACTATGAAAGAAATGAGCCAAACAAA
ACGGAACAAGAAGTTGCAAAAAGTCATGCAATAAATAACCGAGTCGAATG
CAAAGACCTGGTATCTAATTGCCAATATTTTGCCAATGATGGTCAATGTC
AGAAATATAAGGAAACCATGAAATATCATTGTGCAAAATCCTGCAACTTC
TGTTCACATAAATTGTGCAAAAATGAAGATTCTGATGATGTTTGTGATGC
AGTCAGTCAGCGAGGTCTTTGCACAGCCCATGCCGGATTTGCTAATAGAT
GCCAAAGAACTTGTCAGATTTGTCAAGTAGAAGACAGCAAGTCTTTAGAT
GAATGCAAAGATCTCGATTCTCTACACATTTGCCAGGAAATAGTTCGCCG
AAATCAGTGCAATACTGATAGAGGTCAACGATGCCTAAATTCGTGTAATT
TATGTAATCAACCAATGATTGCAGCAACAACCTTACCAAGCATGGAGTCA
GTCACAATGGTTGAATGCGTCAATGAAGACAGTGAAGAAACTTGTGAACA
TTTAAAGGAAAGGGGTCTATGCCAATCATATCTTAATAGAGCAGTTTTAT
GCCGGAAAAGTTGTAATTTGTGTGCATTACCGAAAGCATCAACATCAACT
CCGATAATTTGCCTCAATGTCGAAGATGATGAAACTTGCAATTCATGGGC
GTCCACTGGTTACTGTTTTGAAAACAAAGAATATATGAAAGAAAACTGTG
CTAAAGCTTGCAAATTTTGTTTTAGCAAGGATACAACAATCTCACCATCT
ACTGCTAATACCCACTGTAGAAACAAACAAACTTCTGAAGTATGCATTTC
ATGGGTCGCTCAAGGATACTGTGGGGATCATGAGGACCACATGAGGATAA
ATTGTTTAGAAAGCTGTGGATATTGCAATAAATCCTTCACGGTAACACCA
ATTAAGACTACTGTCGAATGCAAGAACACAGAAAGTGATGAGCTATGTGA
ATCTTGGAGGCAAAACTATTGCTCAGTGAGCCATATCGCTGATTTATGTA
AGAAGACGTGCAATATTTGTTAATAAGACGAAAAACTTGAAAATTAACTA
TAAAACTGTTTGGTTAATTAATAATAATTATTATTGTGCTAACGATATTA
TTTATGTATTTTCAAAAGTTGAGAGCATCAACGCAAATCACTATCCAGAC
TATATGATAATTC
back to top

protein sequence of SMED30033494-orf-1

>SMED30033494-orf-1 ID=SMED30033494-orf-1|Name=SMED30033494-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=791bp
MILETFRVYCLIFLTIHSSYGIPRVKRALGAYNNKLWTGNIIPYITDNSF
SDSDKLNLQKAIESYQAETCLKFVKYQPNIHANWLKIEKGENCFSQIGMQ
NTGEQLLTLSKACRQYGVVVHELGHTIGLLHEMMRPDRNQHIRYIDENVQ
EEAKIGFEIESNHYKLFNTPFDFQSIMLYSPYAFSKNGFPVWLKMNSSDR
TPIFDISEKDLSFWDVKAINDLYQCGKNCSNTQCSSGNYVDKNCACQTPE
MFSNRRCVDDTNNMKNCLNASETNICYNEPISASVMCRKTCGRCFRYGDY
GNGSPPPYKCVDIDVDQCQRKKDDGFCYVDTWTKVYCKKSCNTCGNHSDT
STIEFLCKDRHNSHLCEDWAEKGQCSINPGFMKANCALSCGTCSTNMTAK
KPNAPCRNYSPDSYCDAMFRENKCNGTTLKICLGSCGKCGKNYERNEPNK
TEQEVAKSHAINNRVECKDLVSNCQYFANDGQCQKYKETMKYHCAKSCNF
CSHKLCKNEDSDDVCDAVSQRGLCTAHAGFANRCQRTCQICQVEDSKSLD
ECKDLDSLHICQEIVRRNQCNTDRGQRCLNSCNLCNQPMIAATTLPSMES
VTMVECVNEDSEETCEHLKERGLCQSYLNRAVLCRKSCNLCALPKASTST
PIICLNVEDDETCNSWASTGYCFENKEYMKENCAKACKFCFSKDTTISPS
TANTHCRNKQTSEVCISWVAQGYCGDHEDHMRINCLESCGYCNKSFTVTP
IKTTVECKNTESDELCESWRQNYCSVSHIADLCKKTCNIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR034035Astacin-like_dom
IPR011528NERD
IPR001506Peptidase_M12A
IPR003582ShKT_dom
IPR006026Peptidase_Metallo
IPR024079MetalloPept_cat_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001506Peptidase M12APRINTSPR00480ASTACINcoord: 113..131
score: 48.16
coord: 132..149
score: 39.07
coord: 58..76
score: 27.46
coord: 170..185
score: 47.08
coord: 211..224
score: 40.6
IPR001506Peptidase M12APFAMPF01400Astacincoord: 36..226
e-value: 2.3E-46
score: 157.9
IPR003582ShKT domainSMARTSM00254ShkT_1coord: 309..345
e-value: 0.2
score: 20.7
coord: 405..440
e-value: 25.0
score: 5.7
coord: 505..542
e-value: 0.57
score: 19.2
coord: 356..394
e-value: 4.3E-10
score: 49.5
coord: 256..295
e-value: 9.0
score: 10.6
coord: 705..743
e-value: 0.18
score: 20.9
coord: 551..586
e-value: 10.0
score: 9.9
coord: 466..502
e-value: 1.0E-5
score: 35.0
coord: 605..642
e-value: 0.017
score: 24.3
coord: 756..790
e-value: 6.1
score: 12.5
coord: 653..691
e-value: 3.6E-6
score: 36.5
IPR003582ShKT domainPFAMPF01549ShKcoord: 606..641
e-value: 0.045
score: 14.3
coord: 661..690
e-value: 3.0E-6
score: 27.7
coord: 506..541
e-value: 1.8
score: 9.2
coord: 713..742
e-value: 0.0016
score: 18.9
coord: 466..501
e-value: 1.1E-5
score: 25.8
coord: 309..344
e-value: 0.33
score: 11.5
coord: 757..790
e-value: 0.52
score: 10.9
coord: 357..393
e-value: 1.6E-7
score: 31.7
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 706..742
score: 9.366
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 310..344
score: 7.366
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 552..585
score: 6.699
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 757..790
score: 8.571
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 606..641
score: 10.079
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 654..690
score: 11.313
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 406..439
score: 6.53
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 467..501
score: 10.682
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 506..541
score: 8.723
IPR003582ShKT domainPROSITEPS51670SHKTcoord: 357..393
score: 10.149
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 33..175
e-value: 2.2E-22
score: 90.4
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 15..228
e-value: 1.5E-56
score: 193.5
NoneNo IPR availablePANTHERPTHR10127DISCOIDIN, CUB, EGF, LAMININ , AND ZINC METALLOPROTEASE DOMAIN CONTAININGcoord: 23..399
NoneNo IPR availablePROSITEPS51864ASTACINcoord: 27..226
score: 54.098
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.477
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 32..226
IPR034035Astacin-like metallopeptidase domainCDDcd04280ZnMc_astacin_likecoord: 39..223
e-value: 2.19057E-50
score: 172.756