Si:dkey-29d8.3

Overview
NameSi:dkey-29d8.3
Smed IDSMED30033492
Length (bp)1062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:dkey-29d8.3 (SMED30033492) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:dkey-29d8.3 (SMED30033492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:dkey-29d8.3 (SMED30033492) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:dkey-29d8.3 (SMED30033492) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30033492SMESG000003214.1 SmedASXL_005875SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30033492SMESG000003214.1 SmedASXL_005875SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30033492SMESG000003214.1 dd_Smed_v4_1161_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033492SMESG000021248.1 SMESG000003214.1 dd_1161dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30033492SMESG000021248.1 SMESG000003214.1 dd_1161dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30033492SMESG000003214.1 dd_Smed_v6_1161_1dd_Smed_v6PMID:29674432
Plass et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30033492SMESG000003214.1 dd_Smed_v6_1161_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:dkey-29d8.3 vs. Ensembl Zebrafish
Match: si:ch211-161h7.5 (si:ch211-161h7.5 [Source:ZFIN;Acc:ZDB-GENE-091204-265])

HSP 1 Score: 99.7525 bits (247), Expect = 3.095e-23
Identity = 78/242 (32.23%), Postives = 133/242 (54.96%), Query Frame = 1
Query:   97 VVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            V++++C+  N L    G G +  T   +SN  +T +TP  W+F IW VIYTW +L+  ++L++    V G  +Y    V S+ F   +++N + NI WLL+++  +    ++ A +F  L    +  + IF      ++GS    Y    L  +  RI+V NG+  Y TWTT+A  + FT  L Y   M  + A+ +SLS+LL   + + I++ F ++++ RY+LT + V++ A SG + KN
Sbjct:   48 VLYIICIVFNVLAGP-GKGPFRNTTSAISNKYNTEVTPSGWTFSIWGVIYTWLSLMIAYILSTTCRSVNG-PMYCSPAVLSYPFFIVWIINMLLNIGWLLLWDREV----MIAALIFLALIAFTNYLLIIFTCRALKQHGSWLNKYHKVDLWCI--RIMVQNGIAIYTTWTTIATLINFTIVLRYEAGMTDSDAATVSLSVLLGEAIAWFIVETFVFEKHLRYILTVYPVVIVALSGNMTKN 281          
BLAST of Si:dkey-29d8.3 vs. Ensembl Zebrafish
Match: si:dkey-29d8.3 (si:dkey-29d8.3 [Source:ZFIN;Acc:ZDB-GENE-070912-508])

HSP 1 Score: 83.9593 bits (206), Expect = 5.108e-18
Identity = 74/254 (29.13%), Postives = 132/254 (51.97%), Query Frame = 1
Query:   70 RKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFK-NGS--DEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            R  L V   + +++ L +N L    G G +  +  NVS+   T ITP  W+F IW VIY+W  L+N++ L+          LY    +    F  S+++N I N +WL++++       L+ AA+  +   + + Y+ I+ S+ G + +GS   +   KD + +     ++V NG+  YATWTT+A  + FT  L        N A+     +LL +I+ + + + F  +++ RY+L+ + V+V+A SG + K+
Sbjct:   11 RLSLIVLSQIAYIVALIINALAGP-GKGPFQHSTGNVSDRYQTEITPAGWTFSIWGVIYSWLFLMNIYFLSWLC-----RGLYSSPAILPSVFFVSWIINLILNCSWLVLWD-----RELMIAALIVLALIAFTNYLLIYFSWVGLRAHGSWLKQHHPKDLFCII----VLVQNGIATYATWTTIATLLNFTVVLNLASVSATNAATASLCILLLEVIIWFSVEN-FLIEKHVRYILSVYPVIVYALSGSLSKH 248          
BLAST of Si:dkey-29d8.3 vs. Ensembl Zebrafish
Match: si:dkey-29d8.3 (si:dkey-29d8.3 [Source:ZFIN;Acc:ZDB-GENE-070912-508])

HSP 1 Score: 78.9518 bits (193), Expect = 1.438e-16
Identity = 66/219 (30.14%), Postives = 117/219 (53.42%), Query Frame = 1
Query:  175 NVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFK-NGS--DEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            NVS+   T ITP  W+F IW VIY+W  L+N++ L+          LY    +    F  S+++N I N +WL++++       L+ AA+  +   + + Y+ I+ S+ G + +GS   +   KD + +     ++V NG+  YATWTT+A  + FT  L        N A+     +LL +I+ + + + F  +++ RY+L+ + V+V+A SG + K+
Sbjct:    9 NVSDRYQTEITPAGWTFSIWGVIYSWLFLMNIYFLSWLC-----RGLYSSPAILPSVFFVSWIINLILNCSWLVLWD-----RELMIAALIVLALIAFTNYLLIYFSWVGLRAHGSWLKQHHPKDLFCI----IVLVQNGIATYATWTTIATLLNFTVVLNLASVSATNAATASLCILLLEVIIWFSVEN-FLIEKHVRYILSVYPVIVYALSGSLSKH 212          
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Match: A0A5A9N6B2 (Uncharacterized protein OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti000937 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.598e-24
Identity = 88/257 (34.24%), Postives = 141/257 (54.86%), Query Frame = 1
Query:   70 RKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLH------MRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            R  L V   V F++C++ N L    G G +  T   VSN  DT ITP  W+F IW VIYTW +L+ +++L +     A   +Y    V  + F   +++N + NI+WL +++  +     + AAV F+   + + Y+ IF S    K   + G + + Y    H      +RI+V NG+  YATWTT+A  + FT  L Y   MN + A+ +SLSILL  ++ + I++ F ++++ RY+LT + V++ A SG + KN
Sbjct:    8 RMTLIVVSTVAFIVCVAFNALAGP-GSGPFKNTTSAVSNEYDTEITPSGWTFSIWGVIYTWLSLMIVYILTTTCRRTADGPMYCSPAVLPYGFFIIWILNMLINISWLFLWDSEV-----MIAAVIFLALIAFTNYLTIFLSCHALK---EYGAWLNKY----HKVDLWCIRILVQNGIATYATWTTIATLLNFTIVLNYNAGMNKSDAATLSLSILLGEVVAWFIVENFVFEKHLRYILTIYPVVIVALSGNLTKN 251          
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Match: A0A556TWI4 (Uncharacterized protein OS=Bagarius yarrelli OX=175774 GN=Baya_5335 PE=4 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 7.379e-24
Identity = 81/252 (32.14%), Postives = 148/252 (58.73%), Query Frame = 1
Query:   73 KILFVSIPV-VFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGF-KNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            +I+ +++ V VF++ ++ N L+   GF  +L++  N+S+  +T ITP  W+F IW VIY W T + ++++++     A   +Y    V ++ F   +++N + NI WLL+++  +     + AA+  +   +++ Y  IF S  G  K+G+    Y  + L S+  RI+V NGL  YATWT++A  +  T  ++Y   M+ + A+ +SLS+L   +LV+ +L+ F  D++ RY+LT + V++ A SG + KN
Sbjct:    8 RIVIIAVSVLVFIIGITFNVLSAR-GFDPFLMSTGNISDKYNTQITPSGWTFSIWGVIYFWLTAMLIYIVSTIFRRNAFGPMYCSRPVLTYNFFICWILNILFNIIWLLLWDREV-----MIAALILLALVALTNYAMIFFSCLGLQKHGAWLNKYHKSDLWSV--RILVQNGLAVYATWTSIATLINLTIVVSYSGGMSNSDAATLSLSLLSAEVLVWFVLENFFLDKHVRYILTVYPVVIVALSGNITKN 251          
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Match: A0A315V4N3 (CENP-C_C domain-containing protein OS=Gambusia affinis OX=33528 GN=CCH79_00004166 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.768e-22
Identity = 81/268 (30.22%), Postives = 136/268 (50.75%), Query Frame = 1
Query:   28 LYYS*TKMTAQLWTRKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYK--DNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYG-ILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            LY   T M    + R    +    V+ + L  N L+  +G G Y  T  NVS   DT +TP  W+F IW+VIY W + + +++++          +Y    V  + F  S+ +N   NI+WLL+++  +    ++PA +F IL    +  +  F  +     G     Y   D +L+    R++V NG+  Y TWTT+A  +  T  L Y  + N++TA   +LS  L+ +++ G +++ F  D++ RYV  P+ V++WA SG + KN
Sbjct:  291 LYKDQTTMGKHNYGRLAAIIISVAVYAVSLVFNGLSV-VGVGPYTTTTSNVSAVYDTELTPSGWTFNIWTVIYIWLSAMIVYIVSGLCRRNGYGYIYCSPAVLPYGFFISWCLNQGFNISWLLVWDRGL----MIPALIFLILLICTNYSMVGFICHGLHVYGPWLNKYSKVDLWLI----RMLVLNGVMIYTTWTTIATLLNLTIVLKY--EANMSTADSATLSYSLLSVVLLGFVVENFVLDKHLRYVFIPYIVVIWALSGNMDKN 547          

HSP 2 Score: 108.612 bits (270), Expect = 5.128e-22
Identity = 70/245 (28.57%), Postives = 133/245 (54.29%), Query Frame = 1
Query:   97 VVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYL---LSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            ++F++ +  + L    G   +L    N+S      +TP  W+F IW++IY +  L+ +++L+      A   +Y    V  + F   + +N + N++WL +++        +PAA+ F++  +++ Y  IF S  G    S  G + + Y    L LH R+++ NG+  YATWTT+A  V  T  L Y  K++   A+ +SLS+L V++  + +L+ F  D++ R++L+ + V++WA +G+  +N
Sbjct:   17 IIFIITMVFSALAAA-GSSPFLYDTSNISAQFVIQLTPSGWTFTIWTIIYLFLALVMVYVLSGIFRKNAYGYVYCSPPVLPYGFFAFWCLNLVLNVSWLFLWDRM-----FMPAALAFLILITLTNYGVIFFSCYGL---SQYGAWLNKYHKVDLWLH-RVLIQNGVAIYATWTTIASLVNLTIVLEYDAKVSSTEAATVSLSLLTVVVAAWFLLENFVLDKHIRFILSIYPVVIWALTGVFTEN 251          
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Match: A0A5C6NU03 (Uncharacterized protein OS=Takifugu flavidus OX=433684 GN=D4764_17G0004370 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 9.784e-22
Identity = 80/224 (35.71%), Postives = 120/224 (53.57%), Query Frame = 1
Query:  151 GKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            G Y  T  NVS   DT +TP  W+F IWSVIY W T + +++L+      A   +Y    V  + F  S+ VN   NI WLL+++  +    ++PA VF IL    +  +  F  +     G+    Y+   L  L  R++V NG+  Y TWTT+A  +  T  L Y  KM+   A+ IS S+L V+++V+ +L+    D+Y RYVL  + V++WA SG + KN
Sbjct:   16 GPYTTTTANVSAVFDTQLTPSGWTFNIWSVIYIWLTAMIIYILSGLCRKNADGYVYCSPAVLPYGFFISWCVNLCFNIGWLLVWDRGM----MIPALVFLILVICTNYSMMFFICHGLHIYGAWLHKYQKAELWLL--RVLVQNGVMIYTTWTTIATLINLTIVLTYDVKMSPTDAATISYSVLAVVLIVWFLLEQLVLDRYVRYVLIIYPVVIWALSGNMVKN 233          
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Match: R7TLA2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226481 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 9.994e-22
Identity = 84/239 (35.15%), Postives = 124/239 (51.88%), Query Frame = 1
Query:  133 TTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFY---KDNYLLSL--HMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLG 834
            TT+IG G +L    ++S+   + ITP   +F IW +IY WQ L   + L++         LY    V        Y  N   NIAWL +++ ++ S + L AA+  I  T  SLYI +     G    + E ++   + N L+     +R +V N    YATWTT+A  +   A + Y+  +++ T S+  L IL   IL + +LDLF  D+YTRY+ TPHFVLVWAF+G   +N   G
Sbjct:   25 TTQIG-GLFLNNTGDISDIWYSNITPSGATFSIWGIIYAWQVLFIGYALSTICRKGVDDNLYISPGVLPPALFYVYAFNNCLNIAWLFLWDRTVLSTDYLIAALVVISLTPFSLYICV-----GITCYTVEKYHVILEQNSLMREIWLIRFLVQNAFAIYATWTTIATILNLGAVMTYVGGVDMETTSLTQLGILSAEILAWFLLDLFALDRYTRYLFTPHFVLVWAFTGSFMENYAKG 257          
BLAST of Si:dkey-29d8.3 vs. Ensembl Nematostella
Match: EDO34277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT3])

HSP 1 Score: 86.6557 bits (213), Expect = 2.504e-19
Identity = 79/264 (29.92%), Postives = 140/264 (53.03%), Query Frame = 1
Query:   67 TRKILFVSIPVVFVLCLSVNYLTTEIGFGKYL-------ITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEY-SFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLG 834
            TR +L V + + F++ L++N L        +L       +T  ++S+  ++ I P SW+F IW VIYTWQ L+        +I V  +   ++   V +  FLG Y+++   N  W++I+      L+L  AA   + A    LY  +F SY      ++  F K ++     ++++VHNG+  YATW TVA  +  T+++ Y+  +   TA  I+LSIL   I+V+ I++ F  +++ RY ++ + VL+ A + I++ + K G
Sbjct:    8 TRGVLTVVLILAFLVMLAINVLVPPSMRPAFLDPLYGNNLTTSDISDIYESDINPASWAFSIWGVIYTWQVLM--------IIYVTSLICRKHVPNVLNCTFLGLYILSCFFNGTWIVIWQ----RLHL-SAASGVLFAICFILYATLFVSYYRLNKFANSKFPKFDFWC---IQVLVHNGIAFYATWCTVASLLNMTSAVTYVHGVARATAGTIALSILAAEIIVWFIVENFVLERFLRYTISQYPVLILALTAILYSHWKPG 255          
BLAST of Si:dkey-29d8.3 vs. Ensembl Nematostella
Match: EDO40526 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S714])

HSP 1 Score: 86.2705 bits (212), Expect = 3.042e-19
Identity = 79/267 (29.59%), Postives = 136/267 (50.94%), Query Frame = 1
Query:   70 RKILFVSIPVVFVLCLSVNYLTT--------EIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIV---WKNNKLGG 837
            R +L + + + F++ +++N   T        E  +G  L T  +VS+   T ITP  W+F IW VIYTWQ L+ +++ +    ++    + +   V    FLG YL++   N  W++I     +    L AA   + A S +LY  +F SY          F K ++     ++ +VHNG+  YATW TVA  +  T ++ Y+  +   TA  I+LSIL V I+ + +++ F  +++ RY ++ + VL+ A S I+   WK + +  
Sbjct:   11 RTVLTIILILAFIIMIALNGFATPNVRPAFLEPLYGNNLST-GDVSDIYSTDITPAGWAFSIWGVIYTWQVLMIIYVTS----LICRKHVPD---VLDCTFLGLYLLSCFLNATWIVI-----WQRMHLSAASVILFAISFTLYATLFVSYYRLNKIGKREFPKFDFWC---VQALVHNGIAFYATWCTVASLLNMTIAVTYVHGVARATAGTIALSILAVEIIAWFVIENFVLERFLRYTISQYIVLIVALSAILYSHWKPDNVNA 261          
BLAST of Si:dkey-29d8.3 vs. Ensembl Nematostella
Match: EDO34278 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPT4])

HSP 1 Score: 83.5741 bits (205), Expect = 2.030e-18
Identity = 76/264 (28.79%), Postives = 135/264 (51.14%), Query Frame = 1
Query:   67 TRKILFVSIPVVFVLCLSVNYLTTEIGFGKYL-------ITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEY-SFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLG 834
            TR +L V + + F++ L++N L        +L       +T   +S+  ++ I P SW+F IW VIYTWQ L+        +I V  +   ++   V +  FLG Y+++   N  W++I     +    L AA   + A   +LY  +F S+      +   F K ++     ++++VHNG+  YATW TVA  +  T ++ Y+  +   TA  I+LSIL   I+V+  ++ F  +++ RY ++ + VL+ A + I++ + K G
Sbjct:    8 TRGVLTVVLILAFLVMLAINVLFPPSMRPAFLDPLFGNNLTTSEMSDIYESDIDPASWAFSIWGVIYTWQVLM--------IIYVTSLICRKHVPNVLNCSFLGLYILSCFFNGTWIII-----WQRKYLSAAPGVLFAICFALYATLFMSFYRLNKFAKSNFRKFDFWC---IQVLVHNGIAFYATWCTVASLLNMTTAITYVHGVAKTTAGTIALSILAAEIIVWFFVENFILERFLRYTISQYPVLILALTAILYSHWKPG 255          
BLAST of Si:dkey-29d8.3 vs. Ensembl Nematostella
Match: EDO40525 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S713])

HSP 1 Score: 58.151 bits (139), Expect = 1.371e-9
Identity = 65/221 (29.41%), Postives = 112/221 (50.68%), Query Frame = 1
Query:  166 TIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGM-RLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDE-GFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKN 822
            ++  +S    T +TP   +F IW VIYTWQ L   +++ SF ++   +  ++++ F F F+ L S +V      +WL++ +     L  L   + F      SLY A+  +Y      ++E   Y      + H  I+V NG+  Y TW T+A  +    +L Y   ++  TA  I LSIL V +LV+ +++ F  ++Y R+  T + V++   SGI+ +N
Sbjct:   48 SVGGMSRRFSTDVTPAPPTFQIWIVIYTWQCL---WIVYSFSLICRKVPEVFDWLF-FVFFTLSSCIVT-----SWLVVQS---RGLKQLSCGILFF--HGFSLYAALATAYYRVVPRNEELAAYSKLDFFATH--ILVFNGIVTYTTWVTLASLLSLNGALIYAHGVSKVTAGTIILSILAVELLVWFVIENFVLERYLRFTFTVYPVVITGLSGIIARN 252          
BLAST of Si:dkey-29d8.3 vs. Planmine SMEST
Match: SMESG000003214.1 (SMESG000003214.1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 1
Query:   49 MTAQLWTRKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTAXXXXXXXXXXXXXXYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLGGXXXXXXXXXXXXXXXXXXXXXXXTIVRYRKTDEEGYMEVPDIRR 969
            MTAQLWTRKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTASIISLSILLVLILVYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLGGAVAILSLIILIMAIFMLIAKLAITIVRYRKTDEEGYMEVPDIRR
Sbjct:    1 MTAQLWTRKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDTPITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWFLGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASYQGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLAYLDKMNINTASIISLSILLVLILVYGILDLFKWDQYTRYVLTPHFVLVWAFSGIVWKNNKLGGAVAILSLIILIMAIFMLIAKLAITIVRYRKTDEEGYMEVPDIRR 307          
The following BLAST results are available for this feature:
BLAST of Si:dkey-29d8.3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-161h7.53.095e-2332.23si:ch211-161h7.5 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
si:dkey-29d8.35.108e-1829.13si:dkey-29d8.3 [Source:ZFIN;Acc:ZDB-GENE-070912-50... [more]
si:dkey-29d8.31.438e-1630.14si:dkey-29d8.3 [Source:ZFIN;Acc:ZDB-GENE-070912-50... [more]
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5A9N6B22.598e-2434.24Uncharacterized protein OS=Triplophysa tibetana OX... [more]
A0A556TWI47.379e-2432.14Uncharacterized protein OS=Bagarius yarrelli OX=17... [more]
A0A315V4N31.768e-2230.22CENP-C_C domain-containing protein OS=Gambusia aff... [more]
A0A5C6NU039.784e-2235.71Uncharacterized protein OS=Takifugu flavidus OX=43... [more]
R7TLA29.994e-2235.15Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO342772.504e-1929.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405263.042e-1929.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342782.030e-1828.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405251.371e-929.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:dkey-29d8.3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-29d8.3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000003214.10.000e+0100.00SMESG000003214.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033492 ID=SMED30033492|Name=Si:dkey-29d8.3|organism=Schmidtea mediterranea sexual|type=transcript|length=1062bp
TTAAATTCGGTGAGTGATCTTTGTAATCTGTATTATTCGTGAACAAAAAT
GACGGCCCAGCTATGGACTCGTAAAATATTATTTGTTTCCATTCCGGTGG
TTTTTGTTTTATGTTTATCCGTAAACTACCTTACAACCGAAATTGGATTT
GGTAAATATCTAATAACGATTAGAAATGTGTCAAACTATCTCGATACCCC
AATAACTCCAGGGTCTTGGAGTTTTATTATCTGGTCGGTCATTTACACGT
GGCAAACGTTAATTAATTTATTTCTGCTGGCTTCATTTGTAATAATGGTA
GCAGGAATGAGGCTATATGAATACTCGTTTGTATTTTCATTCTGGTTTCT
TGGGAGCTATTTAGTCAATTTTATTTGTAACATAGCTTGGTTGTTGATAT
TTAATTTTTCTATATATTCATTAAATTTATTACCGGCAGCAGTATTTTTT
ATACTAGCAACTTCAATTTCTCTATATATTGCGATATTTGCTTCATATCA
AGGATTCAAGAATGGATCAGATGAAGGATTTTATAAGGATAATTATCTCT
TATCCTTACACATGCGAATTATAGTTCACAATGGATTGAATGCCTACGCT
ACCTGGACTACAGTAGCCCAATTTGTGATGTTTACAGCGAGTTTAGCATA
TTTGGATAAAATGAATATTAATACAGCTAGCATAATCAGCCTGTCTATAT
TATTGGTTCTAATTCTTGTTTATGGCATTCTGGATTTATTCAAATGGGAT
CAATATACACGATATGTATTGACACCTCACTTCGTACTTGTATGGGCATT
CAGTGGAATTGTGTGGAAAAACAACAAACTCGGAGGAGCTGTCGCAATAT
TGTCGCTTATAATATTGATTATGGCAATTTTTATGTTGATTGCCAAACTA
GCTATAACGATTGTTCGATATCGCAAAACCGATGAAGAAGGTTACATGGA
AGTTCCTGATATCCGAAGAATACTTTAAAATAATGCCAGCGTAGTGTTAA
TTCTGAACTAGTTAAATTCTATTTTAATAAATAAAATAAATTTTTAAAAC
AATTAAAAAAAA
back to top

protein sequence of SMED30033492-orf-1

>SMED30033492-orf-1 ID=SMED30033492-orf-1|Name=SMED30033492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MTAQLWTRKILFVSIPVVFVLCLSVNYLTTEIGFGKYLITIRNVSNYLDT
PITPGSWSFIIWSVIYTWQTLINLFLLASFVIMVAGMRLYEYSFVFSFWF
LGSYLVNFICNIAWLLIFNFSIYSLNLLPAAVFFILATSISLYIAIFASY
QGFKNGSDEGFYKDNYLLSLHMRIIVHNGLNAYATWTTVAQFVMFTASLA
YLDKMNINTASIISLSILLVLILVYGILDLFKWDQYTRYVLTPHFVLVWA
FSGIVWKNNKLGGAVAILSLIILIMAIFMLIAKLAITIVRYRKTDEEGYM
EVPDIRRIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR33802FAMILY NOT NAMEDcoord: 13..293
NoneNo IPR availableTMHMMTMhelixcoord: 264..286
NoneNo IPR availableTMHMMTMhelixcoord: 235..254
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 94..116
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
NoneNo IPR availableTMHMMTMhelixcoord: 131..153