Protocadherin

Overview
NameProtocadherin
Smed IDSMED30033491
Length (bp)3098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin (SMED30033491) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin (SMED30033491) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin (SMED30033491) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin (SMED30033491) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033491

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033491SMESG000035568.1 SmedASXL_015389SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033491SMESG000035568.1 dd_Smed_v6_16610_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033491SMESG000035568.1 SMESG000032293.1 OX_Smed_1.0.03936ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 255.373 bits (651), Expect = 3.583e-70
Identity = 226/792 (28.54%), Postives = 360/792 (45.45%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +      + S F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 156.377 bits (394), Expect = 4.564e-38
Identity = 177/670 (26.42%), Postives = 290/670 (43.28%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I        F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  DRE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +    F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEI-----RYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDADAGENKAVTL--------------SILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.109 bits (331), Expect = 1.429e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P  IF    ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP--IFNQPVIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 256.144 bits (653), Expect = 7.547e-70
Identity = 227/799 (28.41%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 156.762 bits (395), Expect = 4.850e-38
Identity = 178/670 (26.57%), Postives = 292/670 (43.58%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  DRE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +    F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDADAGENKAVTL--------------SILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.88 bits (333), Expect = 1.104e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 255.758 bits (652), Expect = 9.516e-70
Identity = 227/799 (28.41%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 155.992 bits (393), Expect = 6.505e-38
Identity = 178/670 (26.57%), Postives = 292/670 (43.58%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  DRE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +    F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDADAGENKAVTL--------------SILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.88 bits (333), Expect = 1.176e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 255.758 bits (652), Expect = 1.048e-69
Identity = 227/799 (28.41%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 155.992 bits (393), Expect = 8.207e-38
Identity = 178/670 (26.57%), Postives = 292/670 (43.58%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  DRE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +    F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDADAGENKAVTL--------------SILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.109 bits (331), Expect = 1.666e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 251.521 bits (641), Expect = 1.163e-68
Identity = 221/792 (27.90%), Postives = 367/792 (46.34%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            F V+L  + F    Q   Y   I+EE P+   +G++   +  +   +K+      F+L  K+    L+++ + +G +  T  RID + LC  I         H    C  E+ V +   +  +++   FL+EDINDN P F      + I EN       +LP+A D D G      Y L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +   + TDAD G N +I +S +N     ++ L    +  G + + E +DRE    +++ + ASD G+    +   + + + DVNDN P   I    N +N   V  EN  ++T I  I V DKD   N ++TC  +       +      +F N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  +++  I ENN     + +V A D D   N +++Y +      +  +FS+D  TG++      DRE +D Y F +  +D+G P L+++ TV V+I+D+NDN P+ FT N     + EN  P +  + L T  D D G N  V++ IL EN D+   ++ G I      DRE    +   + A+D G   +SSS  V I V D+NDN P FI P  N    +    T    ++ ++ AVD D G N  + +     ++  N        ++  F+++++ G ITL+            +++ A DLG P
Sbjct:   10 FAVLLACVVFHSGAQEKNYT--IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPR-----DEH----CFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIET--PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS---IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHE-----IPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS--IPENNSPGIQLTKVSAMDADSGPNAKINYLLGPD---APPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPV-FTHNEYNFYVPENL-PRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYS----IVGGN--------TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 181.8 bits (460), Expect = 4.785e-46
Identity = 185/676 (27.37%), Postives = 309/676 (45.71%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS-AFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            V D+ DN P FE   +  +I E+  P+    L   A D D G+  ++EY L  GN   L   + KS          + +    DRE+++     +IA D      E+  M+++ ++D ND+ P F  +S  +    I EN  I   I     TD D G NG++ YS+ +        + +     G + + E ID +      + I A D   P   S++ + I ++D+ND+ P  I   + I    ++EEN  I   +G +  ID+D G N  I          KY  +E  E F I +    I+T   +DRE   +  + +   D G   L +S TI + + D NDN P  D      N  ISE   + S I  +KA D D  ++ ++ Y I E+D    S   I  +  ++       R  QD +K  V I    +  L     V V I D N     +F  +P  + I E++   Y +I L  +D D G N ++   + +++ +F +   +G IS+   +DRE  + F + + A DH   P ++S  + + + DINDNSP F     +    +S D  VG   + +++A+D D G NG++ +  +E    S+  P     S + F +++ +G + + + L        ++ I+A+D G P LS+  +I +++
Sbjct:  260 VLDVQDNSPIFEKDSYFGEIRED-APIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGV--------IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVT---ILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMI----TLEENVAIGEEVGRVYAIDEDSGPNGII----------KY-SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK--EYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR--QD-HKVRVEISATDQGGLQGRCVVNVFIDDVNS--APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT--SSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNE----SSSSP-----SIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 882          

HSP 2 Score: 140.969 bits (354), Expect = 1.789e-33
Identity = 174/634 (27.44%), Postives = 282/634 (44.48%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHEN-RLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLF-VSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDT-LSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD--YFSLAENG------KISLKRPIDRETHS-EFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFF 2345
            V DIND+ P       ++ + EN  +  ++G +  A D+D G    ++Y + G++D          F ++E    + +    DRE+   Y   + A+D+          I V + D ND+ P F     K     I E    G++II     D DE  + +I Y +   DR    IL   +  +G++  VS  + R+  +   + ISA+D G       + + I+  DVN + P F     ++     + E+S I   + T++  D D+G N++I   I+    S++ +++     +   I     +DRE      +++   D    PL +S  I + + D NDN P     + S    ISE+    +   QV A D DI  NG + YF+NES +  S+  F +D  +G ++     DRE   +    +F RD G PSLS ++ +T+T+ D NDN P F   +   L I EN+     +  +  +D DEG N  +S  +    D   F + E+       +I  +   D E  + +F  ++ A    L   SS++ V I V D+NDN P     D  + MN  FD     + I  I A DPD  QN  +     E  L  N + E+ K + K  
Sbjct:  469 VIDINDHAPTLIAAQKMITLEENVAIGEEVGRV-YAIDEDSGPNGIIKYSMEGSED----------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILD--IGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSV----KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDP----SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLS-YDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL---SSTVPVRIHVSDVNDNKPA--LKDFVILMN-RFDNVQMARQIGFIPAFDPD--QNATL-----EYFLEENDLIEAEKYTGKIL 1053          

HSP 3 Score: 95.1301 bits (235), Expect = 2.198e-19
Identity = 111/431 (25.75%), Postives = 189/431 (43.85%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEK-IEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSY-INQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIV 1757
             ++D+N + P F D    ++I E+  P+    +   A D D G  +++ Y +  ++           F ++    ++      DRE    +   + A D          ++ ++  D ND+ P+F  +S       I E+  +GT  +  +  DAD G NG + Y LN E  +   I  F + +  G+L VS  +DRE      + I A D G P+  ++ +I + + DVNDN P F    + +     + ENS + + +GTI   D D+G N+ I+  I   + +K   +E+  E   + +I TR   D E             SG   L S+V + I V D NDN P +      +N     +N++ +  I  + A D D   N  L YF+ E+D +   ++     TG +  K  + R +   +K  V
Sbjct:  672 FIDDVN-SAPYFNDHPFSVKIPEHS-PIGYPVITLKAEDHDRGDNARIVYSIDSSQ----------FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAAT---ISEDIPVGTSFLQVSAIDADIGPNGIVDYFLN-ESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF----EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALKDFVILMN---RFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKY-----TGKILVKQEWKRNMDVSFKTCV 1070          
BLAST of Protocadherin vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 161.77 bits (408), Expect = 7.026e-40
Identity = 155/567 (27.34%), Postives = 263/567 (46.38%), Query Frame = 3
Query:  801 MIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            M+++ ++D ND+ P F  +S  +    I EN  I   I     TD D G NG++ YS+ +        + +     G + + E ID +      + I A D   P   S++ + I ++D+ND+ P  I   + I    ++EEN  I   +G +  ID+D G N  I          KY  +E  E F I +    I+T   +DRE   +  + +   D G   L +S TI + + D NDN P  D      N  ISE   + S I  +KA D D  ++ ++ Y I E+D    S   I  +  ++       R  QD +K  V I    +  L     V V I D N     +F  +P  + I E++   Y +I L  +D D G N ++   + +++ +F +   +G IS+   +DRE  + F + + A DH   P ++S  + + + DINDNSP F     +    +S D  VG   + +++A+D D G NG++ +  +E    S+  P     S + F +++ +G + + + L        ++ I+A+D G P LS+  +I +++
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVT---ILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDY---STGEVTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMI----TLEENVAIGEEVGRVYAIDEDSGPNGII----------KY-SMEGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKK--EYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKR--QD-HKVRVEISATDQGGLQGRCVVNVFIDDVNS--APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFT--SSSYAATISEDIPVGTSFL-QVSAIDADIGPNGIVDYFLNE----SSSSP-----SIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTL 523          

HSP 2 Score: 140.198 bits (352), Expect = 3.422e-33
Identity = 174/634 (27.44%), Postives = 282/634 (44.48%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHEN-RLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLF-VSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDT-LSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD--YFSLAENG------KISLKRPIDRETHS-EFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFF 2345
            V DIND+ P       ++ + EN  +  ++G +  A D+D G    ++Y + G++D          F ++E    + +    DRE+   Y   + A+D+          I V + D ND+ P F     K     I E    G++II     D DE  + +I Y +   DR    IL   +  +G++  VS  + R+  +   + ISA+D G       + + I+  DVN + P F     ++     + E+S I   + T++  D D+G N++I   I+    S++ +++     +   I     +DRE      +++   D    PL +S  I + + D NDN P     + S    ISE+    +   QV A D DI  NG + YF+NES +  S+  F +D  +G ++     DRE   +    +F RD G PSLS ++ +T+T+ D NDN P F   +   L I EN+     +  +  +D DEG N  +S  +    D   F + E+       +I  +   D E  + +F  ++ A    L   SS++ V I V D+NDN P     D  + MN  FD     + I  I A DPD  QN  +     E  L  N + E+ K + K  
Sbjct:  110 VIDINDHAPTLIAAQKMITLEENVAIGEEVGRV-YAIDEDSGPNGIIKYSMEGSED----------FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF---DKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILD--IGDQGAILSVSGELKRQDHKV-RVEISATDQGGLQGRCVVNVFID--DVN-SAPYFNDHPFSV----KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---SQFFRIDP----SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSP--QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLS-YDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL---SSTVPVRIHVSDVNDNKPA--LKDFVILMN-RFDNVQMARQIGFIPAFDPD--QNATL-----EYFLEENDLIEAEKYTGKIL 694          

HSP 3 Score: 104.375 bits (259), Expect = 3.178e-22
Identity = 133/535 (24.86%), Postives = 238/535 (44.49%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGS---LPSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIE-IFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSE-TGVVK--SKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF--FTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFK 2057
            +++DINDN P F+ K + + I E    M  GS      A D D  Q  K+ YR+   +++   +  I     +     EL       +   ++    + A D    + + ++ V  +D+ +S P F+ +   +   +I E+  IG  +I     D D G N  IVYS+++      +I P      G + VS ++DRE R  + + ++ASD+  P   +S +I + + D+NDN P F   +       ++ E+  + T+   +  ID D G N  +   + E+S S  ++L +++      ++ ++L  DRE+   +++ +   D G   L ++  IT+ + D NDN P  +    S +  I+EN+   S +  + A D D  DN  + + I       +     D+E  GVV+  ++  FD E +    F       G+  LS++  V + + D NDN P    F    + +   +N      +  +   D D+  N  +   L+EN    +    GKI +K+   R     FK
Sbjct:  211 VLKDINDNAPTFDKKEYNVTISEE---MPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGEL-------KRQDHKVRVEISATDQGGLQGRCVVNV-FIDDVNSAPYFNDHPFSV---KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFF--RIDP----SSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKL--DREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQL--SYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPALKDFV---ILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEENDLIEAEKYTGKILVKQEWKRNMDVSFK 708          

HSP 4 Score: 94.3597 bits (233), Expect = 3.958e-19
Identity = 111/431 (25.75%), Postives = 189/431 (43.85%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEK-IEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSY-INQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIV 1757
             ++D+N + P F D    ++I E+  P+    +   A D D G  +++ Y +  ++           F ++    ++      DRE    +   + A D          ++ ++  D ND+ P+F  +S       I E+  +GT  +  +  DAD G NG + Y LN E  +   I  F + +  G+L VS  +DRE      + I A D G P+  ++ +I + + DVNDN P F    + +     + ENS + + +GTI   D D+G N+ I+  I   + +K   +E+  E   + +I TR   D E             SG   L S+V + I V D NDN P +      +N     +N++ +  I  + A D D   N  L YF+ E+D +   ++     TG +  K  + R +   +K  V
Sbjct:  313 FIDDVN-SAPYFNDHPFSVKIPEHS-PIGYPVITLKAEDHDRGDNARIVYSIDSSQ----------FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAAT---ISEDIPVGTSFLQVSAIDADIGPNGIVDYFLN-ESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF----EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG--QLSSTVPVRIHVSDVNDNKPALKDFVILMN---RFDNVQMARQIGFIPAFDPD--QNATLEYFLEENDLIEAEKY-----TGKILVKQEWKRNMDVSFKTCV 711          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 145.976 bits (367), Expect = 6.132e-35
Identity = 169/682 (24.78%), Postives = 290/682 (42.52%), Query Frame = 3
Query:  492 DINDNVPQFEDKFHVLQIHENRLPMKIGSL---PSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF------ILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSI 2507
            D     PQFE     ++I E+     IG+      A +   G + ++ Y L    + L + ++     + +         +FD E    Y   +IA + +   +  +I +R+ D ND+ P F+ N   +    + E  +    +++ + +D D G  GE+ Y + +E  + S I P      G +F  + +    R  + + +SA D G  +  +S  IHI ++D +   P F      I  T++IL   ++     +     +I   D+D  F+      I+E++   Y+              TR       D  LL +     SG     +   + I + D NDN P   ++   ++  I E+         V+A+D D + NG + Y I  S     S   ID  TG + +  + D E    YK  V   D G P  S++ T+ + +LD NDN P F   +   + ++EN+ P   +  +  +D+D   NG++   +   ++YF + E  G +  KR IDRE  S   + I+A+D G+ P+SS+ +  I V D+NDN P+ +    ++   V    +     I  I A+DPD G NG +L+      L S+            F V K NG++ L   L     R   + +   D G P  S    + + I +  + I
Sbjct:  532 DTESKPPQFEKALWQVEIPED---TPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQK---------TFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLT---VREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFS-INPV----TGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSIYSGDQDHNFS------IDEDTGKIYV--------------TRYLDADVHDTVLLNIQATLPSGES---NQTQVVIFIEDHNDNPPQFSSSLVEIS--IREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSH--PGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEF-EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL----SITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQ---LQSS-----------LFVV-KSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADI 1143          

HSP 2 Score: 123.25 bits (308), Expect = 6.078e-28
Identity = 181/773 (23.42%), Postives = 325/773 (42.04%), Query Frame = 3
Query:  264 FELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYR-LHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKI---MIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKP--DFILQTQNILNHYSVEENSEIDTNIGTIEVID-----KDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQT----RLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYIN----QVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIV--ETKSSIYS 2513
            F +F     ++ LK+++ SG + T   +D +      K   ++             IV V   ++ + ++ L  V+D NDN P F D+   L+I E        +LP+  D D  +     +  L GN +   +F + S     + + +L  +   DRE  ++Y   + A+D     AKI      + I+D ND+ P F   S       +  N  IG+ +I    TDAD G N  I Y +       +    F +S+ G +  + ++       +++ + ASD+G P+  SS  + I +L    + P  D I   ++  N   + ENS + + +  + +       K +   S   C  + +    YL L    +  I   +T     L    EKDGQ+++          P +      + + D NDN P          W  S+ +I  +        + A D D+  NG + Y + +++ +     SID ETG +      D  +    KF V   D G P+LST   V   +LD     P F  A  L+ + I E+T     L+ +   +   G + ++   LQ   ++ ++   +G + +++  D E    ++  +IA +      +S I+  I +KD+NDN P F +P++   + V       + L+  ++A D D G  G + +H              +      FS+N   GE+    + +PL R +  +++ AKD G     ++  I I+++  +TK+  +S
Sbjct:   57 FVVFPDEQTSKFLKVDERSGEISTIAHLDYE------KRSKFD-------------IVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNN--VFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQD-GGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNS--NFAISQSGVITTTASLLPA--STHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVES--NSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLL----LCGILDRETASEHHLKFLLEKDGQIIIE--------HPQL------LTIGDINDNAP---------QWHSSQIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLDTELV-----SIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKA--LWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLIS--IRLKDVNDNWPIF-YPNE-YHLTVREGPKPEEPLLV-VSASDMDSGTFGEVSYH--------------ILSESSSFSINPVTGEVF---AQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFS 742          

HSP 3 Score: 93.2041 bits (230), Expect = 7.984e-19
Identity = 146/660 (22.12%), Postives = 288/660 (43.64%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLP--MKIGS-LPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHIS--FDRESVNEYMFYLIAKDVD-DNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENC-RIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVND-NKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDL----YKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLII 2423
            V ++NDNVP F            R+P  +++GS + +   KD    + L Y L  +       S ++  H N  ++    H++   D E + E+   + A D   D    + I V   D ND+ P F   S  + +  +       G         D D    G + YSL     +  ++ P    + G+LF+   +     E Y +T++A+DNG+P+  +S+ + + I +    +KP F    +     + V ENS+I   IG +   ++ + F+ +    I++   SK   ++K       ++     IDRE+       ++  +  +          + V+D+NDN+P+  +    L+  + ++      I Q+ A+D D  +NGR+ Y I   + L++   +++ +TG ++     D +L +     ++ +V  RDHG P+ +    V V++   + +    F   P+Y + ++E+T+    L  +   +R    N  +   L+E+     +  + G+++LK  +D E+     + +   D   R  S+ + + I V+ +++ +P F      LQ+ +S   T   + + ++ A+D D G +GV+ +              S+ D +    + +  G I L    +PL  R+ L I
Sbjct: 1917 VNNLNDNVPSFP------MSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDS------SGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVS--DINDNAPTF---SKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAP----ESGALFM--KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGF----EKAEFRFEVMENSKIGLQIGNLSG-EESREFHYR----IQDPEASKIFSIDKFG-----RLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLS--LKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNI--VTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGR--SAVVPLKIVVEPVDEFAPVFTKSSYTLQIPIS---TPAGESVGQMQAIDEDGGVHGVVKY--------------SISDRQSTVKIEEHTGIIRL---QKPLVSRRNLTI 2511          

HSP 4 Score: 91.2781 bits (225), Expect = 3.040e-18
Identity = 79/302 (26.16%), Postives = 134/302 (44.37%), Query Frame = 3
Query:  402 HNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKI 1298
            H+T   +I+  +    S   +++ F   +ED NDN PQF      + I E+    +   +  A DKD  +  ++ Y +  +          S   +++   +L +    D E+   Y   + A D  +    + + + + +LD ND+ P+F          ++ EN    T +      D D   NG+IVY + N          F + +K G+++   +IDRE+    +I+I A D G+P + S+    I +LDVNDN P  +  T  +     V   S + T IGTI  +D DKG N  +
Sbjct:  802 HDTVLLNIQATLPSGESNQTQVVIF---IEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHP-------GSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFE---KSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEY------FGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV-----VPAGSPLSTAIGTIVAMDPDKGLNGSV 1079          

HSP 5 Score: 80.1073 bits (196), Expect = 8.545e-15
Identity = 115/510 (22.55%), Postives = 209/510 (40.98%), Query Frame = 3
Query: 1011 FYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKD----------KGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSY---INQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILD-ENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLIN----SLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            F +  +G +  +  +DREI E Y + +  + +G   Q    ++ + + ++NDN P F +          V EN  + + + T+   D D             + +   H   + F+  + L     F +    T             + +K  D   D   +   +TI V D NDN P          ++ + +   FS      +++A D+D +  G L Y + +    S S F +  E+G +  K++      + Y   V   D+G PS STS  V+V I + E  + P F  A      ++EN+     + +L+ ++  E       +   E +  FS+ + G++ +  PIDRE  +  + ++   +  +  Q       + V D NDN P F      L +  S  +  G+K I +I A D D G+NG + +     +L  N +           ++N D G I L       L         I++ A+D G+P  ++  K+++S+
Sbjct: 1874 FSVDSEGVIRTNLELDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFPMSKPR-----RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHT-------------LTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPL----YQTTVSPATFSPGQPFAKIEAHDLDAR--GALTYSLGQG---SSSIFRVAPESGALFMKVL--PPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAE-FRFEVMENSKIGLQIGNLSGEESREF---HYRIQDPEASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAH--GQK-IGQIMASDQDSGENGRVSYR----ILSGNDL--------NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSL 2329          

HSP 6 Score: 79.337 bits (194), Expect = 1.571e-14
Identity = 119/517 (23.02%), Postives = 216/517 (41.78%), Query Frame = 3
Query:  606 GQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSL-FVSENIDREIREF-----YEITISASDNGIPTQMSSIKIHIEI-LDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYF-INESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENT--NPPYALIHLTCKDRDEGINGKVSMIL-QENTDYFSLA-ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVI 2120
            G T +  +R  GN  +   FSI S            S +  DRE+  E++  +I  D         ++V + D+ND+ P+   +++   + +I E+ R+G  +  F  +D D G NG+  + L  +               GSL  V E  D  +R       ++I +   D+G+P       +++E  L++++  P    + +  L        S ID  +   + I K +   + +T  I E +      ++   +     I+T L +DRE   +  + +    SG         + + V + NDN+P       S    + EN    SY+  V A D+D  +   L YF +++S   + + F+ID  TG +      D E+   +   +   D    S  T   +T+ + D NDN P F  + PLY T +     +P      +   D D    G ++  L Q ++  F +A E+G + +K  +       + + + A D+G+   S+S+ V +
Sbjct: 1657 GMTEESRFRFQGNAPK---FSINST-------TGSISVLPLDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQL--DASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLED-------------SSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVP------GLYVEKNLEISNRNPQ--TEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELAGLTYSIVEGNIDSAFSVDSEGV-----IRTNLELDREILERYSLKVIGTGSG---QQIGTRVDVRVNNLNDNVPSFPM---SKPRRVPENLRVGSYVATVGAKDVD--NLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG---SFDTFTNLTIFVSDINDNAPTF--SKPLYQTTVSPATFSPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALFMK--VLPPAGERYLVTVTATDNGVPSFSTSVPVSV 2118          
BLAST of Protocadherin vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 129.798 bits (325), Expect = 6.569e-30
Identity = 180/693 (25.97%), Postives = 302/693 (43.58%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHI-SFDRESVNEYMFYLIAKDVDDNEAKIM------IKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSEN---IDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK---IQTRLAIDREKDGQLLMVLKCCDSGLD----PLMSSVT-ITIDVVDKNDNIPIVDTNT--GSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIV--FDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYA--LIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLK--DSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEIS 2483
            ++D+N++ PQF++  + L+I EN  P K     +A D D G   K+++ L  N+++  + SI       + K  +   + S DRE  + + F +IA D    E   M      + + + D ND+ PK  V  ++ +   I E+   G  +      D D G N ++ + LN+E       +PF +    G +F+      +D     F+ ++I  +D+G P   +S  +H+E++D+  N     ++  ++    SV ENSEI T +  IE   K+ G   K+     EN   + +  +    F+I +   ++T   +DRE      + ++  DS  D    P    V  + I ++D+ND+ P+        S+  E S  N+    +    A D+D      L + I   D  S   F ID  +G + +  +   DRE Q  ++  V I D G+P L ++  V V +LDENDN P F  A   Y     +    +A  L  +   D DEG N +++  + E    FS+  NG I     I  +    + L + A DHG   Q  +   V+   +     P      KN    +S     GKK    I   D D  Q G+ +   +      +++  S+   D    F V +D G++ L   ++ L R +  + I   D G     STV I++S
Sbjct:  710 IKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISI-------DAKTGIVKLLKSLDREDQDVHTFAIIASD----EGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRAR---IPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEK------VPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNH--LAIEFDDVAKEASVYENSEIGTEVIMIEA--KETGDEQKVKA---ENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVA-ENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSF--FRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHY-----SVRSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDNNGNIIASEAIHGD--ESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPR---KSKNSPPEIS-----GKKSDYVIPISDAD--QVGLTVGKLEASDADGDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTD-GQAWDHSTVIIQVS 1354          

HSP 2 Score: 110.923 bits (276), Expect = 3.216e-24
Identity = 127/486 (26.13%), Postives = 212/486 (43.62%), Query Frame = 3
Query:  447 YSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIG-----SLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIM-----IKVRILD--------ENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDR-TKSKILP-FYMSKKGSLFVSENIDREIREFYEITISASDNGI-----PTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIE---VIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYIN---QVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTV 1811
            +   + + N    VED+NDN P+      V+Q    R+P  +      S  +AFD+D GQ SKL++ L+  K   R+        ++  +Y L  H         +  F+ ++ +V D+   I+     + V ++D        E D V K         +  +YEN  IGTE+I+    +A E  + + V + N E R       P F + +KG++  +  +DRE +  Y IT+ A D+       P +   + + I ILD ND++P      +  +   SV ENS  +  I  +E     D D    + +   IE      + +++    +       RL  DREK  +  + +  CD G   L S+V + ++V+D+NDN P       +    I   +++  +     ++ A D D  +N RL Y I E D    ++FSID+   ++ S+ +   E    Y   V   DHG P    +AT  V
Sbjct:  803 FPMRVSVTNLTISVEDVNDNPPKC-----VVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYH---------KTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAK---------EASVYENSEIGTEVIMI---EAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP----VAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRL--DREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSP-------TFTQAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNITEGD----ARFSIDNNGNIIASEAIHGDE---SYALTVQATDHGTPGQQFAATRVV 1242          

HSP 3 Score: 105.916 bits (263), Expect = 1.290e-22
Identity = 163/682 (23.90%), Postives = 282/682 (41.35%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVN--GEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIP--IVDTNTGSLNWEISENNIKFSYINQVKATDID--------IQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKF-FSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            + D+NDN P F   +    I E+       ++ SA D+D   + ++ + L               F LNE    L      DRE ++ Y     A D       +   + + D NDS P+F     + ++F I  +    + I+ F++ D D   N   +      NE+        F++     L +      E +  Y++ ++A D    T   S K+ I +    D+        + ++    + ENS+     GT+ V+ +       +T  + +N  + ++    +   N I K++    ID EK+ QL           +     +T+ I+  + NDN P  I      S++  +  +     YI ++ A D D        + D G L              F ID   GVV      D E+   +   V   D         AT+ VT++D+NDN P F  +    + ++E+ +  Y L H      D+    +  +   + T + +L A+ G ++L +P+D ET S  KL ++AKD G+ P  +   V I V D NDN+P   F  +     V  +   G+K++T + A+D D    G + +   EL + S    E+  D+    F++N  NG++ +  S+     +K  + + AKD G PPL S   +EI +
Sbjct: 2702 IGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSL---------VEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQF-----EKEEFNIDLHLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGV------FWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFET---STKVKINLKSSKDSDIRCPEANKTVI----LAENSKK----GTV-VLGESSLLGPNVTFKLSDNDGNVFV----VNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVVIE--NLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGL--------------FQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKST-YSMKVMESESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPK--FEKEKYVGKVKENSKSGEKVLT-VKALDVDSEHFGAVSY---ELEIVS----ETTTDTPVLPFAINS-NGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHV 3316          

HSP 4 Score: 98.9821 bits (245), Expect = 1.511e-20
Identity = 135/519 (26.01%), Postives = 230/519 (44.32%), Query Frame = 3
Query:  750 YMFYLIAK--DVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNE-----DRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIP-TQMSSIKIHIEILDVN---DNKPDFILQTQN----ILNHY----SVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA-IDREKDGQLLMVLK--CCDSGLDPLMSSV-TITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSMILQENTDYFSLAENGKI----SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLI 2222
            Y F +IA    +++  A+  + + ILD ND  P F     +     I    + G  ++  + TD DEG NG+IVY   +E     +    +I    + KKG+              +  T+ A D G+P ++MS++ +             KP  I +++N    + + +     V E++ I T +  ++  D+D G+N  I   I + + S +  L   E      + + L+ + +EK   L + LK    D+G  P+ SSV T+ + + D N++ P  D  +  L   ISEN      I +V A D D  +NG++ + +  +   S S  SID++TG+VK     DRE QD++ F +   D G P   +   +T+++ D NDN P     +      I    P  A +  +   D D G N K+  +L      F +  +       + + P+D      F L I   DHG    S+S ++ +E+ DI  N     F D   + +V  +  +G ++I
Sbjct:  458 YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVI---GKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGN-------------SWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGT-PVKSSVKTMKLRIKDVNNHSPQFDEVSYYL--RISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKS-SVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQH--SRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVI 954          

HSP 5 Score: 97.0561 bits (240), Expect = 5.465e-20
Identity = 123/472 (26.06%), Postives = 210/472 (44.49%), Query Frame = 3
Query: 1071 EFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIE----IFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDP-LMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS----MILQENTDY----FSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRR--KCLIIIYAKDL 2441
            EF+ +TI   DN   +++    I + I ++NDN+P  I +   +           ID N+ T E           IT  + E++    +K   ++    +F I  I   + + +  D ++L          D       TI + V+D+NDN P  + +T S+    SE+ I +  +   +A+  D   N  + Y++  SD  S    +++++TG++      D E     K  V  +D G P L T A V ++++DENDN P F         + EN+     ++ +   D D    G VS    ++ +  TD     F++  NG + + + ID E   ++ LK+IAKD G  P  S   + I V+D ND++PT  F D N+   V     +G +L+ K +  D D  +NG                 E   D  K F VN+   ++ L+ + +  +R+  K L+ + AKD+
Sbjct: 2980 EFHRLTIQ--DN---SEVCKELITVVIENLNDNRPKIIEKLLKV----------SIDENLPTSE------DARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESES-IGYE-LAHFRASGGD--QNETIEYYLKPSDVTSF--VNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF-EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPT--FDDCNMTALVQEGEAIGHRLL-KFSVSDLDGPKNGAPF------------TVEIQGDGAKSFKVNE---KLELLTAKKLEYRKKDKYLLTVIAKDV 3405          

HSP 6 Score: 91.6633 bits (226), Expect = 2.762e-18
Identity = 115/451 (25.50%), Postives = 196/451 (43.46%), Query Frame = 3
Query:  477 LFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFG-QTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKF--QIYENCRIGTEIILFNVTDADEGVNGEIVYSLN--NEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFN-SKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQD-NGRLHYFINES----------DTLSMSQFSIDSETGVVKSKIVFDREL-QDLYKFIVFIRD 1769
            L  V D NDN P FE   + +++ E+     IG   + F    G Q   +EY        L+   + S  +LN     L      D E+++     ++AKD  V   E +  +++ ++DEND+ PKF     + +K+  ++ EN + G +++     D D    G + Y L   +E  T + +LPF ++  G + +S++ID E  + Y + + A D G P   S   + I + D ND+ P F       L    V+E   I   +    V D D   N +  T  I+ +    +   EK+E+    K++      R+KD  LL V+     G     +   +TI +   + + P +      +N    +N +    I ++KA+D D +D NG L + + E           ++ S   F +D  TG + S    D  + Q L+ F V + D
Sbjct: 3100 LVTVIDQNDNAPTFEKSTYSMKVMESE---SIGYELAHFRASGGDQNETIEY-------YLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF-----EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTAL----VQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEY-----RKKDKYLLTVIAKDVKG---KTTDCPLTIFIRQTSRHAPTMKPMKIQIN--TLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWS----DHSITQGLHTFNVTVTD 3517          

HSP 7 Score: 89.7373 bits (221), Expect = 1.077e-17
Identity = 156/664 (23.49%), Postives = 277/664 (41.72%), Query Frame = 3
Query:  423 IELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVN-EYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGT-------IEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNI----FKIQTRLAIDREKDGQLLMVLKCCDSGLDP---LMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDR----ELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS--MILQENTDYFSLAENGKISLKR-PIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKIT----AVDPDFGQNGVILFHHDELVLHSNKMPESLK 2327
            I  +VQV  +       F   + D NDN P F        + E+     + +  +AFDKD G+   + Y +  GN++        S+F ++    E+      D E  + E +  + A D   N  K  + + I + N++ P+      K+ +  +Y++ R GT +++ N        +G + Y L            F+   +  G++ ++  + + ++    +  +A       Q    K+  +I+  N + P F  Q    +   ++ EN    +++ +       +  ID+D G N  +          + L  +  ++F++      I+T+++ D EK  +    ++  D G  P   LM S+ I + V+D+ND  P   +N+  ++  +   N     ++    T  D+   G L YFI +        FS+DS+TG V   +V D     ++  L+   VF+ D GK S S    ++ TI  EN  F   FT N  + ++IENT  P   I L+       I  K+    I+  +  +F     G IS     +DRE  +  +L + AK H   P  +   VV+ +++IND +P F        M   +D T+G   I  +      +D D G         D + + S  MPE  K
Sbjct: 1436 IRAVVQVQQANMKSFATFSVNINDENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEE--------SLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEA-PETAKFDRKVYQTTLYDSTRPGTPVLVLNALH-----HGTVSYKLEPN-------CTFFEVHTLSGAVHLATWLTK-LKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQ----VYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGY--------RMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSL-IVVTVIDENDEPPRFPSNSLDISMILPTAN----GVSVGGQTAQDMDSVGSLRYFIKDQSV----PFSVDSKTGDV---LVKDSNGISDMTKLFDLEVFVTD-GKQSASYVMKIS-TISTENSKFK--FTRNEYHTSLIENTTLPPGSIILSVAT----IGDKLDHFSIVNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIF--------MGTPYDITIGHSDIGTVVLEPKVIDNDEG---------DVVTISSENMPEYFK 2028          

HSP 8 Score: 87.4261 bits (215), Expect = 5.739e-17
Identity = 135/584 (23.12%), Postives = 257/584 (44.01%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFG-----QTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRES-VNEYMFYLIAKDVDDNE----AKIMIKVRILDENDSVPKF---HVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL----NNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDRE---KDG-QLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTF 2156
            F+ L+ED+ND +P+F       +I ++ +  +  ++ SA D D       ++ KL Y++    + L        F+++    EL      +++  VNE    ++   V D      AK+++++         P+F   H  +N +      EN  +    +L   T A +G    + +SL    ++   T  +  P  + +K G + VS  ++    + Y+I +   D       S++   + ++D+ND  P F+L         S+ E+++    +  +   D D+  N  I   + + S S++        F++   Q  + + ++   K G  L + +K  DS   P  ++ T+ +++  ++  +P   +N+  L + + E+    + I +V+  + +I D  R        ++ S   FS++  TG +  K   DRE ++ +K    IR      +    TVTV I D NDN P F   +    TI E+     ++   +  DRD+  +G++   L E   YF L EN G +++   +DRE    +KL   A D G    ++ +   I V D+ND+ P F
Sbjct: 2271 FIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETL--------FNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANAL------ENTIVNKSALL---TVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFSTLT--LSVIDINDKPPFFVLP----FYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQF--------FSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRF-SNSHYL-FSVMEDADVGNVIGRVQQMETEI-DEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMT--IRADAAGGVHAITTVTVDIGDVNDNAPAFH-GDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQF 2813          

HSP 9 Score: 66.2402 bits (160), Expect = 1.411e-10
Identity = 81/303 (26.73%), Postives = 137/303 (45.21%), Query Frame = 3
Query: 1674 FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--------SMILQENTDYFSLAENGK-----------ISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTF-IFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLII-----IYAKDLGYPPLSS--TVKIEISIVETKS 2501
            F+I S+ G+++     +R  + +Y F V    HG         V++ ILD ND+ P+ F+A  +  T I    P   L+ +   D+DEG NGK+         + +  NT   +L E  K           I L  P+ R +     L ++   +G +  +    ++I+  + N +SP F  FP+    + V+ D  +G  ++ K+ A D D G NG I +     V+H     +    S +  +V++ +GEIT+ + L  L + K  ++     + A D G P  SS  T+K+ I  V   S
Sbjct:  436 FAIGSKNGILRVSAKINRS-ERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPV-FSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMS----ALNLMFYKNGTKIPAKPKPIIIQESE-NKHSPVFSSFPE---IVEVTEDAPIG-TVVAKLQANDEDTGYNGFIRY-----VIH-----DIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHS 717          
BLAST of Protocadherin vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 124.405 bits (311), Expect = 2.335e-28
Identity = 177/664 (26.66%), Postives = 283/664 (42.62%), Query Frame = 3
Query:  411 NTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLP----MKIGSLP----SAFDKDF-GQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDV---------DDNEAKIMIKVRILDENDSVPKFHVNSNKIQKF--QIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKG-FNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLL---MVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFS----YINQVKATDID--IQDNGRLHYFINESDTL-SMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIR--DHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNP-PYALIHLTCKDRDEGINGKV-SMILQENTDYFSLAEN--------GKISLKRPIDRETHSE---FKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFG 2255
            N  ++ L      S+      F+  V D+ND VPQF        I E   P     K    P     A D D  G  +++ YR+ G  N ++ + F I      +E   E+F +  FDRE ++ Y+  + A D            N+  + +++ I D ND+ P F     + QK+  ++ E+   G ++I     D D+  N  + Y L      +   +PF + +  G++FV E +D E  + Y + + ASD G     +++ IHIE  DVNDN P F    Q       +EE+ +I   +  +   D D+   +S+I   +E     +  ++ K        I+   A+DR+    +     V++  D   + L+    + ++V D NDN PI       L   I EN         Y   V+A D D    +N  + Y I  +  +   S F ID  TG + +    DRE+    +FI+ +R  D G PS    A VT+ + D NDN P F      Y   +E T P   A++  +  D DE     V +  L E +DYF +  +        G + +K+P+D E  ++   F L I   D G     ++++V +   D ND++P         +  V  D   G   I + TA D D G
Sbjct: 1176 NNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI------DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF-----EEQKYIGRVKESEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGR---IPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTNVYIHIE--DVNDNAPQF---EQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYS----GTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPER---LFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTR--YEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-GRHDAEAAVHVAL--VDRNDHAPHI---HGATEHRVREDVPRGTS-IGRYTATDRDAG 1801          

HSP 2 Score: 103.219 bits (256), Expect = 8.255e-22
Identity = 155/637 (24.33%), Postives = 265/637 (41.60%), Query Frame = 3
Query:  621 LEYRLHGN--KDQLRLFSI---KSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREI---REF-YEITISASDNGIPTQM-SSIKIHIEILDVNDNKPDFILQTQNILNHYS--VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDG-------------QLLMVLK----CCDSGLDPLMSSVTITIDVVDKNDNIP-IVDTNTGSLNWEISENNIKF--SYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSK--IVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNP-PYALIHLTCKDRDEGINGKVSMIL----------QENTDYFSLA--ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQS--SSINVVIEVKDINDNSPTF---------IFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNK 2357
            + Y L G+  +D+ + F I     I HL          + FD  ++ +     +    D+ E+ + + +RI D ND+VP F   +  +   Q+ E+  +   I+     D D G N  I YS++N +        F ++  G +     +D +    R F Y   ++A D+G P  + SS  IHI   + ND    F+  +Q     Y+  V E+++  T +  I+  D D+    ++T    + +     K+      N+F I     + + + G              L ++++    CC        S  T+ I + D N+N P   D    S   +I E   K     I +V+ATD D   NG + Y +  + + S   F ID +TGV+     +VFDRE +      V   D G   L      +V ++D NDN P F    P Y T +        ++I +   D D   N +++  L          Q + D+F L    +G+I+L +PI  +T  +F   +IA D+G+ P++  SS  V + V D    +P +         I  D+N+++N         K+I +  AV     +N  +++         NK     +   KF + N+
Sbjct:  569 ITYSLEGDTPEDETKWFRIDPSTGIIHLTRL-------LDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTF---TRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN--------FSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ-----YTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKM------NLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQF--ERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADDNGI-PEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELN---------KVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNE 1160          

HSP 3 Score: 99.7525 bits (247), Expect = 8.402e-21
Identity = 152/591 (25.72%), Postives = 254/591 (42.98%), Query Frame = 3
Query:  831 DSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNN---EDRTKS-KILPFYMSKKGSLFVSENIDRE---IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLD-----PLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDR----ELQDLYKFIVFIRDHGK----PSLSTS--ATVTVTILDENDNFPMFFTANPL--YLTIIENT---NPPYALIHLTCKDRDEGINGKVSMIL----QENTDYFSLAENGKISLKRP---IDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP-PLSSTVKIEISIVETK 2498
            D++  + V   K Q F+ +E+ R                  G I YSL     ED TK  +I P      G + ++  +D +   + + +++ ++A ++    + S + + I I DVNDN P F       L    V E+  ++  I  +  +DKD G NS+IT  ++ ++FS         I +  +I  ++ +D ++  +   V +   +  D      L SS  I I   + ND   +    T      ++E+    + + Q++A D D  +        N   T  M+ FSID  TG+VK +         E ++     V ++D G     PS + +  AT+ + I D N+N P F           I+E T   +PP  ++ +   D D   NG +   L     E+   F +     +    P    DRET     + + A D G RP        +EV DINDNSP F  P  + + +VS    VG  +IT + A D D   N  I +    L + +    E   D   F  VN+ +GEITLI  + P+  +K +  + A D G P  L S+ ++ +++++ +
Sbjct:  542 DNLVDYSVVDVKAQSFRSFEDGR----------------SKGPITYSLEGDTPEDETKWFRIDP----STGIIHLTRLLDFDDPALPKLHKLKVTARED---NRESHVDLTIRIDDVNDNVPTFTRP----LYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFS---------INSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-LPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPP-TIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP--SYETSVSRFEAVGTSVIT-VFAFDNDAAHNAEITY---SLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPI-PMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQ 1087          

HSP 4 Score: 95.1301 bits (235), Expect = 2.243e-19
Identity = 153/615 (24.88%), Postives = 265/615 (43.09%), Query Frame = 3
Query:  459 IKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS--AFDKDFGQTSKLEYRLH-----GNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEA---KIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNE----DRTKSKILPFYMSKKGSLFVS----ENIDREIREFYEITISASDNGIPTQMSSIKIH-IEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTN---IGTIEVIDKDK-GFNSKITCHI--EENS-FSKYLKLEKI--EIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSS-------VTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYAL--IHLTCKDRDEGINGKVSMILQENTD-YFSLAE-NGKISLKRPIDRETHS---EFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDK 2171
            I    F   V DINDN PQFE   +   +  +R      S+ +  AFD D    +++ Y L      G + Q  L      F L   +    + I        +++F +IA D    EA      + + +LD+    PK+  + +      + EN  +   I+      + +  N +++Y L       ++ +SK   F   + G+ +V     E +D E    Y +T++A+D  + ++++S K   +E+ DVND  P F +   T  I    +  E+ E  TN   I T++ ID D  G  +++   I  E N   +K+ +++++  EIF   K       DREK    ++ ++  D  +  L  +       V + I + D NDN P  +         + E+  +   +  +KA D+D   N R H        +    F + +++G +  K   D E  D Y  ++   D G+ + +T+  V + I D NDN P F         I E+ + P  L  +H T  D+DE  +  V  +  +  D  F + + +G I L + +DR+  +    +   + A D          +V + V+DINDNSP  IFP++
Sbjct:  960 IGFCQFSVEVVDINDNSPQFERPSYETSV--SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDL----DFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLE-KTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEK------FDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQ--KYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIP---FGVRTDSGTIFVKEPLDFEASDQYHLVLIASD-GRHNATTN--VYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSP--IFPER 1549          

HSP 5 Score: 95.1301 bits (235), Expect = 2.300e-19
Identity = 165/695 (23.74%), Postives = 280/695 (40.29%), Query Frame = 3
Query:  468 LNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNE----YMFYLIAKDVDDN---EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYS-LNNEDRTKSKILPFYMSKKGSLF-----VSENIDREIREFYEITISASDNG------IPTQMSSIKIHIEILDVNDNKPDF--ILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF------NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFS--------IDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKP-SLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEG------------INGKVSMILQENTDYFSLAENG----KISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFP------DKNLQMNVSFDYTVGKKLIT-KITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEI 2372
            ++    ++D+NDNVP F    +  Q+ E+ +P+    L  +A DKD G  S++ Y +  +      FSI S         E+ + +  D + +NE    Y F + A+D  +     +  MI +R  + ND    F + +++   F + E+ + GT +I     DAD     E+ YS ++   R+  K+  F + +   L      VS     E      +T+   D+G        T  S   + I I DVN+NKP+F    +  +I         ++  T I  +E  D D   N  I   +       Y + E  + F       +      +  DRE   +  + +K  D G  PL+     +++VVD NDN P  +    S    +S      + +  V A D D   N  + Y + E DT +  +          ++  +G +        + Q  + F V   D+G P +L +SA VT+ +LD+    P + T+      I  + N     + L C+    G             +G      +     F+  ENG    ++ +   +D E  + + L + A D   R  +S+   V+EV+D+ND  P F         D+ +  N   + T GK ++T K    D D  QN V          H   + E+  +  K F +++  GEI
Sbjct:  626 VDLTIRIDDVNDNVPTFTRPLYTAQVRED-IPLNQTILKVTAVDKDTGDNSRITYSVDNHN-----FSINS-------NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVF-LPTSQYTAF-VAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPT-IVKVEATDDDSSANGDIVYSL------YYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP--SYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSL-EIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSR-VASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEV----------HYRIVGEANGEETKHFRIDELTGEI 1280          

HSP 6 Score: 88.1965 bits (217), Expect = 2.717e-17
Identity = 144/544 (26.47%), Postives = 227/544 (41.73%), Query Frame = 3
Query:  639 GNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKI-MIKVRILDENDSVPKFHVN--SNKIQKFQIYENCRI----GTEIILFNVTDAD-EGVNGEIVYSL----NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSS-------IKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQD--NGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQ---DLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYA----LIHLTCKDRDEGIN-------GKVSMILQENTDYFSLAEN-GKISLKRPIDRETHSE--FKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTF 2156
            GNK + +        + NE   E+      D E VN Y   L A D+    A      V + D ND VP+F V+  +  I + ++  N  +    G  I+     D D +G   E+ Y +    N E+    +I        G +F +E  DRE  + Y +T+ ASD  +     +       +K+ I I DVNDN P F  + Q  +    V+E+     ++ TI+  D DK  +S +  H+      +     + +   IF    +  +D E   Q  +VL   D   +   ++  + I + D NDN P  +    +      + +I     N V ATD D QD  + R+ Y +       +  F I   +G ++     DR+       + F+V   D     L   A V V + D NDN P+F     L+  I EN  P ++     + +  +D D+          G V   L      F + +N GKI   R +DRE  SE  F +++ A D G+  +    NV I+V D+NDN+P F
Sbjct: 1142 GNKAESKFRQFNKFENGNEW-VEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDE-EMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDEL----TGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF--EEQKYIGR--VKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRIPFGVRTDSGTIF---VKEPLDFEASDQYHLVLIASDGRHN---ATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFN-VHATDAD-QDEKSSRIVYRLEGQGADEV--FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFF 1661          

HSP 7 Score: 83.5741 bits (205), Expect = 7.105e-16
Identity = 144/593 (24.28%), Postives = 254/593 (42.83%), Query Frame = 3
Query:  456 NIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNV--TDADEG-VNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSENIDREIREF---YEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGF------NSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDRE--KDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNT--GSL--NWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDT--LSMSQFSIDSETGVVKSKIVFDRE---LQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDY-FSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSIN---VVIEVKDINDNSP 2150
            N+K+     ++ D+NDN P FE++ ++ ++ E+           A D D  + S L Y L G       F +++          +F     D E+ ++Y   LIA D   N A   + + I D ND+ P+F     K     I E+  I    +LFNV  TDAD+   +  IVY L  +   +     F + K  G++ + + +DR+       +   + A D+     +    + + + D+NDN P F    + +  +  +EEN E   + G   +  + + F      N+ I   I  N       + +I+  N  KI    ++DRE   + + ++ ++  D G+        +TI V D NDN P  +     GS+     I    + FS  +     D + +DN   +    ESD   ++  + S  S  GV++ K   D E    +D +   + + D G+      A V V ++D ND+ P    A      + E+     ++   T  DRD G   +  +  Q +    F++ ++G + +   +DRE  + + L I A D+     S++I    V + ++D+NDN P
Sbjct: 1318 NVKVQ---IVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLD--KHSNLRYHLIGAGGGRIPFGVRTD------SGTIFVKEPLDFEASDQYHLVLIASDGRHN-ATTNVYIHIEDVNDNAPQFE--QQKYATTVIEEDVDIPK--VLFNVHATDADQDEKSSRIVYRLEGQGADEV----FRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF---PERLFGY--IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQ-NTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFD----ADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD-GR--HDAEAAVHVALVDRNDHAPHIHGAT--EHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDN-----SNNIGRQMVAVYLQDVNDNGP 1870          

HSP 8 Score: 66.6254 bits (161), Expect = 1.016e-10
Identity = 107/455 (23.52%), Postives = 184/455 (40.44%), Query Frame = 3
Query:  912 IILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENI--DREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQ----TRLAIDREKDGQLLMVLKCCDSGL-DPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFS-YINQVKATDIDIQDNGRLHYFIN---------ESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNP----------PYALIHLTCKDRDEGINGKVSMIL----QENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLR-------PQSSSINVVIEVKDINDNSPTF 2156
            I+    TD D   NG+IVYSL        K   F + ++ G L  S ++  DRE R   ++T+ A+D G    +   +  +E++D+NDN P F    +      SV     + T++ T+   D D   N++IT  +E ++ +       ++ F +   +    T +     K  + +  +   D+G+ + L SS  +T++V+DK    P   T+         + N++ +  I + +A       N  + Y +          ES     ++F   +E   V      D E  + Y   +   D     ++++ T  V + D ND  P  FT +    TI E   P          P   +     D D   N     I+     E T +F + E  G+I      DRE    + L + A D  +        P   ++ V I + D+NDN+P+F
Sbjct:  889 IVKVEATDDDSSANGDIVYSLYYTQSESRKA--FVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQF----ERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDM-TSRVASTKTFVVEVRDVNDVVPQ-FTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSF 1335          

HSP 9 Score: 60.077 bits (144), Expect = 1.149e-8
Identity = 81/312 (25.96%), Postives = 132/312 (42.31%), Query Frame = 3
Query:  471 NFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDF-GQTSKLEYRLHGNKDQLRLFSIK----SIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDN--EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNG--IPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEV--IDKDKG-FNSKITCHIEEN-SFSKYLKLEKIEIFN 1364
            N    V D+NDN P FE   +   + E   P+    +  SAFD D   + +   Y+L    D   + + K    S   +   K  L      D E V +   + +   V D   +A+  + V ++D ND  P  H       + ++ E+   GT I  +  TD D G      + +N +   K +   F + + G+L V+  +DRE    Y + I A DN   I  QM ++ +     DVNDN P+     +  +      EN+ ++  +GT E+   D+D   F    T  +  +  +S+YL +    IFN
Sbjct: 1646 NVTIKVTDMNDNAPFFEKTRYEGSVEET-APIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPL------DYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIH----GATEHRVREDVPRGTSIGRYTATDRDAGDTAR--FRINRQSDPKRQ---FTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQ----DVNDNGPEPYTVPRPCI----FRENTPVN-QLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNV----IFN 1928          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 204.527 bits (519), Expect = 5.181e-53
Identity = 195/763 (25.56%), Postives = 343/763 (44.95%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDS-----LCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD----VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQ--IYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS-KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQ---FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQ----ENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPL----FRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            + +++  SGV+ T++ +D ++     L  +  +         T T S++          +K+L       D NDN PQF ++ + +Q+ E++      +  +   A D D G  + + Y + G   Q       S F ++    ++      D ESV  Y   + A+D       N  ++++ V  +D ND+ P+F+ +     +FQ  + EN  +G  II     D+DEG N EI YS++  D       P  +  + G +   + +DRE +  +   + A D G+P + +S  + I + DVNDN P F  +        +V E+    T + T+   D D+  +S++   I   +      +       +  I   L   +EK  + L+ +   DSG      + T+ I++ D N+  PI +    S +  + E+    + +  V ATD D+  N ++ Y +NE     +     FSI+ +TG + +    DRE    Y   V  +D G PSLS +  V + + D NDN P F   +PLY  +I+E+     ++I +   D D G+NG++  +L     E+  +     +G I   + +DRE+ + F L  IA D G  P SS++ V I ++D+ND+ PT  F    + + V  +  VG  ++ +I A DPD G N V+   H  ++           DS  F  V +   E   + ++  L     R++  +++ A     PPL +   IEI + +   +
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQ----------VKVL-------DDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-------SQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV--IDANDNAPRFYTS-----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN----FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA----NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK--RFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSAS--VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKITLYVPENSPVG-SVVGEIHAHDPDEGVNAVV---HYSII--------GGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDN 1216          

HSP 2 Score: 201.83 bits (512), Expect = 3.729e-52
Identity = 151/537 (28.12%), Postives = 264/537 (49.16%), Query Frame = 3
Query:  960 IVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYL-KLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-----WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE--ITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSN 2516
            +VYS+ +   ++S+ L    S+ G +  S ++DRE+ + +   + A+D+  P +  +  + + +LD ND+ P F  +        S+ E + + + + T+   D+D G N++I   IE  +    L + +++ IF I      I TR ++DRE      +++   D   +  +   ++ ++ + V+D NDN P     T ++      W  +E+N     +  ++ATD D  +N  + Y I   +T   SQFSIDS +G V      D E    Y+ ++  +D G PS S +  + V ++D NDN P F+T+     +++EN    Y +I +   D DEG N +++  + E  D F LA     G +   +P+DRE    F  +++AKD G+ P+S+S +VVI V+D+NDN P   F  K  + NV  D   G   +T +TA DPD           ++  LH      +  +++  F++   NG   IT+  SL     ++ L+ + A D G    ++TV I I+     + I+ N
Sbjct:  391 VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEA----SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ-FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA--FNPKYYEANVGEDQPPGTP-VTTVTATDPD-----------EDSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFEN 899          

HSP 3 Score: 156.377 bits (394), Expect = 4.935e-38
Identity = 154/610 (25.25%), Postives = 269/610 (44.10%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-----AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFI------------FPDKNLQMNVSFDYTVGKKLITKI 2231
             L  V D NDN P+F        + EN +P+    +   A+D D G  +++ Y +    D   L        +   K         DRE    + F ++AKD  V    A   + + + D ND+ P F   + K  +  + E+   GT +     TD DE  +  + Y +   + T+ +      + +G + +++++D +  + + +T++A+D+G   +  +  +HI I D N+  P F    +N     SV E++ + T +  +   D D G N++IT  + E S +     +   I      I T   +DRE     L+ +   D G   L  +  + I V D NDN P   +        I E+ +  + + QV A+D D+  NGR+ Y +++ D +    F ID  +G +++    DRE   ++       D G P LS++  V + + D ND+ P F  ++ + L + EN+     +  +   D DEG+N  V  S+I  ++++ FSL     +E  ++     +D E T   F+L + A    LR   +  ++ I V D+NDN+P               FP   +    +FD  V  KL  +I
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK-------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLR---NDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 106.301 bits (264), Expect = 1.238e-22
Identity = 85/316 (26.90%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 1608 DIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN------------GKISLKRPIDRETHSEFKLKIIAKDHG---LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK--LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            D +D+  ++  ++  D+ S S F +DS TGVV +    DREL D++ F V   D   P  S + T+ V +LD ND+ P  F A     +I E       +I L   D+D G N ++   ++  TD   LA++            G IS +  +DRET   + L + A D        ++++ +V ++V D NDN P   F ++   + V  D   G +   +  I A D D G N  I +     ++  N   +        FS++  +G+++L+  L     R   ++I A+D G P  S+T ++ +++++   +
Sbjct:  385 DPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY----AIIGGNTQSQ--------FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDN 685          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 204.142 bits (518), Expect = 6.615e-53
Identity = 195/763 (25.56%), Postives = 343/763 (44.95%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDS-----LCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD----VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQ--IYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS-KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQ---FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQ----ENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPL----FRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            + +++  SGV+ T++ +D ++     L  +  +         T T S++          +K+L       D NDN PQF ++ + +Q+ E++      +  +   A D D G  + + Y + G   Q       S F ++    ++      D ESV  Y   + A+D       N  ++++ V  +D ND+ P+F+ +     +FQ  + EN  +G  II     D+DEG N EI YS++  D       P  +  + G +   + +DRE +  +   + A D G+P + +S  + I + DVNDN P F  +        +V E+    T + T+   D D+  +S++   I   +      +       +  I   L   +EK  + L+ +   DSG      + T+ I++ D N+  PI +    S +  + E+    + +  V ATD D+  N ++ Y +NE     +     FSI+ +TG + +    DRE    Y   V  +D G PSLS +  V + + D NDN P F   +PLY  +I+E+     ++I +   D D G+NG++  +L     E+  +     +G I   + +DRE+ + F L  IA D G  P SS++ V I ++D+ND+ PT  F    + + V  +  VG  ++ +I A DPD G N V+   H  ++           DS  F  V +   E   + ++  L     R++  +++ A     PPL +   IEI + +   +
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQ----------VKVL-------DDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-------SQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV--IDANDNAPRFYTS-----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN----FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA----NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK--RFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSAS--VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKITLYVPENSPVG-SVVGEIHAHDPDEGVNAVV---HYSII--------GGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDN 1216          

HSP 2 Score: 201.445 bits (511), Expect = 4.439e-52
Identity = 151/537 (28.12%), Postives = 264/537 (49.16%), Query Frame = 3
Query:  960 IVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYL-KLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-----WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE--ITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSN 2516
            +VYS+ +   ++S+ L    S+ G +  S ++DRE+ + +   + A+D+  P +  +  + + +LD ND+ P F  +        S+ E + + + + T+   D+D G N++I   IE  +    L + +++ IF I      I TR ++DRE      +++   D   +  +   ++ ++ + V+D NDN P     T ++      W  +E+N     +  ++ATD D  +N  + Y I   +T   SQFSIDS +G V      D E    Y+ ++  +D G PS S +  + V ++D NDN P F+T+     +++EN    Y +I +   D DEG N +++  + E  D F LA     G +   +P+DRE    F  +++AKD G+ P+S+S +VVI V+D+NDN P   F  K  + NV  D   G   +T +TA DPD           ++  LH      +  +++  F++   NG   IT+  SL     ++ L+ + A D G    ++TV I I+     + I+ N
Sbjct:  391 VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEA----SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ-FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA--FNPKYYEANVGEDQPPGTP-VTTVTATDPD-----------EDSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFEN 899          

HSP 3 Score: 155.992 bits (393), Expect = 5.561e-38
Identity = 154/610 (25.25%), Postives = 269/610 (44.10%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-----AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFI------------FPDKNLQMNVSFDYTVGKKLITKI 2231
             L  V D NDN P+F        + EN +P+    +   A+D D G  +++ Y +    D   L        +   K         DRE    + F ++AKD  V    A   + + + D ND+ P F   + K  +  + E+   GT +     TD DE  +  + Y +   + T+ +      + +G + +++++D +  + + +T++A+D+G   +  +  +HI I D N+  P F    +N     SV E++ + T +  +   D D G N++IT  + E S +     +   I      I T   +DRE     L+ +   D G   L  +  + I V D NDN P   +        I E+ +  + + QV A+D D+  NGR+ Y +++ D +    F ID  +G +++    DRE   ++       D G P LS++  V + + D ND+ P F  ++ + L + EN+     +  +   D DEG+N  V  S+I  ++++ FSL     +E  ++     +D E T   F+L + A    LR   +  ++ I V D+NDN+P               FP   +    +FD  V  KL  +I
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK-------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLR---NDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 105.916 bits (263), Expect = 1.336e-22
Identity = 85/316 (26.90%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 1608 DIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN------------GKISLKRPIDRETHSEFKLKIIAKDHG---LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK--LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            D +D+  ++  ++  D+ S S F +DS TGVV +    DREL D++ F V   D   P  S + T+ V +LD ND+ P  F A     +I E       +I L   D+D G N ++   ++  TD   LA++            G IS +  +DRET   + L + A D        ++++ +V ++V D NDN P   F ++   + V  D   G +   +  I A D D G N  I +     ++  N   +        FS++  +G+++L+  L     R   ++I A+D G P  S+T ++ +++++   +
Sbjct:  385 DPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY----AIIGGNTQSQ--------FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDN 685          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 204.142 bits (518), Expect = 6.615e-53
Identity = 195/763 (25.56%), Postives = 343/763 (44.95%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDS-----LCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD----VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQ--IYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS-KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQ---FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQ----ENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPL----FRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            + +++  SGV+ T++ +D ++     L  +  +         T T S++          +K+L       D NDN PQF ++ + +Q+ E++      +  +   A D D G  + + Y + G   Q       S F ++    ++      D ESV  Y   + A+D       N  ++++ V  +D ND+ P+F+ +     +FQ  + EN  +G  II     D+DEG N EI YS++  D       P  +  + G +   + +DRE +  +   + A D G+P + +S  + I + DVNDN P F  +        +V E+    T + T+   D D+  +S++   I   +      +       +  I   L   +EK  + L+ +   DSG      + T+ I++ D N+  PI +    S +  + E+    + +  V ATD D+  N ++ Y +NE     +     FSI+ +TG + +    DRE    Y   V  +D G PSLS +  V + + D NDN P F   +PLY  +I+E+     ++I +   D D G+NG++  +L     E+  +     +G I   + +DRE+ + F L  IA D G  P SS++ V I ++D+ND+ PT  F    + + V  +  VG  ++ +I A DPD G N V+   H  ++           DS  F  V +   E   + ++  L     R++  +++ A     PPL +   IEI + +   +
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQ----------VKVL-------DDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-------SQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV--IDANDNAPRFYTS-----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN----FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA----NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK--RFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSAS--VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKITLYVPENSPVG-SVVGEIHAHDPDEGVNAVV---HYSII--------GGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDN 1216          

HSP 2 Score: 201.445 bits (511), Expect = 4.439e-52
Identity = 151/537 (28.12%), Postives = 264/537 (49.16%), Query Frame = 3
Query:  960 IVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYL-KLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-----WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE--ITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSN 2516
            +VYS+ +   ++S+ L    S+ G +  S ++DRE+ + +   + A+D+  P +  +  + + +LD ND+ P F  +        S+ E + + + + T+   D+D G N++I   IE  +    L + +++ IF I      I TR ++DRE      +++   D   +  +   ++ ++ + V+D NDN P     T ++      W  +E+N     +  ++ATD D  +N  + Y I   +T   SQFSIDS +G V      D E    Y+ ++  +D G PS S +  + V ++D NDN P F+T+     +++EN    Y +I +   D DEG N +++  + E  D F LA     G +   +P+DRE    F  +++AKD G+ P+S+S +VVI V+D+NDN P   F  K  + NV  D   G   +T +TA DPD           ++  LH      +  +++  F++   NG   IT+  SL     ++ L+ + A D G    ++TV I I+     + I+ N
Sbjct:  391 VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEA----SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ-FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA--FNPKYYEANVGEDQPPGTP-VTTVTATDPD-----------EDSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFEN 899          

HSP 3 Score: 155.992 bits (393), Expect = 5.561e-38
Identity = 154/610 (25.25%), Postives = 269/610 (44.10%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-----AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFI------------FPDKNLQMNVSFDYTVGKKLITKI 2231
             L  V D NDN P+F        + EN +P+    +   A+D D G  +++ Y +    D   L        +   K         DRE    + F ++AKD  V    A   + + + D ND+ P F   + K  +  + E+   GT +     TD DE  +  + Y +   + T+ +      + +G + +++++D +  + + +T++A+D+G   +  +  +HI I D N+  P F    +N     SV E++ + T +  +   D D G N++IT  + E S +     +   I      I T   +DRE     L+ +   D G   L  +  + I V D NDN P   +        I E+ +  + + QV A+D D+  NGR+ Y +++ D +    F ID  +G +++    DRE   ++       D G P LS++  V + + D ND+ P F  ++ + L + EN+     +  +   D DEG+N  V  S+I  ++++ FSL     +E  ++     +D E T   F+L + A    LR   +  ++ I V D+NDN+P               FP   +    +FD  V  KL  +I
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK-------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLR---NDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 105.916 bits (263), Expect = 1.336e-22
Identity = 85/316 (26.90%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 1608 DIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN------------GKISLKRPIDRETHSEFKLKIIAKDHG---LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK--LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            D +D+  ++  ++  D+ S S F +DS TGVV +    DREL D++ F V   D   P  S + T+ V +LD ND+ P  F A     +I E       +I L   D+D G N ++   ++  TD   LA++            G IS +  +DRET   + L + A D        ++++ +V ++V D NDN P   F ++   + V  D   G +   +  I A D D G N  I +     ++  N   +        FS++  +G+++L+  L     R   ++I A+D G P  S+T ++ +++++   +
Sbjct:  385 DPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY----AIIGGNTQSQ--------FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDN 685          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 204.142 bits (518), Expect = 6.631e-53
Identity = 195/763 (25.56%), Postives = 343/763 (44.95%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDS-----LCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD----VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQ--IYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS-KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQ---FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQ----ENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPL----FRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            + +++  SGV+ T++ +D ++     L  +  +         T T S++          +K+L       D NDN PQF ++ + +Q+ E++      +  +   A D D G  + + Y + G   Q       S F ++    ++      D ESV  Y   + A+D       N  ++++ V  +D ND+ P+F+ +     +FQ  + EN  +G  II     D+DEG N EI YS++  D       P  +  + G +   + +DRE +  +   + A D G+P + +S  + I + DVNDN P F  +        +V E+    T + T+   D D+  +S++   I   +      +       +  I   L   +EK  + L+ +   DSG      + T+ I++ D N+  PI +    S +  + E+    + +  V ATD D+  N ++ Y +NE     +     FSI+ +TG + +    DRE    Y   V  +D G PSLS +  V + + D NDN P F   +PLY  +I+E+     ++I +   D D G+NG++  +L     E+  +     +G I   + +DRE+ + F L  IA D G  P SS++ V I ++D+ND+ PT  F    + + V  +  VG  ++ +I A DPD G N V+   H  ++           DS  F  V +   E   + ++  L     R++  +++ A     PPL +   IEI + +   +
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQ----------VKVL-------DDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-------SQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV--IDANDNAPRFYTS-----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN----FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA----NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK--RFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSAS--VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKITLYVPENSPVG-SVVGEIHAHDPDEGVNAVV---HYSII--------GGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDN 1216          

HSP 2 Score: 201.445 bits (511), Expect = 4.450e-52
Identity = 151/537 (28.12%), Postives = 264/537 (49.16%), Query Frame = 3
Query:  960 IVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYL-KLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-----WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE--ITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSN 2516
            +VYS+ +   ++S+ L    S+ G +  S ++DRE+ + +   + A+D+  P +  +  + + +LD ND+ P F  +        S+ E + + + + T+   D+D G N++I   IE  +    L + +++ IF I      I TR ++DRE      +++   D   +  +   ++ ++ + V+D NDN P     T ++      W  +E+N     +  ++ATD D  +N  + Y I   +T   SQFSIDS +G V      D E    Y+ ++  +D G PS S +  + V ++D NDN P F+T+     +++EN    Y +I +   D DEG N +++  + E  D F LA     G +   +P+DRE    F  +++AKD G+ P+S+S +VVI V+D+NDN P   F  K  + NV  D   G   +T +TA DPD           ++  LH      +  +++  F++   NG   IT+  SL     ++ L+ + A D G    ++TV I I+     + I+ N
Sbjct:  391 VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEA----SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ-FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA--FNPKYYEANVGEDQPPGTP-VTTVTATDPD-----------EDSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFEN 899          

HSP 3 Score: 155.992 bits (393), Expect = 5.571e-38
Identity = 154/610 (25.25%), Postives = 269/610 (44.10%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-----AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFI------------FPDKNLQMNVSFDYTVGKKLITKI 2231
             L  V D NDN P+F        + EN +P+    +   A+D D G  +++ Y +    D   L        +   K         DRE    + F ++AKD  V    A   + + + D ND+ P F   + K  +  + E+   GT +     TD DE  +  + Y +   + T+ +      + +G + +++++D +  + + +T++A+D+G   +  +  +HI I D N+  P F    +N     SV E++ + T +  +   D D G N++IT  + E S +     +   I      I T   +DRE     L+ +   D G   L  +  + I V D NDN P   +        I E+ +  + + QV A+D D+  NGR+ Y +++ D +    F ID  +G +++    DRE   ++       D G P LS++  V + + D ND+ P F  ++ + L + EN+     +  +   D DEG+N  V  S+I  ++++ FSL     +E  ++     +D E T   F+L + A    LR   +  ++ I V D+NDN+P               FP   +    +FD  V  KL  +I
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK-------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLR---NDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 105.916 bits (263), Expect = 1.338e-22
Identity = 85/316 (26.90%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 1608 DIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN------------GKISLKRPIDRETHSEFKLKIIAKDHG---LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK--LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            D +D+  ++  ++  D+ S S F +DS TGVV +    DREL D++ F V   D   P  S + T+ V +LD ND+ P  F A     +I E       +I L   D+D G N ++   ++  TD   LA++            G IS +  +DRET   + L + A D        ++++ +V ++V D NDN P   F ++   + V  D   G +   +  I A D D G N  I +     ++  N   +        FS++  +G+++L+  L     R   ++I A+D G P  S+T ++ +++++   +
Sbjct:  385 DPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY----AIIGGNTQSQ--------FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDN 685          
BLAST of Protocadherin vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 203.756 bits (517), Expect = 9.224e-53
Identity = 195/763 (25.56%), Postives = 343/763 (44.95%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDS-----LCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD----VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQ--IYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS-KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQ---FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQ----ENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPL----FRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            + +++  SGV+ T++ +D ++     L  +  +         T T S++          +K+L       D NDN PQF ++ + +Q+ E++      +  +   A D D G  + + Y + G   Q       S F ++    ++      D ESV  Y   + A+D       N  ++++ V  +D ND+ P+F+ +     +FQ  + EN  +G  II     D+DEG N EI YS++  D       P  +  + G +   + +DRE +  +   + A D G+P + +S  + I + DVNDN P F  +        +V E+    T + T+   D D+  +S++   I   +      +       +  I   L   +EK  + L+ +   DSG      + T+ I++ D N+  PI +    S +  + E+    + +  V ATD D+  N ++ Y +NE     +     FSI+ +TG + +    DRE    Y   V  +D G PSLS +  V + + D NDN P F   +PLY  +I+E+     ++I +   D D G+NG++  +L     E+  +     +G I   + +DRE+ + F L  IA D G  P SS++ V I ++D+ND+ PT  F    + + V  +  VG  ++ +I A DPD G N V+   H  ++           DS  F  V +   E   + ++  L     R++  +++ A     PPL +   IEI + +   +
Sbjct:  520 IFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQ----------VKVL-------DDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQ-------SQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNV--IDANDNAPRFYTS-----QFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDN----FPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA----NVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEK--RFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSAS--VFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAF--KSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPT--FASDKITLYVPENSPVG-SVVGEIHAHDPDEGVNAVV---HYSII--------GGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAAS---PPLRNDAHIEILVTDVNDN 1216          

HSP 2 Score: 201.06 bits (510), Expect = 5.572e-52
Identity = 151/537 (28.12%), Postives = 264/537 (49.16%), Query Frame = 3
Query:  960 IVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYL-KLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-----WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE--ITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSN 2516
            +VYS+ +   ++S+ L    S+ G +  S ++DRE+ + +   + A+D+  P +  +  + + +LD ND+ P F  +        S+ E + + + + T+   D+D G N++I   IE  +    L + +++ IF I      I TR ++DRE      +++   D   +  +   ++ ++ + V+D NDN P     T ++      W  +E+N     +  ++ATD D  +N  + Y I   +T   SQFSIDS +G V      D E    Y+ ++  +D G PS S +  + V ++D NDN P F+T+     +++EN    Y +I +   D DEG N +++  + E  D F LA     G +   +P+DRE    F  +++AKD G+ P+S+S +VVI V+D+NDN P   F  K  + NV  D   G   +T +TA DPD           ++  LH      +  +++  F++   NG   IT+  SL     ++ L+ + A D G    ++TV I I+     + I+ N
Sbjct:  391 VVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEA----SIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNT----VAHIRATDADQGNNAAIRYAIIGGNT--QSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQ-FQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA--FNPKYYEANVGEDQPPGTP-VTTVTATDPD-----------EDSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFEN 899          

HSP 3 Score: 155.992 bits (393), Expect = 6.771e-38
Identity = 154/610 (25.25%), Postives = 269/610 (44.10%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-----AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFI------------FPDKNLQMNVSFDYTVGKKLITKI 2231
             L  V D NDN P+F        + EN +P+    +   A+D D G  +++ Y +    D   L        +   K         DRE    + F ++AKD  V    A   + + + D ND+ P F   + K  +  + E+   GT +     TD DE  +  + Y +   + T+ +      + +G + +++++D +  + + +T++A+D+G   +  +  +HI I D N+  P F    +N     SV E++ + T +  +   D D G N++IT  + E S +     +   I      I T   +DRE     L+ +   D G   L  +  + I V D NDN P   +        I E+ +  + + QV A+D D+  NGR+ Y +++ D +    F ID  +G +++    DRE   ++       D G P LS++  V + + D ND+ P F  ++ + L + EN+     +  +   D DEG+N  V  S+I  ++++ FSL     +E  ++     +D E T   F+L + A    LR   +  ++ I V D+NDN+P               FP   +    +FD  V  KL  +I
Sbjct:  675 LLVNVIDANDNAPRFYTSQFQESVLEN-VPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIK-------PLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF---NPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGN-TRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIF----ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPL--YQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD-IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF-ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPLR---NDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSDKLHYRI 1257          

HSP 4 Score: 105.916 bits (263), Expect = 1.610e-22
Identity = 85/316 (26.90%), Postives = 148/316 (46.84%), Query Frame = 3
Query: 1608 DIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN------------GKISLKRPIDRETHSEFKLKIIAKDHG---LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK--LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSS 2504
            D +D+  ++  ++  D+ S S F +DS TGVV +    DREL D++ F V   D   P  S + T+ V +LD ND+ P  F A     +I E       +I L   D+D G N ++   ++  TD   LA++            G IS +  +DRET   + L + A D        ++++ +V ++V D NDN P   F ++   + V  D   G +   +  I A D D G N  I +     ++  N   +        FS++  +G+++L+  L     R   ++I A+D G P  S+T ++ +++++   +
Sbjct:  385 DPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPT-FEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQ--FSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRY----AIIGGNTQSQ--------FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDN 685          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 256.529 bits (654), Expect = 7.887e-71
Identity = 217/776 (27.96%), Postives = 364/776 (46.91%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL----INSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN++  +  N   D        F+   K+    L+K+   +G +L T  RID + LC  +    +N K      C  E+ V V   +  +++   FL+EDINDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    S DRE+ + ++  +  +D  +    +  +++V + D ND+ P F  +  ++    + EN  +GT +   + TDAD G N +I +S +N+    +K      S  G + V + +DRE+   +++ + ASD    +  S   + + + D+NDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC+ + +     +      +FN  F ++T   +D E   +  + +   DSG  PL +S  + I + D+NDN+P+       +   I ENN   + + ++ ATD D   N  + Y +      +   F+IDS +G++      DRE Q+ Y F V  RD+G   L ++ TV + + D+NDN P F   +P Y   +    P Y  + L T  D D G N  V++ +    D F +  + G I      DRE  S +   + A D GL   +S   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +         + +  SL   +  F+++K  G ITL    + + Q L R    +++  KDLG P
Sbjct:   30 VKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGV----FNEKR-----CYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIET--PEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN---VPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGS--STPSRATVIVNVTDINDNVPS--IDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQ--PEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPD---APDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQY---------SIIGGSL---RGLFTIDKTTGNITLQEKIVAADQGLHR----LVVKVKDLGQP 759          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 256.914 bits (655), Expect = 1.392e-70
Identity = 217/776 (27.96%), Postives = 364/776 (46.91%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL----INSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN++  +  N   D        F+   K+    L+K+   +G +L T  RID + LC  +    +N K      C  E+ V V   +  +++   FL+EDINDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    S DRE+ + ++  +  +D  +    +  +++V + D ND+ P F  +  ++    + EN  +GT +   + TDAD G N +I +S +N+    +K      S  G + V + +DRE+   +++ + ASD    +  S   + + + D+NDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC+ + +     +      +FN  F ++T   +D E   +  + +   DSG  PL +S  + I + D+NDN+P+       +   I ENN   + + ++ ATD D   N  + Y +      +   F+IDS +G++      DRE Q+ Y F V  RD+G   L ++ TV + + D+NDN P F   +P Y   +    P Y  + L T  D D G N  V++ +    D F +  + G I      DRE  S +   + A D GL   +S   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +         + +  SL   +  F+++K  G ITL    + + Q L R    +++  KDLG P
Sbjct:   30 VKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLCSGV----FNEKR-----CYYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIET--PEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN---VPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGS--STPSRATVIVNVTDINDNVPS--IDTRYIMNLVNGTVLLSENAPLNTKIALITVTDRDSDLNGKVTCYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDENDNVPVFPQ--PEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPD---APDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGLMQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPSNTSPGSVVTRVFAIDNDTGMNAELQY---------SIIGGSL---RGLFTIDKTTGNITLQEKIVAADQGLHR----LVVKVKDLGQP 759          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 255.373 bits (651), Expect = 2.431e-70
Identity = 225/797 (28.23%), Postives = 366/797 (45.92%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVK---NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--IIIYAKDLGYP 2450
            V    L   +  + +Y   PI+EE  +   +GN+    N    N+A   T   N  + L  K+    LL++   +G +  T  RID + LC           S   + CS E+ V +  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D  + +  +  +++V + D ND+ P F  +  ++    I EN  +GT ++    TDAD G N EI Y    +    ++ L    +  G + V   +DRE    +++T+ ASD    +  +   I I + DVNDN P+    +I+   N      + E   I+T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   + +  +   DSG   L  +  + + + D+NDN PI       +   + ENN++  ++  + ATD D   N  + Y +  +     S F +D +TGV+ +  VFDRE Q+ + F V  RD+G  +L + A V VTILDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V + IL +N ++    ++G I      DRE  S +   + A D+G  P SS+  V I V D+NDN+P  I+P  N    +     +   ++ ++ AVD D G N  + +     ++  N         +  F ++   G ITL    +P      L  +++   DLGYP
Sbjct:   13 VACFWLDPTIAQELIY---PIREELQENVLIGNIPKDLNISHMNSATGAT--SNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--------PSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH---IPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTN--GTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKY----TIVSGN--------VRSLFRIDPVTGNITL--EEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 117.087 bits (292), Expect = 4.889e-26
Identity = 140/573 (24.43%), Postives = 241/573 (42.06%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQT-----------RLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPPY--ALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  ++  G    +VY L     +K+   P    MS  G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G           NS  KY  L     F +  ++T           +  +DRE+    +M +K  D G     S+  + + V D NDN P+       +   I EN+   + + Q++ATD D+  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    AT+T+ + D NDN P   + +  +P   T++ +   P    +  +T  D+D  +NGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +  +    +T I+A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G   L S   + ++I++
Sbjct:   33 ELQENVLIGNIPKDLNISHMNSATGATSNLVYRL----VSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTG----------PNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNLRDMFLTTISATDEDSGRNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 254.603 bits (649), Expect = 5.254e-70
Identity = 225/797 (28.23%), Postives = 366/797 (45.92%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVK---NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--IIIYAKDLGYP 2450
            V    L   +  + +Y   PI+EE  +   +GN+    N    N+A   T   N  + L  K+    LL++   +G +  T  RID + LC           S   + CS E+ V +  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D  + +  +  +++V + D ND+ P F  +  ++    I EN  +GT ++    TDAD G N EI Y    +    ++ L    +  G + V   +DRE    +++T+ ASD    +  +   I I + DVNDN P+    +I+   N      + E   I+T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   + +  +   DSG   L  +  + + + D+NDN PI       +   + ENN++  ++  + ATD D   N  + Y +  +     S F +D +TGV+ +  VFDRE Q+ + F V  RD+G  +L + A V VTILDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V + IL +N ++    ++G I      DRE  S +   + A D+G  P SS+  V I V D+NDN+P  I+P  N    +     +   ++ ++ AVD D G N  + +     ++  N         +  F ++   G ITL    +P      L  +++   DLGYP
Sbjct:   13 VACFWLDPTIAQELIY---PIREELQENVLIGNIPKDLNISHMNSATGAT--SNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--------PSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH---IPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTN--GTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKY----TIVSGN--------VRSLFRIDPVTGNITL--EEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 116.701 bits (291), Expect = 6.188e-26
Identity = 140/573 (24.43%), Postives = 241/573 (42.06%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQT-----------RLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPP--YALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  ++  G    +VY L     +K+   P    MS  G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G           NS  KY  L     F +  ++T           +  +DRE+    +M +K  D G     S+  + + V D NDN P+       +   I EN+   + + Q++ATD D+  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    AT+T+ + D NDN P   + +  +P   T++ +   P    +  +T  D+D  +NGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +  +    +T I+A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G   L S   + ++I++
Sbjct:   33 ELQENVLIGNIPKDLNISHMNSATGATSNLVYRL----VSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTG----------PNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNLRDMFLTTISATDEDSGRNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 254.603 bits (649), Expect = 5.254e-70
Identity = 225/797 (28.23%), Postives = 366/797 (45.92%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVK---NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--IIIYAKDLGYP 2450
            V    L   +  + +Y   PI+EE  +   +GN+    N    N+A   T   N  + L  K+    LL++   +G +  T  RID + LC           S   + CS E+ V +  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D  + +  +  +++V + D ND+ P F  +  ++    I EN  +GT ++    TDAD G N EI Y    +    ++ L    +  G + V   +DRE    +++T+ ASD    +  +   I I + DVNDN P+    +I+   N      + E   I+T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   + +  +   DSG   L  +  + + + D+NDN PI       +   + ENN++  ++  + ATD D   N  + Y +  +     S F +D +TGV+ +  VFDRE Q+ + F V  RD+G  +L + A V VTILDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V + IL +N ++    ++G I      DRE  S +   + A D+G  P SS+  V I V D+NDN+P  I+P  N    +     +   ++ ++ AVD D G N  + +     ++  N         +  F ++   G ITL    +P      L  +++   DLGYP
Sbjct:   13 VACFWLDPTIAQELIY---PIREELQENVLIGNIPKDLNISHMNSATGAT--SNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPG--------PSFEDSECSFEIEVVILPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELLNGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVH---IPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTN--GTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKY----TIVSGN--------VRSLFRIDPVTGNITL--EEKPTIADIGLHRLVVNISDLGYP 760          

HSP 2 Score: 116.701 bits (291), Expect = 6.188e-26
Identity = 140/573 (24.43%), Postives = 241/573 (42.06%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQT-----------RLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPP--YALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  ++  G    +VY L     +K+   P    MS  G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G           NS  KY  L     F +  ++T           +  +DRE+    +M +K  D G     S+  + + V D NDN P+       +   I EN+   + + Q++ATD D+  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    AT+T+ + D NDN P   + +  +P   T++ +   P    +  +T  D+D  +NGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +  +    +T I+A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G   L S   + ++I++
Sbjct:   33 ELQENVLIGNIPKDLNISHMNSATGATSNLVYRL----VSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECSFEIEVVILPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTG----------PNSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVF--KESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGS--SSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNLRDMFLTTISATDEDSGRNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILD 563          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 259.61 bits (662), Expect = 1.252e-71
Identity = 219/750 (29.20%), Postives = 353/750 (47.07%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDDNEAK---IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL 2378
            ++EE P+   +GN+   +  N  LD        F+L  K+    L+++ + +G +  T  RID + LC  I            N C  E+ V V   +  +++   FL+EDINDN P F      + I EN       S+PSA D D G      Y L   ++   +F +  I      K+ +L    S DRE  + Y+  +  +D   N A+    +++V + D ND+ P F     K  +  I E+  +GT +   + TDAD G N +I +   N+    +K      +  G + V E +DRE   ++++T+ ASD    +  S   + I I D+NDN P   + T+ I+N  +    + E + ++T I  I V DKD   N K+TC  + +     +      +F N F ++T   +D E   +  + +   DSG  PL  S  + I + D+NDN P+       L++   ENN   + + ++ ATD D   N  L Y +  +   + + F++D  TG++ +    DRE QD Y F V  +D+G PSL T+ TVT+++LD+NDN P  FT N     + EN  P Y  + L T  D D G N  V++ L    D F +    G I      DRE    +  ++ A D G   +SS++ V I V+D+NDN P F+ P  N   ++    T    ++ ++ A+D D G N  + +     ++  N        S+  F++ + +G ITL
Sbjct:   30 VREELPENVLIGNLLKDL--NLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI---------FTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQN---VFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVED-GGNPARSSTAILQVTVTDVNDNRPVFK---EKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPS--IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD-----VPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSF--VENNPPGTELTKISATDADSGRNAELSYMLGPN---APTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPS-FTHNEYNFYVPENL-PMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYS----IIGGN--------SRGLFAIGERSGNITL 733          

HSP 2 Score: 159.073 bits (401), Expect = 5.437e-39
Identity = 162/599 (27.05%), Postives = 267/599 (44.57%), Query Frame = 3
Query:  756 FYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNG---------EIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDT----NTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSM-----SQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD-YFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQM--NVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEI 2480
            FY +   V  +E   ++K+R L  D ND+ P F    + +    I EN  + +   + +  D D GVNG         + V+ L+  +  +    P        L V +++DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + + ++I    ++ E++ + T++  +   D D G N+KI  +   N  +   K       N   I  +  +DRE+     + +   D    P  S  T+TI++ D NDNIP +DT    N  +   ++SE     + I  +  TD D   NG++  F +      +     +QF       ++++    D E    Y   +   D GKP L+ SA + + I DENDN P+F T   + L+ +EN  P   L  ++  D D G N ++S +L  N    F+L    G ++  R +DRE    +   +IAKD+G     ++  V + V D NDNSP+F   + N  +  N+    TVG      IT  D D G+N V+                SL +++  F ++   G I    +     +      + A D G P  SSTVK+ I
Sbjct:  105 FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF---PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWP-------QLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDI--EVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG-NQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVF-TLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGL-----ITVTDADSGENAVVTL--------------SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 659          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 258.84 bits (660), Expect = 2.380e-71
Identity = 219/750 (29.20%), Postives = 353/750 (47.07%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDDNEAK---IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL 2378
            ++EE P+   +GN+   +  N  LD        F+L  K+    L+++ + +G +  T  RID + LC  I            N C  E+ V V   +  +++   FL+EDINDN P F      + I EN       S+PSA D D G      Y L   ++   +F +  I      K+ +L    S DRE  + Y+  +  +D   N A+    +++V + D ND+ P F     K  +  I E+  +GT +   + TDAD G N +I +   N+    +K      +  G + V E +DRE   ++++T+ ASD    +  S   + I I D+NDN P   + T+ I+N  +    + E + ++T I  I V DKD   N K+TC  + +     +      +F N F ++T   +D E   +  + +   DSG  PL  S  + I + D+NDN P+       L++   ENN   + + ++ ATD D   N  L Y +  +   + + F++D  TG++ +    DRE QD Y F V  +D+G PSL T+ TVT+++LD+NDN P  FT N     + EN  P Y  + L T  D D G N  V++ L    D F +    G I      DRE    +  ++ A D G   +SS++ V I V+D+NDN P F+ P  N   ++    T    ++ ++ A+D D G N  + +     ++  N        S+  F++ + +G ITL
Sbjct:   50 VREELPENVLIGNLLKDL--NLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI---------FTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQN---VFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVED-GGNPARSSTAILQVTVTDVNDNRPVFK---EKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPS--IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD-----VPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSF--VENNPPGTELTKISATDADSGRNAELSYMLGPN---APTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPS-FTHNEYNFYVPENL-PMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYS----IIGGN--------SRGLFAIGERSGNITL 753          

HSP 2 Score: 158.688 bits (400), Expect = 7.274e-39
Identity = 162/599 (27.05%), Postives = 267/599 (44.57%), Query Frame = 3
Query:  756 FYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNG---------EIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDT----NTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSM-----SQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD-YFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQM--NVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEI 2480
            FY +   V  +E   ++K+R L  D ND+ P F    + +    I EN  + +   + +  D D GVNG         + V+ L+  +  +    P        L V +++DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + + ++I    ++ E++ + T++  +   D D G N+KI  +   N  +   K       N   I  +  +DRE+     + +   D    P  S  T+TI++ D NDNIP +DT    N  +   ++SE     + I  +  TD D   NG++  F +      +     +QF       ++++    D E    Y   +   D GKP L+ SA + + I DENDN P+F T   + L+ +EN  P   L  ++  D D G N ++S +L  N    F+L    G ++  R +DRE    +   +IAKD+G     ++  V + V D NDNSP+F   + N  +  N+    TVG      IT  D D G+N V+                SL +++  F ++   G I    +     +      + A D G P  SSTVK+ I
Sbjct:  125 FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF---PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWP-------QLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDI--EVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG-NQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVF-TLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGL-----ITVTDADSGENAVVTL--------------SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 679          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 256.914 bits (655), Expect = 2.810e-71
Identity = 235/827 (28.42%), Postives = 393/827 (47.52%), Query Frame = 3
Query:   93 MQFEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVT---YSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEI-FNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNW--EISENNIKFSYINQVKATDIDIQDNGRLHYFINE---SDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPP---YALIHLTCKDRDEGINGKVS-MILQENTDYFSLAE-------NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFD----YTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++++VI     F+           I EEQ  G  +GN+ N +     +    L +  F +  +S   + L ++  +G L    RID ++LC   + C  N          IE +++     Y+ N++I       +D+NDN P F      + I E  +     +L SA D D G  S   Y+L  N      F +    + +  KY EL    + DRE  N  +  L A D          +I++ + D ND+ P F+ ++ ++    + EN  IG  +I  + TDADEG N EI Y  N+      ++      + GS+ ++  +D E+   YE+T+ A D G    +S  K+ I++ DVNDN PD ++ + + +    + E+S + T I  + + D D G N ++   I E+     L    I    N +K+ T + +DREK  +  + +K  D G   L +S TI + + D NDN P+ D     +++   I ENN   +   +V ATD DI +NG++ Y I      D    S  SI++ +GV+ ++  FD E   L +F +   D G P L+ + T+ + + D NDN P+F   +  Y+  I+  NP    +  +H T  D +E  NGKV  MIL +  +   L+        +G +  +R  D E+  EF ++++AKD G   +S++  V I + D NDN+P  ++P ++ +    F+    ++    L+TK+ AVD D G N  + +H   L+    ++P+       F  + ++ GEI +   LQ     +  I++  KD GYP LSSTV + + + E
Sbjct:   14 IRWQVIFCFFSFLCESVICQLQYSIYEEQRLGYVIGNIANDL----GVSAEELSSRKFHIVSRSK-KQYLNVHLENGDLYVADRIDREALCGMQQNCFLN----------IEAVMESPLHFYTINVEI-------QDVNDNSPSFSKSIFEISISELAVVGTHFALGSAKDPDLGNNSIQSYKLSAND----YFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVT---VSENVPIGFLVIDLHATDADEGSNAEITYLFNDIPENAQEVFAI-NPENGSVQITGKLDYEVATNYEMTVEAKDGG--GLVSYCKLLIQVSDVNDNAPDILITSFSDI----IPEDSRVGTVIALVNLDDLDSGENGEVVGQISES-----LPFHLISSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFD----KMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMILTDIIEDIPISSYVSINTVSGVLYAQRSFDYE--KLREFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMD--YVAYIQENNPSGSSFFRVHATDSDINE--NGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESLREFYIQVMAKDSGSPSRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYH---LL----QVPD-----PSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVVAE 777          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 258.84 bits (660), Expect = 2.898e-71
Identity = 219/750 (29.20%), Postives = 353/750 (47.07%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDDNEAK---IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL 2378
            ++EE P+   +GN+   +  N  LD        F+L  K+    L+++ + +G +  T  RID + LC  I            N C  E+ V V   +  +++   FL+EDINDN P F      + I EN       S+PSA D D G      Y L   ++   +F +  I      K+ +L    S DRE  + Y+  +  +D   N A+    +++V + D ND+ P F     K  +  I E+  +GT +   + TDAD G N +I +   N+    +K      +  G + V E +DRE   ++++T+ ASD    +  S   + I I D+NDN P   + T+ I+N  +    + E + ++T I  I V DKD   N K+TC  + +     +      +F N F ++T   +D E   +  + +   DSG  PL  S  + I + D+NDN P+       L++   ENN   + + ++ ATD D   N  L Y +  +   + + F++D  TG++ +    DRE QD Y F V  +D+G PSL T+ TVT+++LD+NDN P  FT N     + EN  P Y  + L T  D D G N  V++ L    D F +    G I      DRE    +  ++ A D G   +SS++ V I V+D+NDN P F+ P  N   ++    T    ++ ++ A+D D G N  + +     ++  N        S+  F++ + +G ITL
Sbjct:   50 VREELPENVLIGNLLKDL--NLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLCSGI---------FTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQN---VFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVED-GGNPARSSTAILQVTVTDVNDNRPVFK---EKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPS--IDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHD-----VPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSF--VENNPPGTELTKISATDADSGRNAELSYMLGPN---APTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPS-FTHNEYNFYVPENL-PMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSPGSVVARVYAIDNDTGINADLRYS----IIGGN--------SRGLFAIGERSGNITL 753          

HSP 2 Score: 158.688 bits (400), Expect = 7.570e-39
Identity = 162/599 (27.05%), Postives = 267/599 (44.57%), Query Frame = 3
Query:  756 FYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNG---------EIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDT----NTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSM-----SQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD-YFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQM--NVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEI 2480
            FY +   V  +E   ++K+R L  D ND+ P F    + +    I EN  + +   + +  D D GVNG         + V+ L+  +  +    P        L V +++DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + + ++I    ++ E++ + T++  +   D D G N+KI  +   N  +   K       N   I  +  +DRE+     + +   D    P  S  T+TI++ D NDNIP +DT    N  +   ++SE     + I  +  TD D   NG++  F +      +     +QF       ++++    D E    Y   +   D GKP L+ SA + + I DENDN P+F T   + L+ +EN  P   L  ++  D D G N ++S +L  N    F+L    G ++  R +DRE    +   +IAKD+G     ++  V + V D NDNSP+F   + N  +  N+    TVG      IT  D D G+N V+                SL +++  F ++   G I    +     +      + A D G P  SSTVK+ I
Sbjct:  125 FYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLF---PSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWP-------QLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDI--EVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFG-NQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQF-------LLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVF-TLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGL-----ITVTDADSGENAVVTL--------------SLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 679          
BLAST of Protocadherin vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 254.603 bits (649), Expect = 7.506e-70
Identity = 228/809 (28.18%), Postives = 371/809 (45.86%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNS-SFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP-PLSSTVKIEISIVETKS 2501
            +  L L   +  + +Y    I+EE P+   +GN+   +  ++    T    S  + L  K+  + L+K++  +G +  T TRID + LC         S + + N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F  +  ++    I EN  IGT ++  + TDAD G N EI Y    +  + +K L    +  G + V   +DRE    +++T+ A+D       +++ I+  + DVNDN P+  L+     I     + E   I+T I  I V DKD   NSK+ C IE     + +      ++ N + ++T   +D E   +    +   D+G   L  +  + +++ D+NDN PI       L+  +SENN +  Y+  V A+D D   N  + Y +      + S F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I + D NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL             +++   DLGYP PL + V + + + ET  
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAG-------SSNSDENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVH---IPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTIN--VTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELS--VSENNRRGLYLTTVSASDEDSGKNSDIVYQLGP----NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNETAG 779          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.062 bits (645), Expect = 2.859e-70
Identity = 222/772 (28.76%), Postives = 354/772 (45.85%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD       +++ I++   DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +      + S F +D +TGV+ +  VF+RE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   30 IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVT--DVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGP----NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 153.68 bits (387), Expect = 1.590e-37
Identity = 176/672 (26.19%), Postives = 290/672 (43.15%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKG----SLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N        L    + +G     L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I        F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  +RE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +  + F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFG--LDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEI-----RYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDEDAGENKAVTL--------------SILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 131.339 bits (329), Expect = 1.544e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P  IF    ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPP--IFNQPVIELSVSENNRRGLYL-TTISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 253.832 bits (647), Expect = 8.293e-70
Identity = 223/801 (27.84%), Postives = 372/801 (46.44%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--------IIIYAKDLGYP 2450
            F V+L  + F    Q   Y   ++EE P+   +G++   +  +   DK+      F+L  K+    L+++ + +G +  T  RID + LC  I     +++      C  E+ V V   +  +++   FL+EDINDN P F      + I EN       SLP+A D D G      Y+L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     K  +  I EN  IG+ +   + TDAD G N  I +  +N     +K L    +  G + V E +DRE    +++ + A+D G  +  +   + + + D+NDN P     +I+   N      + EN+ ++T I  I V+DKD   N ++TC  +        +L  +   N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  SL+  + ENN   + + ++ ATD D   N  + Y +      +  +F++D  TG++ +    DRE Q+ Y F V  +D+G P L ++ATV VT+LD+NDN P+F T N     + E+  P +  + L T  D D G N  V++ + +  D F++  ++G I      DRE    +   + A+D G   +SS+  V I V D+NDN P FI P  N         T    ++ K+ A+D D G N  +L+     ++  N        +K  F + + +G ITL        + KC+        +I+ A DLG P
Sbjct:   10 FAVLLACVVFQSGAQEKNYT--VREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGI---VLDAR------CFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIET--PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF---IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTN--GTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV---PFRLRPV-FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLS--VPENNSPGAQLTKISATDADSGQNAEISYMLGFD---APPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIF-THNEYNFYVPESL-PKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYS----IVGGN--------TKGLFMIEQTSGNITL--------KEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 172.17 bits (435), Expect = 3.684e-43
Identity = 165/561 (29.41%), Postives = 266/561 (47.42%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVP----KFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSM----SQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV-SMILQENTDYFSLAE--NGKISLKRPIDRETHSEFKL-KIIAKDHGLRPQSSSINVV 2117
            V D NDN P F +K   + I EN     IGS  +   A D D G+ +++ +        +     K +FHLN     +      DRE    +   ++A D     A+  + V + D ND+VP    ++ VN        + EN  + T+I L  V D D   NG +    ++E     ++ P + S +  L  +  +D E    Y I + A+D G P    S  + I++ D NDN P F   TQ+ ++  SV EN+     +  I   D D G N++I+  +  ++  ++   ++  I    K      +DREK  +    +   D+G+ PLMS+ T+ + V+D+NDN PI   N    N+ + E+  K   +  +  TD D        Y  N + TLS+     QF+ID ++GV++  I FDRE Q+ Y F V   D G+ S S++A VT+ ++D NDN P+F    +N  +  ++ +TNP   +  +   D D G+N +V   I+  NT    + E  +G I+LK   ++   S+  L ++I K + L    S  NVV
Sbjct:  239 VADTNDNHPIFIEKEIEVSIPEN---APIGSSVTQLHATDADIGENARIHFYFSNLVSNIA----KRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTN-GTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHE--VPFRLRPVF-SNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF---TQSFIS-LSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVK-----KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHN--EYNFYVPESLPKHGTVGLITVTDPD--------YGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLGQPDSLFNVV 766          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 254.218 bits (648), Expect = 1.454e-69
Identity = 223/801 (27.84%), Postives = 372/801 (46.44%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--------IIIYAKDLGYP 2450
            F V+L  + F    Q   Y   ++EE P+   +G++   +  +   DK+      F+L  K+    L+++ + +G +  T  RID + LC  I     +++      C  E+ V V   +  +++   FL+EDINDN P F      + I EN       SLP+A D D G      Y+L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     K  +  I EN  IG+ +   + TDAD G N  I +  +N     +K L    +  G + V E +DRE    +++ + A+D G  +  +   + + + D+NDN P     +I+   N      + EN+ ++T I  I V+DKD   N ++TC  +        +L  +   N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  SL+  + ENN   + + ++ ATD D   N  + Y +      +  +F++D  TG++ +    DRE Q+ Y F V  +D+G P L ++ATV VT+LD+NDN P+F T N     + E+  P +  + L T  D D G N  V++ + +  D F++  ++G I      DRE    +   + A+D G   +SS+  V I V D+NDN P FI P  N         T    ++ K+ A+D D G N  +L+     ++  N        +K  F + + +G ITL        + KC+        +I+ A DLG P
Sbjct:   10 FAVLLACVVFQSGAQEKNYT--VREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGI---VLDAR------CFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIET--PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIF---IEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGG--STPARATVLVNVTDINDNVPSIDIRYIVNPTN--GTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEV---PFRLRPV-FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLS--VPENNSPGAQLTKISATDADSGQNAEISYMLGFD---APPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIF-THNEYNFYVPESL-PKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYS----IVGGN--------TKGLFMIEQTSGNITL--------KEKCMVSDLGLHRVIVKANDLGQP 759          

HSP 2 Score: 171.785 bits (434), Expect = 4.863e-43
Identity = 165/561 (29.41%), Postives = 266/561 (47.42%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPS---AFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVP----KFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSM----SQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV-SMILQENTDYFSLAE--NGKISLKRPIDRETHSEFKL-KIIAKDHGLRPQSSSINVV 2117
            V D NDN P F +K   + I EN     IGS  +   A D D G+ +++ +        +     K +FHLN     +      DRE    +   ++A D     A+  + V + D ND+VP    ++ VN        + EN  + T+I L  V D D   NG +    ++E     ++ P + S +  L  +  +D E    Y I + A+D G P    S  + I++ D NDN P F   TQ+ ++  SV EN+     +  I   D D G N++I+  +  ++  ++   ++  I    K      +DREK  +    +   D+G+ PLMS+ T+ + V+D+NDN PI   N    N+ + E+  K   +  +  TD D        Y  N + TLS+     QF+ID ++GV++  I FDRE Q+ Y F V   D G+ S S++A VT+ ++D NDN P+F    +N  +  ++ +TNP   +  +   D D G+N +V   I+  NT    + E  +G I+LK   ++   S+  L ++I K + L    S  NVV
Sbjct:  239 VADTNDNHPIFIEKEIEVSIPEN---APIGSSVTQLHATDADIGENARIHFYFSNLVSNIA----KRLFHLNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTN-GTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHE--VPFRLRPVF-SNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVF---TQSFIS-LSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVK-----KLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHN--EYNFYVPESLPKHGTVGLITVTDPD--------YGENSAVTLSILDVNDQFTIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLK---EKCMVSDLGLHRVIVKANDLGQPDSLFNVV 766          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 254.218 bits (648), Expect = 2.086e-69
Identity = 226/799 (28.29%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VF+RE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 154.836 bits (390), Expect = 1.162e-37
Identity = 177/670 (26.42%), Postives = 293/670 (43.73%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  +RE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +  + F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDEDAGENKAVTL--------------SILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.88 bits (333), Expect = 6.860e-31
Identity = 151/568 (26.58%), Postives = 248/568 (43.66%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSEN-IDREI-----------REFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE              F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 253.832 bits (647), Expect = 3.079e-69
Identity = 226/799 (28.29%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VF+RE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 154.066 bits (388), Expect = 1.882e-37
Identity = 177/670 (26.42%), Postives = 293/670 (43.73%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  +RE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +  + F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDEDAGENKAVTL--------------SILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.494 bits (332), Expect = 1.015e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 256.144 bits (653), Expect = 3.624e-69
Identity = 227/799 (28.41%), Postives = 362/799 (45.31%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILEN-NALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +  L L   +  + +Y    I+EE P+   +GN+ K+  + + NA   T   +  + L  K+    L+K++  +G +  T  RID + LC       Y  +    N C  EL V +  +   +++    +V+D NDN P F      + I EN L      +PSA D D G      Y L          + +S+F L+       E   +L    + DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +I  + TDAD G N EI Y    +    +K L    +  G + V  ++DRE    +++T+ ASD    +  +   + I + DVNDN P+  L+     I     + E   ++T I  I V DKD   N K+ C IE     + +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI   N   +   +SENN +  Y+  + ATD D   N  + Y +  + +     F +D +TGV+ +  VFDRE Q+ + F V  RD+G P L + A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  V++ IL +N ++     +G I      DRE  S +   + A D G  P+SS+  V I V D+NDNSP  I P  N    +     +   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   13 IACLRLDSAIAQELIYT---IREELPENVPIGNIPKDLNISHINAATGTSA-SLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEE----NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYEL---------LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVH---IPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-----REVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASF----FDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          

HSP 2 Score: 156.762 bits (395), Expect = 2.329e-37
Identity = 178/670 (26.57%), Postives = 292/670 (43.58%), Query Frame = 3
Query:  564 MKIGSLP-----SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKS----IFHLNEC--KYELFSHISFDRESVNEYMFYL-IAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGS-LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNWEI--SENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDY----TVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            + IG++P     S  +   G ++ L YRL        L  + S    IF  +    + +L +  S+  E  NE  F L +    +D    I IK+ + D ND+ P F    + +    I EN  I +   + + TD D G NG   Y L N +      I+     +K   L V +N+DRE ++ Y + I   D G P + S+  + + + DVNDN+P  + +   +  H  + EN+ + T++  +   D D G N++I  +I    F   +      +F +      I  + ++DRE+     + +   D    P  +  T+TI+V D NDN P +D       +N  +  SE +   + I  +  +D D   NG++  FI       +   ++     ++++  + D E    + F +   D GKPSL+ +A V V + DENDN P+F     + L++ EN      L  ++  D D G N  +   L  N  +F L  + G ++  R  DRE    F   + A+D+G  P  S   V++ V D NDNSP F     + Q  VS +     TVG      IT  D D G+N  +                S+ +    F ++  +G I    S     +      + A D G PP SST K+ I++++
Sbjct:   38 VPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEE--NECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPMF---PSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRP--VFKEGQVEVH--IPENAPVGTSVIQLHATDADIGSNAEIR-YI----FGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTP--ARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLK--AVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF-NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH--NHFQFFVSENLPKYSTVGV-----ITVTDADAGENKAVTL--------------SILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMD 667          

HSP 3 Score: 132.88 bits (333), Expect = 5.300e-30
Identity = 152/568 (26.76%), Postives = 249/568 (43.84%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFY--MSKKGSLFVSEN-IDRE--------IRE---FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPL----YLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N++  +A  G +  +VY L     +K+   P     S  G +F + N IDRE          E   F+E+ +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D GFN     H E  +      L+ +E     K    +    +DRE+    +M +K  D G     S+  + + V D NDN P+     G +   I EN    + + Q+ ATD DI  N  + Y F  +    +   F++++ TG++  +   DRE   ++K  V   D    S    ATVT+ + D NDN P   + +  +P+    YL+  +  N   ALI  T  D+D  +NGKV   ++    +   ++ +N  +      +D E   EF  KI+A D G    + +  V ++++D NDN P F  P   ++++VS +   G  L T I+A D D G+N  I++               L  +  FF +++  G +T         + + +  + A+D G PPL S   + +++++
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRL----VSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAGASYAEENECFFELEVVILPNDF---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFPIPSATDPDTGFNG--VQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVF--KEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGS--STPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALI--TVSDKDTDVNGKVICFIEREVPFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQP--VIELSVSENNRRGLYLTT-ISATDEDSGKNADIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLD 564          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 4.877e-68
Identity = 222/792 (28.03%), Postives = 367/792 (46.34%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            F V+L  + F    Q   Y   I+EE P+   +G++   +  +   +K+      F+L  K+    L+++ + +G +  T  RID + LC  I         H    C  E+ V +   +  +++   FL+EDINDN P F      + I EN       +LP+A D D G      Y L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +   + TDAD G N +I +S +N     ++ L    +  G + + E +DRE    +++ + ASD G+    +   + + + DVNDN P   I    N +N   V  EN  ++T I  I V DKD   N ++TC  +       +      +F N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  +++  I ENN     + +V ATD D   N  ++Y +      +  +FS+D  TG++      DRE +D Y F +  +D+G P L+++ TV V+I+D+NDN P+ FT N     + EN  P +  + L T  D D G N  V++ IL EN D+   ++ G I      DRE    +   + A+D G   +SSS  V I V D+NDN P FI P  N    +    T    ++ ++ AVD D G N  + +     ++  N        ++  F+++++ G ITL+            +++ A DLG P
Sbjct:   10 FAVLLACVVFHSGAQEKNYT--IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPR-----DEH----CFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIET--PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS---IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHE-----IPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS--IPENNSPGIQLTKVSATDADSGPNAEINYLLGPD---APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPV-FTHNEYNFYVPENL-PRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYS----IVGGN--------TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 5.690e-68
Identity = 222/792 (28.03%), Postives = 367/792 (46.34%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            F V+L  + F    Q   Y   I+EE P+   +G++   +  +   +K+      F+L  K+    L+++ + +G +  T  RID + LC  I         H    C  E+ V +   +  +++   FL+EDINDN P F      + I EN       +LP+A D D G      Y L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +   + TDAD G N +I +S +N     ++ L    +  G + + E +DRE    +++ + ASD G+    +   + + + DVNDN P   I    N +N   V  EN  ++T I  I V DKD   N ++TC  +       +      +F N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  +++  I ENN     + +V ATD D   N  ++Y +      +  +FS+D  TG++      DRE +D Y F +  +D+G P L+++ TV V+I+D+NDN P+ FT N     + EN  P +  + L T  D D G N  V++ IL EN D+   ++ G I      DRE    +   + A+D G   +SSS  V I V D+NDN P FI P  N    +    T    ++ ++ AVD D G N  + +     ++  N        ++  F+++++ G ITL+            +++ A DLG P
Sbjct:   10 FAVLLACVVFHSGAQEKNYT--IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPR-----DEH----CFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLDVIET--PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS---IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHE-----IPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS--IPENNSPGIQLTKVSATDADSGPNAEINYLLGPD---APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPV-FTHNEYNFYVPENL-PRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYS----IVGGN--------TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 5.846e-68
Identity = 222/792 (28.03%), Postives = 367/792 (46.34%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            F V+L  + F    Q   Y   I+EE P+   +G++   +  +   +K+      F+L  K+    L+++ + +G +  T  RID + LC  I         H    C  E+ V +   +  +++   FL+EDINDN P F      + I EN       +LP+A D D G      Y L  +++   L  I++     +   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F     ++    I EN  +GT +   + TDAD G N +I +S +N     ++ L    +  G + + E +DRE    +++ + ASD G+    +   + + + DVNDN P   I    N +N   V  EN  ++T I  I V DKD   N ++TC  +       +      +F N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+   +  +++  I ENN     + +V ATD D   N  ++Y +      +  +FS+D  TG++      DRE +D Y F +  +D+G P L+++ TV V+I+D+NDN P+ FT N     + EN  P +  + L T  D D G N  V++ IL EN D+   ++ G I      DRE    +   + A+D G   +SSS  V I V D+NDN P FI P  N    +    T    ++ ++ AVD D G N  + +     ++  N        ++  F+++++ G ITL+            +++ A DLG P
Sbjct:   10 FAVLLACVVFHSGAQEKNYT--IREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPR-----DEH----CFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIET--PEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVS---IPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGL--MPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHE-----IPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVS--IPENNSPGIQLTKVSATDADSGPNAEINYLLGPD---APPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPV-FTHNEYNFYVPENL-PRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYS----IVGGN--------TRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.045e-67
Identity = 226/806 (28.04%), Postives = 366/806 (45.41%), Query Frame = 3
Query:   99 FEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN-------ECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--------IIIYAKDLGYP 2450
            F V+L  + F    Q   Y   I+EE P+   +G++   +  +   D++      F+L  K+    L+++ + +G +  T  RID + LC  I    +         C  E+ V V   +  +++   FL+EDINDN P F      + I EN       +LP+  D D G      Y L            +SIF L+       E   +L      DRE  + Y+  +  +D       +  +++V + D ND+ P F  N  ++    I EN  +G+ +   + TDAD G N +I +  +N     +K L    S  G + + E +DRE    +++ + ASD G+    + + +++   D+NDN P   I    N +N   V  EN+ ++T I  I V DKD   N  ++C  +        +L  +   N F ++T   +D E   +  + L   D+G  PL  S  + I V D+NDN P+      SL+  + ENN   + + ++ A D D   N  ++Y +      + S+F++D  TG++ +    DRE Q+ Y F V  +D+G P L T+ATV VT+LD+NDN P+ FT N     + EN  P +  + L T  D D G N  V + IL  N D+    + G I      DRE    +   + A+D G   +SS+  V I V D+NDN P F+ P  N    +    T    ++  + A+D D G N  + +     ++  N        +K  F +++ +G ITL        + KC+        +++ AKDLG P
Sbjct:   10 FAVLLACIVFQSGAQEKNYT--IREEMPENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLCAGIVVDAH---------CFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRYALPATIDPDTGINGVQNYHL---------IKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVS---IPENAPVGSSVTQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREESPNHKLLVLASDGGLTPARAMVLVNV--TDINDNIPSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFTDHEV---PFRLRPV-FSNQFLLETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLS--VPENNSPGTQLTKISAMDADSGRNAEINYLLGFD---APSEFNLDHRTGILTAVKKLDREKQEKYSFTVLAKDNGMPPLMTNATVLVTVLDQNDNSPV-FTHNEYNFYVPENL-PRHGTVGLITVTDPDYGENSAVILSILDANDDFTIDPQTGVIQPNISFDREKQESYTFYVKAEDGGRISRSSTAKVTINVVDVNDNKPVFVVPSSNYSFELVPPSTNPGTVVFTVVAIDNDTGMNAELRYS----MVGGN--------TKGLFIIDQTSGNITL--------KEKCVFADLGLHRLVVKAKDLGQP 759          
BLAST of Protocadherin vs. TrEMBL
Match: G5AQQ6 (Protocadherin gamma-A11 (Fragment) OS=Heterocephalus glaber OX=10181 GN=GW7_10583 PE=4 SV=1)

HSP 1 Score: 292.352 bits (747), Expect = 2.759e-81
Identity = 250/858 (29.14%), Postives = 400/858 (46.62%), Query Frame = 3
Query:  111 LLLLQFVMPYQFLYYLQ------PIKEEQPQGTFVGNV-KNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLH-----------GNKDQLR------------LFSIKSI------------FHLNECKY---------------ELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLS----MSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK-----LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKI 2474
            LLLL F++    L+ L        + EE  +G FVGN+ K+  LE   L +  +   S E        +L  LN   G L T  R+D + LCE++  C            S+E++V+ T    +KI      + D+NDN P F ++   +++ E+  P     LP+A D D G  S   Y+L            G++ Q R             F + +             + L+   Y               EL      DRE    +   L A D  D   +  I I+  +LD ND +PKF   +  + +  + EN   GT +++ N TD DEG NGE++YS  N +   S+I  F M SK G + V   +D E  +FYE+ I   D G    +++ K+ I ++DVNDN P+  + +   +N  S+ ENS   + I  + V D+D G N +++C I  N      KLEK    N +K+ T   +DRE+     + L   D G  PL +   + ++V D NDN P+   +  S +  I ENN + + I  V A D+D ++N  + Y + E DT+      S  SI+S+TG++ S   FD E     +  V   D G P L+ +A + + + D NDN P+ FT N   +++ EN  P  +++ +T  D+DEG N +++   +    Y S+ A++G +  +R  D E    F+L + A+D G    S+++++ + V D NDN+P  ++P      +  FD TV +      L+TK+ AVD D G N  + +H    VL ++            FS+    GE+    +L      +  +++  +D G PPLS+T  +
Sbjct:    1 LLLLCFIL--GTLWGLGDGQIRYSVPEETDRGFFVGNISKDLGLEPQELAERGVRIVSGEK------TQLFALNPRGGSLVTAGRVDREELCETVSSCF----------LSMEILVEDT----LKIYGVEVEIIDVNDNAPTFREEEVEIKVSEHATPGSRFPLPNARDPDVGANSLQSYQLSPNSYRNPRRQLGHRGQGRPGGALEHATPGSRFPLPNARDPDVGANSLQSYQLSPNSYFSLQVRGGADGVKNPELVLEGGLDREKAAAHHLLLTAADGGDPIRKGTIPIRAVVLDVNDHIPKF---TQPVYQVSVPENLSSGTRVLVVNATDPDEGTNGEVMYSFRNMESKASEI--FQMNSKTGEVLVQGPLDFEKYKFYEMEIQGQDGG--GLLTTAKMLITVVDVNDNAPEITITSS--VN--SLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNN---LPFKLEKT-YGNYYKLITNSELDREQIQSYNVTLTAKDQGSPPLYTEAHLLLNVADDNDNPPVFSQS--SYSAYIPENNPRGASIFSVTAVDLDSKENAHVTYSLME-DTIQGVPLSSYVSINSDTGILYSLQSFDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDANDNPPV-FTQNVYKVSLRENVPPGTSMLQVTAIDQDEGANAEITYSFKTLLSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFD-TVPRAAEPGYLVTKVVAVDADSGHNAWLSYH----VLQASD--------PGLFSLGLRTGEVRTARALGDKDAARHRLLVAVRDGGKPPLSATATL 804          

HSP 2 Score: 150.214 bits (378), Expect = 2.595e-33
Identity = 146/573 (25.48%), Postives = 257/573 (44.85%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDN-----EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGS----LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENS-----FSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP--MFFTANP----LYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD--YFSLA-ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKD 2132
            +V D+ND++P+F    + + + EN        + +A D D G   ++ Y     + +        IF +N    E+      D E   +Y FY +     D       AK++I V  +D ND+ P+  + S+      + EN   G+ I L NV D D G NG++   + N        LPF + K       L  +  +DRE  + Y +T++A D G P   +   + + + D NDN P F   +Q+  + Y + EN+    +I ++  +D D   N+ +T  + E++      S Y+ +   +   ++ +Q+    D E+   L + +   D G   L  +  I I V D NDN P+   N   ++  + EN    + + QV A D D   N  + Y      TL +S  S+ +++GVV ++  FD E    ++  +  RD G P+LS + ++ V + D NDN P  ++    P    L+ T+     P Y +  +   D D G N  +S  + + +D   FSL    G++   R +  +  +  +L +  +D G  P S++  +++   D
Sbjct:  272 VVLDVNDHIPKFTQPVYQVSVPENLSSGTRVLVVNATDPDEGTNGEVMYSFRNMESK-----ASEIFQMNSKTGEVLVQGPLDFE---KYKFYEMEIQGQDGGGLLTTAKMLITV--VDVNDNAPEITITSS---VNSLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNN-------LPFKLEKTYGNYYKLITNSELDREQIQSYNVTLTAKDQGSPPLYTEAHLLLNVADDNDNPPVF---SQSSYSAY-IPENNPRGASIFSVTAVDLDSKENAHVTYSLMEDTIQGVPLSSYVSINS-DTGILYSLQS---FDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDANDNPPVFTQNVYKVS--LRENVPPGTSMLQVTAIDQDEGANAEITYSFK---TL-LSYVSVSAQSGVVFAQRAFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDTVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEVRTARALGDKDAARHRLLVAVRDGGKPPLSATATLLLVFAD 810          

HSP 3 Score: 132.494 bits (332), Expect = 1.234e-27
Identity = 127/462 (27.49%), Postives = 206/462 (44.59%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD----NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMS---KKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNT----GSLNWEISENNIKFSY-INQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILD 1823
             L  V D+NDN P+      V  + EN  P  + +L +  D+D G+  ++   +  N      F ++  +      Y+L ++   DRE +  Y   L AKD        EA +++ V   D+ND+ P F  +S       I EN   G  I      D D   N  + YSL  ED  +   L  Y+S     G L+  ++ D E  +  ++ ++A D G P    + +I I++ D NDN P F   TQN+    S+ EN    T++  +  ID+D+G N++IT      SF   L    +   +      R A D E+     + L+  D G   L ++V++ + V D+NDN P V        GS  ++      +  Y + +V A D D   N  L Y + ++    +  FS+   TG V++      +    ++ +V +RD GKP LS +AT+ +   D
Sbjct:  374 MLITVVDVNDNAPEITITSSVNSLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNNLP----FKLEKTYG---NYYKLITNSELDREQIQSYNVTLTAKDQGSPPLYTEAHLLLNV--ADDNDNPPVFSQSSYSAY---IPENNPRGASIFSVTAVDLDSKENAHVTYSLM-EDTIQGVPLSSYVSINSDTGILYSLQSFDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDANDNPPVF---TQNVY-KVSLRENVPPGTSMLQVTAIDQDEGANAEITY-----SFKTLLSYVSVSAQSGVVFAQR-AFDHEQLRAFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDTVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGL--FSLGLRTGEVRTARALGDKDAARHRLLVAVRDGGKPPLSATATLLLVFAD 810          

HSP 4 Score: 104.76 bits (260), Expect = 5.507e-19
Identity = 129/557 (23.16%), Postives = 227/557 (40.75%), Query Frame = 3
Query: 1023 KKGSLFVSENIDREIREFYEITIS---ASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSF---------------------------------------SKYLKLEKIEIFNIFKIQTRLA--------------IDREKDGQLLMVLKCCDSGLDPLM-SSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQEN---------TDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVET 2495
            + GSL  +  +DRE  E  E   S   + +  +   +    + +EI+DVNDN P F  +   I     V E++   +        D D G NS  +  +  NS+                                       +  L+  ++   + F +Q R                +DREK     ++L   D G DP+   ++ I   V+D ND+IP        ++  + EN    + +  V ATD D   NG + Y     ++ +   F ++S+TG V  +   D E    Y+  +  +D G   L T+A + +T++D NDN P     + +  +++EN+ P   +  L  +DRD G NG+VS  +  N          +Y+ L  N ++      DRE    + + + AKD G  P  +  ++++ V D NDN P  +F   +    +  +   G  + + +TAVD D  +N  + +   E  +    +         + S+N D G +  + S      +   + + A D G P L+ T +I+I + + 
Sbjct:   68 RGGSLVTAGRVDRE--ELCETVSSCFLSMEILVEDTLKIYGVEVEIIDVNDNAPTFREEEVEI----KVSEHATPGSRFPLPNARDPDVGANSLQSYQLSPNSYRNPRRQLGHRGQGRPGGALEHATPGSRFPLPNARDPDVGANSLQSYQLSPNSYFSLQVRGGADGVKNPELVLEGGLDREKAAAHHLLLTAADGG-DPIRKGTIPIRAVVLDVNDHIPKFTQPVYQVS--VPENLSSGTRVLVVNATDPDEGTNGEVMYSFRNMESKASEIFQMNSKTGEVLVQGPLDFEKYKFYEMEIQGQDGG--GLLTTAKMLITVVDVNDNAPEITITSSVN-SLLENSPPGSVIALLNVRDRDSGENGQVSCFIPNNLPFKLEKTYGNYYKLITNSEL------DREQIQSYNVTLTAKDQGSPPLYTEAHLLLNVADDNDNPP--VFSQSSYSAYIPENNPRGASIFS-VTAVDLDSKENAHVTYSLMEDTIQGVPL-------SSYVSINSDTGILYSLQSFDYEQFQNLQLRVAALDGGDPVLTGTAQIKIKVTDA 596          
BLAST of Protocadherin vs. TrEMBL
Match: A0A3P9JRD1 (Protocadherin 2 alpha a 15 OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 6.827e-77
Identity = 251/833 (30.13%), Postives = 400/833 (48.02%), Query Frame = 3
Query:  138 YQFLYYLQ---PIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHIS--FDRESVNEYMFYLIAKDVD--DNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNG-IPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENS-FSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQF-SIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF---TANPLYLTIIE---NTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL----AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKN---------LQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKI--SASNDHD 2543
            + F   LQ    I EE  +GT VGN    I ++  +DK  L    + +   SSI  L + N+ +G L  +  +D + +CE    C  N K+       I  +        I++L       D+ND+ P F ++   L+I E+ LP     L  A D D  Q S  +Y+L  N D  RL     +    E +   F  +    DRE+V ++   L A D         I + + +LD ND+ P F  ++ ++    + EN   GT ++  N TD DEG NGEIVYS   E     K L    S+ G + V   ID E  + +EI + A+D G +P  +  I + I+++D+NDN P   + + +     SV E+ +I+T +G I V D D G N K++C I +++ FS Y  L+     N++ I T   +DRE      + +   D+G+  L S  TIT+ V D NDN P  +   G   + I ENN   + +  V+ATD D  DN R+ Y + ++    +  F +IDSETG + +   FD E  + ++F V   D G P LS++ TV V ILD+NDN P+     ++N     + E   N N  + +  +   D D G NG +   LQ+ TD+ S     +E+G++   +  D E+   F+  ++A D G  P SS++ V + + D NDN+P  ++P  +         +  NV+        L+TK+ A D D G NG +LF   ++  HS             F++++  G+I  + S       +  ++I  KD G   LS+T  + + +VE K +  ++ +  +A+ D D
Sbjct:   18 FNFCVVLQIRYSISEEVNEGTVVGN----IAKDLGIDKNELKARGYRII-DSSIEPLFRFNEDNGFLYVRRNVDREEICERSSACVINLKTVLQKPLEIHYV-------GIEVL-------DVNDHSPSFSEREKRLEIFESALPGARFQLQPARDADGLQFSIQQYKLSQN-DLFRL----EVEERGEDRKTPFLVLQKKLDRETVGKHKLLLTAIDGGRPAKSGTIELLIEVLDVNDNSPVFTQDAYRVT---LNENVPPGTVVVQINATDLDEGANGEIVYSFGKEVDVSLKKLFSIDSQTGEIKVIGEIDYEQTKNFEIDVRATDKGPVPLFVDKI-VTIKVVDLNDNIPKIEVTSFS----ESVPEDCKIETTVGLISVSDLDSGSNGKVSCFIPDDAPFSIYPSLQN----NMYAIVTTSPLDRETKSLYALTVIAKDAGVPSLSSQKTITVVVSDVNDNKP--EFPVGPQTFYIIENNKIDAPLFSVRATDNDEGDNARILYNLEKNKDKGIVLFLNIDSETGAISTLKSFDFESVETFQFHVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKIRAYDADIGYNGWLLFSLQQVTDHTSFLSINSESGEVVALKSFDFESVKTFQFHVVATDSGSPPLSSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVN-----AGHLVTKVRAYDADIGYNGWLLFSLQQVTDHS------------LFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGNVSLSATATVIVKLVEPKEAFAASDVQSAAAEDED 795          
BLAST of Protocadherin vs. TrEMBL
Match: L8HNP4 (Protocadherin gamma-C3 (Fragment) OS=Bos mutus OX=72004 GN=M91_17250 PE=4 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.236e-76
Identity = 236/821 (28.75%), Postives = 375/821 (45.68%), Query Frame = 3
Query:  108 ILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEEN---SFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDT---LSMSQFSIDSETGVVK-----SKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQE-------NTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQ--MNVSFDYTVGKK-LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEI-TLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +LLLL  +           I EE+ +G  VGNV    + +  LD   L      +   +S  R  ++N  +G +    R+D + LC ++  C          T ++EL+V+    + +++ +   +++DINDN P F  +   L+I E   P     L SA D D G  S   Y L  N+     F+++     +  KY EL    + DRE   +    L A D       A + I++ +LD ND+ P F+     + + ++ E+   GT ++    TD DEG NGEI+YS  + +R   + L       G L V   +D E  + +EI I A D G   + +  K+ +E++DVNDN P+  + +     +  V E++ + T I  + V D D G N  +TC +      S +  LK       N F ++T  A+DRE   +  + +   D+G   L +  T+ + V D NDN P   ++  S N  + ENN+    I  +   D D   N RL +F+ E      L    F+I+ ++GVV      +    DRE +  Y  +V   D G P LST  T+ + I D NDN P FF  +   + + EN  P   L  L   D D G+N  +S  L E        + + SL  + G +   R  D E     + ++ A+D G  P SS++ V + V D+NDN+P  + P          +   +VG   L+TK+TAVD D G N  + +   E                  F+V++  GE+ T +     L  +K +I++  KD G PPLS++V + +S+ E
Sbjct:    1 VLLLLGALHKASAAVIRYEILEEREKGFVVGNV----VRDLDLDLGSLSARRLRVVSGAS-RRFFEVNWETGEMFVNDRLDREELCGTLPSC----------TITLELVVE----RPLELFSAEVVIQDINDNNPSFPTREMKLEISEAVAPGTRFPLESAHDPDVGSNSLQTYELSRNE----YFALRVQTREDSTKYAELVLERALDREREPDLQLVLTALDGGTPARSASLPIRIVVLDANDNAPTFN---QSLYRARVLEDAPPGTRVVQVRATDLDEGPNGEIIYSFGSHNRAGVRELFSLDLVTGVLTVKGRLDFEDAKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTSV----YSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEVPPGLPFSLTSSLK-------NYFTLKTSAALDRETVPEYNLSITARDAGTPSLSALTTVRVQVSDINDNPP--QSSQSSYNVYVEENNLPGVPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDSGVVNQFSLVTAGPLDREAKSSYDIMVTASDAGSPPLSTHRTIFLNISDVNDNPPSFFQRS-HEVFVPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLE------------APDPSLFAVSRYAGEVRTAVPIPADLPPQKLVIVV--KDSGSPPLSTSVTLLVSLEE 767          

HSP 2 Score: 167.548 bits (423), Expect = 8.699e-39
Identity = 159/590 (26.95%), Postives = 263/590 (44.58%), Query Frame = 3
Query:  468 LNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK----GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENS-----FSKYLKLEK-IEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINES---DTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPP-----YALIHLTCKDRDEGINGKVSMILQENTD--YFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPD 2168
            L    +V D NDN P F    +  ++ E+  P        A D D G   ++ Y   G+ ++     ++ +F L+     L      D E    +  Y+ AKD   N   A   + V ++D ND+ P+  V S       + E+  +GT I L +VTD D G NG +   +          LPF ++       +L  S  +DRE    Y ++I+A D G P+  +   + +++ D+NDN P     +Q+  N Y VEEN+     I  + V D D   N++++  + E         +Y  + +   + N F + T   +DRE      +++   D+G  PL +  TI +++ D NDN P     +  +   + ENN     +  + A+D D   N  + Y + E    D  + S  S++ +TG V +   FD E     +F V  RD G P LS++ TV + +LD NDN P          ++     PP     + +  +T  D D G N  VS  L E  D   F+++   G++    PI  +   + KL I+ KD G  P S+S+ +++ +++  D  P  + PD
Sbjct:  211 LPIRIVVLDANDNAPTFNQSLYRARVLEDAPPGTRVVQVRATDLDEGPNGEIIYSF-GSHNRA---GVRELFSLDLVTGVLTVKGRLDFEDAKLHEIYIQAKDKGANPEGAHCKVLVEVVDVNDNAPEITVTS---VYSPVPEDAPLGTVIALLSVTDLDAGENGLVTCEV-------PPGLPFSLTSSLKNYFTLKTSAALDRETVPEYNLSITARDAGTPSLSALTTVRVQVSDINDNPPQ---SSQSSYNVY-VEENNLPGVPILNLSVWDPDAPQNARLSFFLLEQGAETGLVGRYFTINRDSGVVNQFSLVTAGPLDREAKSSYDIMVTASDAGSPPLSTHRTIFLNISDVNDNPPSFFQRSHEVF--VPENNRPGDLLCSLAASDPDSGLNALISYSLLEPRNRDVSASSFISLNPQTGAVHATRSFDYEQTQTLQFEVQARDRGNPPLSSTVTVRLFVLDLNDNAPAVLRPRARPGSLCPQALPPSVGAGHLVTKVTAVDLDSGYNAWVSYQLLEAPDPSLFAVSRYAGEVRTAVPIPADLPPQ-KLVIVVKDSGSPPLSTSVTLLVSLEE--DTHP--VVPD 775          
BLAST of Protocadherin vs. TrEMBL
Match: A0A401PCT7 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0001407 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 5.521e-76
Identity = 228/774 (29.46%), Postives = 367/774 (47.42%), Query Frame = 3
Query:  165 IKEEQPQGTFVGN-VKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKT-RIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSI-NVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            ++EE P    V N V++  L   A     L   +F+L  K+    LL++   SG L T   RID + LC ++         +  + C  E+ V V  ++  +++   FL+ED+NDN P F      + I EN       S+PSA D D G      Y L   +    +F +  I      K+ +L    + DRE  + Y+  +  +D  V    +  ++++ + D ND+ P F      +    I EN  +GT +I  + TDAD G N  + +S +N+    ++ L    +  G + V + +DRE    +++TI ASD    +  S   + I I DVNDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC  + +   +   + + +    F ++T   +D E   +  + +   D+G  PL  S T+ I + D+NDN P+   N   +   I ENN   + + ++ ATD D   N  + Y +  +   + S FS+D  TG++ +    DRE QD Y F V  RD G+PS+ ++ATV VT+LD+NDN P  FT +     + EN  P Y  + L T  D D G N  VS+ +  +  YF +   +G I      DRE  S +  +++A D G RPQ SS+  V I V D+NDNSP F++P  N    +         ++ K+ A+D D G N  + +     ++  N        S+  F+++   G ITL   +         +++   DLG P
Sbjct:   41 LREELPDNVLVANLVRDLNLTAAAAAGLPL---TFKLVSKTGDAPLLRVEGGSGELYTTPHRIDREKLCANV---------YGDSRCFYEVEVAVLPNEVFQLVKVRFLIEDVNDNAPLFPSAVINISIPENTAVNSRYSIPSALDPDVGTNGIQHYELLKGQS---VFGLDIIETPEGDKWPQLIVQQNLDREQKDTYVMKIKVEDGGVPPRSSTAILQITVTDVNDNRPVFKEGEVDVH---IPENAPVGTSVIQLHATDADLGSNAVVRFSFSNQVSALARRLFAVDAATGLITVRQPLDREEFPVHKLTILASDGS--STPSRAVVTINITDVNDNVP--TIDTRYIINPVNGTVLLSENAPLNTKIALITVTDEDADLNGKVTCFTDHDVPYRLKPVFESQ----FLLETAALLDYESTKEYTIKIVASDAGKPPLNQSATVVIKLKDENDNAPVF--NQPVIGLSIPENNTPGTQLTKISATDADSGKNAEITYLLGPN---APSIFSVDRRTGILSAMRRLDREKQDRYVFTVLARDGGRPSIQSNATVVVTVLDQNDNSPS-FTHSEYNFYVPENL-PMYGTVGLITVTDADAGGNAAVSLSILNDKGYFIIDPISGVIKPNITFDREQQSSYTFQVMAVDGG-RPQRSSVARVTINVVDVNDNSPVFVYPPSNFSYELVSTSANPGSVVGKVFAIDNDTGMNAELRYS----IVSGN--------SRGLFAIDPMTGNITLQEKVAKADHGLYRLVVKVIDLGQP 768          

HSP 2 Score: 159.458 bits (402), Expect = 7.447e-36
Identity = 149/536 (27.80%), Postives = 246/536 (45.90%), Query Frame = 3
Query:  942 EGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLA---IDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF---FTANPLYLTIIENTNPPY----ALIHLTCKDRDEGINGKVSMILQENTDY-----FS---LAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            EG +GE+  + +  DR K               +  N+  + R FYE+ ++   N +      +K+   I DVNDN P F     NI    S+ EN+ +++       +D D G N     H E         L+ IE     K    +    +DRE+    +M +K  D G+ P  S+  + I V D NDN P+     G ++  I EN    + + Q+ ATD D+  N  + + F N+   L+   F++D+ TG++  +   DRE   ++K  +   D    S  + A VT+ I D NDN P     +  NP+  T++ + N P     ALI +T  D D  +NGKV+     +  Y     F    L E   +     +D E+  E+ +KI+A D G  P + S  VVI++KD NDN+P F  P   + +++  + T G +L TKI+A D D G+N  I +     +L  N        +   FSV++  G ++ +  L    + + +  + A+D G P + S   + +++++
Sbjct:   87 EGGSGELYTTPHRIDREK---------------LCANVYGDSRCFYEVEVAVLPNEV---FQLVKVRFLIEDVNDNAPLFPSAVINI----SIPENTAVNSRYSIPSALDPDVGTNG--IQHYELLKGQSVFGLDIIETPEGDKWPQLIVQQNLDREQKDTYVMKIKVEDGGVPPRSSTAILQITVTDVNDNRPVF--KEGEVDVHIPENAPVGTSVIQLHATDADLGSNAVVRFSFSNQVSALARRLFAVDAATGLITVRQPLDREEFPVHKLTILASDGS--STPSRAVVTINITDVNDNVPTIDTRYIINPVNGTVLLSENAPLNTKIALITVT--DEDADLNGKVTCFTDHDVPYRLKPVFESQFLLETAAL-----LDYESTKEYTIKIVASDAGKPPLNQSATVVIKLKDENDNAPVFNQP--VIGLSIPENNTPGTQL-TKISATDADSGKNAEITY-----LLGPN--------APSIFSVDRRTGILSAMRRLDREKQDRYVFTVLARDGGRPSIQSNATVVVTVLD 571          

HSP 3 Score: 132.88 bits (333), Expect = 1.150e-27
Identity = 131/465 (28.17%), Postives = 212/465 (45.59%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKF-------HVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVD----DNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWE-ISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKP-SLSTSATVTVTILDENDNF 1838
            + D+NDNVP  + ++        VL      L  KI +L +  D+D    + L  ++    D    + +K +F   E ++ L +    D ES  EY   ++A D      +  A ++IK++  DEND+ P F+     +    I EN   GT++   + TDAD G N EI Y L     +      F + ++ G L     +DRE ++ Y  T+ A D G P+  S+  + + +LD NDN P F   T +  N Y V EN  +   +G I V D D G N+ ++  I  +    Y  ++ I       I+  +  DRE+       +   D G     S   +TI+VVD NDN P+      + ++E +S +    S + +V A D D   N  L Y I   ++  +  F+ID  TG +  +    +    LY+ +V + D G+P SL   A V + + +  +NF
Sbjct:  354 ITDVNDNVPTIDTRYIINPVNGTVLLSENAPLNTKI-ALITVTDED----ADLNGKVTCFTDHDVPYRLKPVF---ESQFLLETAALLDYESTKEYTIKIVASDAGKPPLNQSATVVIKLK--DENDNAPVFN---QPVIGLSIPENNTPGTQLTKISATDADSGKNAEITYLLGPNAPSI-----FSVDRRTGILSAMRRLDREKQDRYVFTVLARDGGRPSIQSNATVVVTVLDQNDNSPSF---THSEYNFY-VPENLPMYGTVGLITVTDADAGGNAAVSLSILNDK--GYFIIDPISGV----IKPNITFDREQQSSYTFQVMAVDGGRPQRSSVARVTINVVDVNDNSPVFVYPPSNFSYELVSTSANPGSVVGKVFAIDNDTGMNAELRYSIVSGNSRGL--FAIDPMTGNITLQEKVAKADHGLYRLVVKVIDLGQPESLHAMALVHLFLNETINNF 788          
BLAST of Protocadherin vs. TrEMBL
Match: A0A401S1S5 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0002728 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 8.249e-76
Identity = 229/774 (29.59%), Postives = 368/774 (47.55%), Query Frame = 3
Query:  165 IKEEQPQGTFVGN-VKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKT-RIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSI-NVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            ++EE P    V N V++  L   A     L   +F+L  K+    LL++   SG L T   RID + LC        N+ S +++ C  E+ V V  ++  +++   FL+ED+NDN P F      + I EN       S+PSA D D G      Y L   +    +F +  I      K+ +L    S DRE  + Y+  +  +D       +  ++++ + D ND+ P F      +    I E+  +GT ++  + TDAD G N  + +S +N+    ++ L       G + V + +DRE    +++T+ ASD    +  S   + I I DVNDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC  + +   +   + + +    F ++T   +D E   +  + +   D+G  PL  S T+ I + D+NDN P+   N   +   I ENN   + + ++ ATD D   N  + Y +  +   + S FS+D  TG++ +    DRE QD Y F V  RD GKPS+ ++ATV VT+LD+NDN P  FT +     + EN  P Y  + L T  D D G N  VS+ +  +  YF +  N G I      DRE  S +  +++A D G RPQ SS+  V I V D+NDNSP F++P  N    +     +   ++ K+ A+D D G N  + +     ++  N        S+  F+++   G ITL   +         +++   DLG P
Sbjct:   90 LREELPDNVLVANLVRDLNLTAAAAAGLPL---TFKLVSKTGDAPLLRVEGSSGELYTTAHRIDRERLCA-------NTFS-DSSRCFYEVEVAVLPNEVFQLVKMRFLIEDVNDNAPLFPSAVINISIPENTAVNSRYSVPSALDPDAGINGIQHYELLKGQS---VFGLDIIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGQPPRSSTAILQITVTDVNDNRPVFKEGETNVH---IPEDAPVGTSVVQLHATDADLGSNAVVSFSFSNQVSALARRLFAVNPSTGLITVRQPLDREEFPVHKLTVLASDGS--STPSRAVVTINITDVNDNVP--TIDTRYIINPVNGTVLLSENAPLNTKIALITVTDEDADLNGKVTCFTDHDVPYRLKPVFESQ----FLLETAALLDYETTKEYTIKIVASDAGKPPLNQSATVVIKLKDENDNAPVF--NQPVIGLSIPENNTPGTQLTKISATDADSGKNAEITYLLGPN---APSIFSVDRRTGILSAMRRLDRERQDRYVFTVLARDGGKPSIQSNATVVVTVLDQNDNSPS-FTHSEYNFYVPENL-PMYGTVGLITVTDADAGGNAAVSLSILNDKGYFIIDPNSGVIKPNITFDREQQSSYTFQVMAVDGG-RPQRSSVARVTINVVDVNDNSPVFVYPPSNFSYELVSTSAIPGSVVGKVFAIDNDTGMNAELRYS----IVSGN--------SRGLFAIDPMTGNITLQEKVTTADHGLYRLVVKVIDLGQP 818          

HSP 2 Score: 157.532 bits (397), Expect = 2.618e-35
Identity = 147/526 (27.95%), Postives = 240/526 (45.63%), Query Frame = 3
Query: 1029 GSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQT-----------RLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF---FTANPLYLTIIENTNPPY----ALIHLTCKDRDEGINGKVSMILQENTDY-----FS---LAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            G L+ + + IDRE           R FYE+ ++   N +      +K+   I DVNDN P F     NI    S+ EN+ +++       +D D G N              Y  L+   +F +  I+T           + ++DRE+    +M +K  D G  P  S+  + I V D NDN P+     G  N  I E+    + + Q+ ATD D+  N  + + F N+   L+   F+++  TG++  +   DRE   ++K  V   D    S  + A VT+ I D NDN P     +  NP+  T++ + N P     ALI +T  D D  +NGKV+     +  Y     F    L E   +     +D ET  E+ +KI+A D G  P + S  VVI++KD NDN+P F  P   + +++  + T G +L TKI+A D D G+N  I +     +L  N        +   FSV++  G ++ +  L    + + +  + A+D G P + S   + +++++
Sbjct:  140 GELYTTAHRIDRERLCANTFSDSSRCFYEVEVAVLPNEV---FQLVKMRFLIEDVNDNAPLFPSAVINI----SIPENTAVNSRYSVPSALDPDAGING----------IQHYELLKGQSVFGLDIIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGQPPRSSTAILQITVTDVNDNRPVF--KEGETNVHIPEDAPVGTSVVQLHATDADLGSNAVVSFSFSNQVSALARRLFAVNPSTGLITVRQPLDREEFPVHKLTVLASDGS--STPSRAVVTINITDVNDNVPTIDTRYIINPVNGTVLLSENAPLNTKIALITVT--DEDADLNGKVTCFTDHDVPYRLKPVFESQFLLETAAL-----LDYETTKEYTIKIVASDAGKPPLNQSATVVIKLKDENDNAPVFNQP--VIGLSIPENNTPGTQL-TKISATDADSGKNAEITY-----LLGPN--------APSIFSVDRRTGILSAMRRLDRERQDRYVFTVLARDGGKPSIQSNATVVVTVLD 621          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 256.914 bits (655), Expect = 5.621e-71
Identity = 225/795 (28.30%), Postives = 366/795 (46.04%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVK---NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            V  L L   +  + +Y   PI+EE  +   +GN+    N    N A   +  +N  + L  K+  N LL++   +G +  T  RID + LC           S+  + CS E+ V +  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D    +  +  +++V + D ND+ P F  +  ++    I E+  +GT ++    TDAD G N EI Y    +    ++ L    S  G + V   +DRE    +++++ ASD    +  +++ I++   DVNDN P+    +I+   N      + E   ++T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   + +  +   DSG   L  +  + + + D+NDN PI       L   +SENN +  Y+  + ATD D   N  + Y +  +     S F +D +TGV+ +  VFDRE Q+ + F V  RD+G  +L + A V VTILD+NDN P  FT N     + EN  P Y+ +  +T  D D G N  VS+ IL +N ++      G I      DRE  S +   + A D G  P SS+  V I V D+NDN P  I+P  N    +     +   ++ ++ AVD D G N  + +     +++ N        +K  F ++   G ITL             +++   DLGYP
Sbjct:   13 VACLWLDPAIAQELIY---PIREELQENVLIGNIPKDLNISHMNTATGAS--NNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPG--------PSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVH---IPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINV--TDVNDNAPNIDLRYIISPTN--GTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELT--VSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKY----TIVNGN--------NKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 256.529 bits (654), Expect = 1.154e-70
Identity = 225/795 (28.30%), Postives = 366/795 (46.04%), Query Frame = 3
Query:  105 VILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVK---NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPD----FILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            V  L L   +  + +Y   PI+EE  +   +GN+    N    N A   +  +N  + L  K+  N LL++   +G +  T  RID + LC           S+  + CS E+ V +  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D    +  +  +++V + D ND+ P F  +  ++    I E+  +GT ++    TDAD G N EI Y    +    ++ L    S  G + V   +DRE    +++++ ASD    +  +++ I++   DVNDN P+    +I+   N      + E   ++T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   + +  +   DSG   L  +  + + + D+NDN PI       L   +SENN +  Y+  + ATD D   N  + Y +  +     S F +D +TGV+ +  VFDRE Q+ + F V  RD+G  +L + A V VTILD+NDN P  FT N     + EN  P Y+ +  +T  D D G N  VS+ IL +N ++      G I      DRE  S +   + A D G  P SS+  V I V D+NDN P  I+P  N    +     +   ++ ++ AVD D G N  + +     +++ N        +K  F ++   G ITL             +++   DLGYP
Sbjct:   13 VACLWLDPAIAQELIY---PIREELQENVLIGNIPKDLNISHMNTATGAS--NNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPG--------PSYEDSECSFEIEVVILPNDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVH---IPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINV--TDVNDNAPNIDLRYIISPTN--GTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELT--VSENNKRDLYLTTITATDEDSGRNAEIVYQLGPN----ASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPK-FTHNHFQFFVSENL-PKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKY----TIVNGN--------NKGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP 760          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 245.358 bits (625), Expect = 8.320e-67
Identity = 217/779 (27.86%), Postives = 365/779 (46.85%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSS--FELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASD-NGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL----INSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN++  +  N  LD     +S+  F+   K+    L+++   +G +  T  RID + LC  +    +N K      C  E+ V V   +  +++   FL+EDINDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    + DRE+ + ++  +  +D  +    +  +++V + D ND+ P F  +  ++    + EN  +GT +   + TDAD G N +I +S +N+    +K      S  G + V + +DRE    +++ + ASD +  P++ + I   + + DVNDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC+ + +     +      +FN  F ++T   +D E   +  + +   DSG  PL +S  + I + D+NDN P+       +   I ENN   + + ++ ATD D   N  + Y +      +   F+ID  +G++      DRE Q+ Y F V  RD+G   L ++ TV + + D+NDN P F  A   Y   +    P Y  + L T  D D G N  V++ +    D F +  + G I      DRE  S +   + A D GL   +S   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +    ++  S          +  F+++K  G ITL     N+ Q L R    +++  KDLG P
Sbjct:   70 VKEEQPENVRIGNLRTDLDLN--LDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGV----FNEKR-----CFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIET--PEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN---VPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVI---VNVTDVNDNVPS--IDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQ--PEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD---APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAE--YNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQY---SIIGGS---------PRGLFAIDKTTGNITLQEKIANADQGLHR----LVVKVKDLGQP 799          

HSP 2 Score: 160.614 bits (405), Expect = 1.155e-39
Identity = 168/592 (28.38%), Postives = 263/592 (44.43%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIG-SLPSAFDKDFGQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVN--SNKIQ-KFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK----KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVG 2210
            V D+NDN P F+D    + + EN  PM    +   A D D G  +++ +      +    R F+I S   L   K  L      DRES   +   ++A D     ++  + V + D ND+VP        N +     + EN  + T+I L  VTD D  +NG++    +++       +PF +      +  L  +  +D E    Y I I ASD+G P   +S  + I+I D NDN P F      +    S+ EN++  T +  I   D D G N+ I   +  ++   +    +  I ++ K      +DREK  +    +   D+G +PL S+VT+ + V D+NDN P         N+ + EN   +  +  +  TD D  DN  +    IN  D      F ID +TGV+K  I FDRE Q  Y F+V   D G    ++ A VT+ ++D NDN P+F   ++N  Y  +   TNP   +  +   D D G+N ++  S+I       F++ +  G I+L+  I        +L +  KD G      SI +V + V D   N+ TF+       M    D  VG
Sbjct:  279 VSDVNDNRPVFKDSEVEVNVPENA-PMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPL------DRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-------VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQL----SIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSK-----RLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAF--THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKD-----NFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNA-TFLQEQVRKSMETPLDKNVG 839          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 246.128 bits (627), Expect = 1.070e-66
Identity = 217/779 (27.86%), Postives = 365/779 (46.85%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSS--FELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASD-NGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL----INSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN++  +  N  LD     +S+  F+   K+    L+++   +G +  T  RID + LC  +    +N K      C  E+ V V   +  +++   FL+EDINDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    + DRE+ + ++  +  +D  +    +  +++V + D ND+ P F  +  ++    + EN  +GT +   + TDAD G N +I +S +N+    +K      S  G + V + +DRE    +++ + ASD +  P++ + I   + + DVNDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC+ + +     +      +FN  F ++T   +D E   +  + +   DSG  PL +S  + I + D+NDN P+       +   I ENN   + + ++ ATD D   N  + Y +      +   F+ID  +G++      DRE Q+ Y F V  RD+G   L ++ TV + + D+NDN P F  A   Y   +    P Y  + L T  D D G N  V++ +    D F +  + G I      DRE  S +   + A D GL   +S   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +    ++  S          +  F+++K  G ITL     N+ Q L R    +++  KDLG P
Sbjct:   70 VKEEQPENVRIGNLRTDLDLN--LDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGV----FNEKR-----CFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIET--PEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN---VPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVI---VNVTDVNDNVPS--IDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQ--PEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD---APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAE--YNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQY---SIIGGS---------PRGLFAIDKTTGNITLQEKIANADQGLHR----LVVKVKDLGQP 799          

HSP 2 Score: 160.999 bits (406), Expect = 1.038e-39
Identity = 169/596 (28.36%), Postives = 264/596 (44.30%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIG-SLPSAFDKDFGQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKF-------HVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK----KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVG 2210
            V D+NDN P F+D    + + EN  PM    +   A D D G  +++ +      +    R F+I S   L   K  L      DRES   +   ++A D     ++  + V + D ND+VP          VN   +    + EN  + T+I L  VTD D  +NG++    +++       +PF +      +  L  +  +D E    Y I I ASD+G P   +S  + I+I D NDN P F      +    S+ EN++  T +  I   D D G N+ I   +  ++   +    +  I ++ K      +DREK  +    +   D+G +PL S+VT+ + V D+NDN P         N+ + EN   +  +  +  TD D  DN  +    IN  D      F ID +TGV+K  I FDRE Q  Y F+V   D G    ++ A VT+ ++D NDN P+F   ++N  Y  +   TNP   +  +   D D G+N ++  S+I       F++ +  G I+L+  I        +L +  KD G      SI +V + V D   N+ TF+       M    D  VG
Sbjct:  279 VSDVNDNRPVFKDSEVEVNVPEN-APMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPL------DRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVL----LSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-------VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQL----SIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSK-----RLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAF--THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKD-----NFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNA-TFLQEQVRKSMETPLDKNVG 839          
BLAST of Protocadherin vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 244.202 bits (622), Expect = 3.691e-66
Identity = 219/780 (28.08%), Postives = 364/780 (46.67%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSS--FELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASD-NGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL----INSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN++  +  N  LD     +S+  F+   K+    L+++   +G +  T  RID + LC  +    +N K      C  E+ V V   +  +++   FL+EDINDN P F+     + I EN        +PSAFD D G      Y L   K     F +  I      K+ +L    + DRE+ + ++  +  +D  +    +  +++V + D ND+ P F  +  ++    + EN  +GT +   + TDAD G N +I +S +N+    +K      S  G + V + +DRE    +++ + ASD +  P++ + I   + + DVNDN P   + T+ I+N  +    + EN+ ++T I  I V D+D   N K+TC+ + +     +      +FN  F ++T   +D E   +  + +   DSG  PL +S  + I + D+NDN P+       +   I ENN   + + ++ ATD D   N  + Y +      +   F+ID  +G++      DRE Q+ Y F V  RD+G   L ++ TV + + D+NDN P F  A   Y   +    P Y  + L T  D D G N  V++ +    D F +  + G I      DRE  S +   + A D GL   +S   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +    ++  S          +  F+++K  G ITL     N+ Q L R    +++  KDLG P
Sbjct:   30 VKEEQPENVRIGNLRTDLDLN--LDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLCSGV----FNEKR-----CFYEIEVAVLPDEIFRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELV--KVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVN---VPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVI---VNVTDVNDNVPS--IDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQ--PEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPD---APDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAE--YNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQY---SIIGGS---------PRGLFAIDKTTGNITLQEKIANADQGLHR----LVVKVKDLGQP 760          

HSP 2 Score: 160.614 bits (405), Expect = 1.431e-39
Identity = 168/592 (28.38%), Postives = 263/592 (44.43%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIG-SLPSAFDKDFGQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVN--SNKIQ-KFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK----KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVG 2210
            V D+NDN P F+D    + + EN  PM    +   A D D G  +++ +      +    R F+I S   L   K  L      DRES   +   ++A D     ++  + V + D ND+VP        N +     + EN  + T+I L  VTD D  +NG++    +++       +PF +      +  L  +  +D E    Y I I ASD+G P   +S  + I+I D NDN P F      +    S+ EN++  T +  I   D D G N+ I   +  ++   +    +  I ++ K      +DREK  +    +   D+G +PL S+VT+ + V D+NDN P         N+ + EN   +  +  +  TD D  DN  +    IN  D      F ID +TGV+K  I FDRE Q  Y F+V   D G    ++ A VT+ ++D NDN P+F   ++N  Y  +   TNP   +  +   D D G+N ++  S+I       F++ +  G I+L+  I        +L +  KD G      SI +V + V D   N+ TF+       M    D  VG
Sbjct:  240 VSDVNDNRPVFKDSEVEVNVPEN-APMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPL------DRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYTDHD-------VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQL----SIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSK-----RLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAF--THAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKD-----NFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFVNDTVSNA-TFLQEQVRKSMETPLDKNVG 800          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 2.556e-59
Identity = 195/770 (25.32%), Postives = 340/770 (44.16%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL---HGNKDQLRLFSI----------------------KSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFV---SENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF---ILQTQNILN-HYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEIS-------ENNIKFSYINQVKATDIDIQDNGRLHYFINE-SDTLSMSQ-FSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF----TANPLYLTII-ENTNPPYALIHLTCKDRDEGINGKVS--MILQENTDYFSLAENGKISLKRP---IDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLI-TKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLG 2444
            L  +N+ SG L    R+D ++LC    + C ++     +T  +  + +   S N+++L+   LV DIND+ P F      + I E+    +   LP A D D G  S   YR+    G+  QL  FS+                      +++  L E           DRE+V  Y   L  +D  + +    +++ + ++D ND+ P F       +  +I E+ ++GT ++     D D G NG I YS + +  + +     ++     L     +E +DRE    + + + A D G  ++ +S+ + +E+ D NDN P F    LQ + + +    + EN    T +  I V D D G +  +   +E  + ++     K++    F ++T   +D E+  Q  + +   D G   L   + + I VVD NDN P+   N  S+  +++       EN    + +  + ATD D   NG + + ++E +   S+++ FS++  TG +      DRE +  Y+  V   D G P     A V VT+LDENDN P F     + N +Y   + E T+    +  ++  D DEG N +V+  ++ +   D+   A +    + R    +DRE   +++L + A D G    S+S  V I V D NDN+P    P+ N        ++    L+   +TA D D G NG  L+     ++  N         K  F +N D+G ++L  ++  L      +++  +D G
Sbjct:   73 LCIVNELSGELSVALRLDREALCMEEPDACRSTGF--MHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELRE---------QLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFV--DPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ----FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVF-MNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYE----IIGGNP--------KGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRG 812          

HSP 2 Score: 137.117 bits (344), Expect = 3.504e-33
Identity = 160/681 (23.49%), Postives = 282/681 (41.41%), Query Frame = 3
Query:  675 SIFHLNECKYELFSHISFDRESV--------------NEYMFYLIAKDVDDNEAKIM-IKVRILDENDSVPKF---HVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPF--------------------YMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKI--TCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWE--------ISENNIKFSYINQVKATDIDIQDNG----RLHYFIN-ESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYL---------TIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAE-------NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNL----QMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVET 2495
            S+  +NE   EL   +  DRE++              +      +AK    +  +++ +++ + D ND  P F   H+N        I E+  +G  + L    D D G N    Y ++       ++ PF                     M  +  L + E +DRE    YE+ +   D G P    S+ + I ++D NDN P F+      +    + E+S++ T++  +   D D G N  I  + H +  S +    L       +  ++    +DRE      +V+   D G     +SVT+T+++ D NDN P+ +    +L  E        I EN    + +  +  +D D+  +G    RL +    E  + +  QF       ++K+  + D E    Y   V   D G P LS    + ++++D NDN P+F   NP  +         ++ EN      +++L   D D G NG ++  L E     S+AE        G+++L  P+DRE    ++L + A D G  PQ  +  +V + V D NDN+PTF+    +     Q  V  + +VG  + T ++  D D G N  +  +     L     P+ +  +      +   G +  +  L    R +  + + A D G P LS++ ++ I++ +T
Sbjct:   72 SLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLN------VSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVR---ITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVI--ALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQF-------LLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFM--NPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGG-SPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGT-VSTSDLDEGDNARVALN-----LVREAGPDWIGGAG-----DTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDT 720          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 219.55 bits (558), Expect = 2.633e-59
Identity = 215/782 (27.49%), Postives = 349/782 (44.63%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVK-NFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTR-IDIDSLCESIKECCYNSKSHNTNTCSIEL---IVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYE-LFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKS-----KILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKP-----DFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLG 2444
            + EE  +G F+GN   +  L +  L+ TY    S     + +   L+++N  +G L    R +D ++LC               + C +++   ++ V      K++     VEDINDN P F      + + EN    K   +  A D D        Y L   +   +  F +      N  K   L    S DRE    Y   L A D     +    ++++ + D ND+ P F      ++   I EN  +GT ++  + +D D G N E+VY L             K L       G + V+  ++RE    Y I I A+D G     ++  + + + DVNDN P     D +     ++    + E S ++  +  I V D D G N  +TC+I         +L+K+   N + ++TR  +D E   + ++ +K  D+G   L  ++++TI ++D NDN P+    T  ++  + ENN+   ++  V ATD D+  N  + YF+   D  +M  F +D ETG++      DRE +  Y F +  +D G P L  +ATV V +LD NDN P F  A      + EN      +  +T  D DEG NG+V  S++  +N   FS+  E+G I      DRE    + L++ A D G   +SS++ VVI V DINDNSP  + P  N         T+   ++T+++AVD D   N  + +H    ++  N  P +L      F ++   G ITL+  L         +++   D+G
Sbjct:   43 VAEELREGAFIGNPSVDLRLADYNLELTYKVMLSK---AEDAAPPLVRVNPRTGELFAAGRKMDREALC---------GGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVE---IPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVI---YISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVP--FQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVS--VPENNVIGKHLITVSATDRDMDKNAEMVYFLG-PDAPTM--FHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAE-FDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYH----IVGGN--PHNL------FHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 141.354 bits (355), Expect = 1.976e-34
Identity = 149/588 (25.34%), Postives = 265/588 (45.07%), Query Frame = 3
Query:  798 IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGS------LFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFK----IQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTN--TGSLNW-----EISENNIKFSYINQVKATDIDIQDNGRLHYFI-NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSMILQEN--TDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMN--VSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            I +++ + D ND+ P F   +  +    + EN   G    +    D D   NG   Y L   D          +++  +      L V +++DRE R+ YE+ + A D G P    S  + I + D NDN P F     N+     + ENS + T++  +   D+D G N+++   +  ++           +F + +    +     ++RE+     +++   D G +P+ ++ T+T+ V D NDN P ++       +N      E S  N+  + I     +D DI  NG +  +I N      + + +  ++  +++++   D E ++ Y   +   D G  SLS + +VT+ +LD NDN P+F    P Y +++ EN      LI ++  DRD   N ++   L  +  T +    E G ISL   +DRE  + +   I+AKD G+     +  V++ V D+NDN P F   + +  +N  V    TVG      +T  D D G+NG +       +L +        D+++ FS++ ++G I          R   ++ + A D G P  SSTVK+ I +++
Sbjct:  137 IEVRINVEDINDNAPAF---AAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNV----EIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALIT---VSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQY-LLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVF--TEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGM-----VTVADSDEGENGRVRLS----ILGT--------DNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMD 694          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 212.231 bits (539), Expect = 3.493e-56
Identity = 175/598 (29.26%), Postives = 277/598 (46.32%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMK-IGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLD-PLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNG 2264
            V D  D  P F    +   + EN  P   +GS+ SA   D    + + Y L  + DQ   FSI+           +F+  + DRE    Y   ++A        +  + V + D N+  P F   S ++    I E+  + +       TD D G NGE+ Y +   +  +     F +   G L+V   +DRE RE Y +T+SA D G+    SS+ +++ +LDVNDNKP  +  + + + H+  E+  E+ + +G ++  D D G N  +T   E+   +  L  E   I ++        I +         +   D G   PL    T+ + V D NDN P    +       +SE+    + + +V A+D+D   NG L Y INE +     +F++D+ TG +      DRE    Y  +V   D G   L+ S TV V +LDENDN P  FT + L +  +E+T     LI LT  D D G +G V   +     + + A     G + L R +D ET   ++L + A+D G  P+SS+  +V+ V+D NDN P F+  D  +  ++  +  +G ++IT +TA DPD   NG
Sbjct:  648 VADAQDTPPTFARDDYSFVVFENVAPGTLVGSV-SASTLDL--NANVTY-LIVSGDQRGSFSIE------WSGGRIFTANAIDREEQAFYQLRVVANS-GGVAGEASVSVLVHDVNNHAPVFDRASYEVS---IAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK----FGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKP--LFNSSSYVFHFCEEQ--EVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSV--YQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGN--EGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPR-FTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGD--VFASIMENIPIGTRVIT-VTARDPDADVNG 1215          

HSP 2 Score: 196.052 bits (497), Expect = 4.056e-51
Identity = 179/676 (26.48%), Postives = 301/676 (44.53%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD-VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCR---------IGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDP---LMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFI-------NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS--MILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKK-LITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKD 2438
            VED+NDN P F      L++ EN    ++    SA D D GQ + + Y +        L   +  F ++     L +    DRE    Y+  + A D     +A++ + VR  D ND+ P+F   S     F + E+           IGT +      DAD G  GE+ Y+L   + +      F +    G+L V+  +DRE R  Y +   A+D G     ++ ++++ +LD NDN P      QN      V E++   T++  I   D D+G N+++     E S S      +  + N  ++    A+DRE+     +V++  D    P   L S+V +++ + D NDN P   +   +L     E++   + +  V+A D D   N  + Y +                 F++++ TG V+     DRE +  Y   V   D G+P L+++AT+ VT+ D NDN P  F        I E+  P   ++ L+  D DEG NG++   +   + T  F L    G +++ RP+DRE  + ++L + A+D G   +S + +V + + D+ND SP F      +      + T G   LI ++ A D D G +G + +              +  +    FSV+ D G + L+ SL    + + ++II A D
Sbjct: 1506 VEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSV--------LSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVR--DANDNSPRF---SRHAYSFDVAEDAAPDGKTTRAVIGTVL----AGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAP----SVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAEL-----EFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL---APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPR-FPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHAR---ENTQGPPVLILQVVARDDDLGSSGQVTYAA------------AGGNDGGAFSVSPD-GHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 3 Score: 176.792 bits (447), Expect = 4.036e-45
Identity = 169/620 (27.26%), Postives = 289/620 (46.61%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPM--KIGSLPSAFDKDFGQTSKLEYRL-HGNK-DQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDRE--IREF----YEITISASDNGIPTQMS-SIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQEN---TDYFSL-AENGKISLKRPIDRE-THSEFKLKIIAKDHGLRP----QSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILF 2276
            LV D+N++ P F+   + + I E+  P+  +  S+  A DKD G+  +++Y +  GN  ++  +F    ++     +YEL      DRE+  EY   + A D  V+   + + + V +LD ND+ P F+ +S     F   E   +G+ +     TDAD G NG + YS       K ++     S+ G +      DRE  IR+     +  ++ A+D G P  +     + + + DVNDN P F       +   SV E++   T +  +   D D+G N  +   I E +      ++     +  +I    ++DRE+     +V+   DSG  PL +S T+ + V+D+NDN P    +   L+ +  E+      +  + A+D D   +G + Y I   +T   + F+ID  TG V      D E Q LY+  V   D G+P  S++  + V + D NDN P F   + ++ +I+EN      +I +T +D D  +NG++   +        +F++  E+G+I     IDRE T   F++ + A D  + P    +S+  NV + V D NDN+P F+ P   L   V         ++  + A DPD  +N  + +
Sbjct:  747 LVHDVNNHAPVFDRASYEVSIAEDE-PVNSRFFSV-RATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLY----VRYEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSS---YVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFE-----KPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQF----AKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDA----STGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESL--LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNT--HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGD-VFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAI-PVHTRRSALKNVTVLVTDENDNAPRFVTPTAIL---VDGLRAAAGSVVGTLQASDPDEAENAAVRY 1329          

HSP 4 Score: 174.096 bits (440), Expect = 3.339e-44
Identity = 186/681 (27.31%), Postives = 303/681 (44.49%), Query Frame = 3
Query:  492 DINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRIL--DENDSVPKFHVNSNKIQKF-QIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDG--QLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRET------HSEFKLKIIAKDHGL-RPQSSSINVVIEVKDINDNSPTFIFPDKNL-QMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            D+ND  P F    +V    EN LP       SA D D G+   + Y    N D       + +F L+    ++ +  S DRE + EY   + A+D          KV ++  D ND+ P F+     +Q F  I EN   GT +     TD D G NG + Y L   D  + ++     +  G++    ++DRE R  Y++ ++A D G     S   + I + D  D  P F     + +    V EN    T +G++     D   N+ +T  I          +E    ++  +I T  AIDRE+    QL +V    +SG   +    ++++ V D N++ P+ D    S    I+E+    S    V+ATD D   NG + Y I E +     +F I  + G +  +   DRE ++ Y   V   D G   LS+S TV VT+LD NDN P+F +++ ++    E       +  +   D D G NG V+   ++    F L +E G+I+  R  DRE        + F   ++A D G  +P      V + V+D+NDN P F    K++ Q +VS   +   +L+ ++TA D D G NG + +  +E             +    F+V+   G+ITL+ SL         +++ A D G  PL+++  + + +++
Sbjct:  438 DVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRY----NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFY----PVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQV----NAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFV----VFENVAPGTLVGSVSASTLD--LNANVTYLIVSGDQRGSFSIE----WSGGRIFTANAIDREEQAFYQLRVV---ANSGG--VAGEASVSVLVHDVNNHAPVFDR--ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGN--GGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVF-HFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFA---KSVYQASVSESASNLTQLL-RVTASDVDEGVNGALRYAINE------------GNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLD 1069          

HSP 5 Score: 162.54 bits (410), Expect = 1.121e-40
Identity = 163/605 (26.94%), Postives = 268/605 (44.30%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRL-FSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD----NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEG-VNGEIVYSLNNEDRTKSKIL--PFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIK-IHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQE-NTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHG-LRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQN 2261
            V+D NDN P FE   +   + E              D   G  + L   LH  +  L + F  K+          + +    D E+  +Y   L A D  +      A  +I++  +++ND   +F       +   + E+   GT   L  VTDAD    NGE+  S+   +     +L  P     +  L V+  +DRE    Y +TI ASDNG P   S+   + + + DVND+ P F L         ++ E +   + +  +  +D D G N+K+   I   +   +  +++    +   + T   +DRE    +++ +   D G  P  +  ++T+ ++D ND  P+  T T  +   + EN++   ++  V A D D+ +NG + Y F  +        F +DS TG V +    DRE  + Y  +V  +D G P L ++A VTV + D NDN P+F+     + +I+EN     A+  +T  D D G NG V   L   +   F + A  G +S +  +DRE  + ++L++ A D G LR +S +I V I V D  D  PTF   D +    V F+      L+  ++A   D   N
Sbjct:  126 VQDANDNPPAFEKPAYRASVAE--------------DSPVG--AALRDLLHRGRGPLAVPFDPKTGM--------VSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLR-VLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAA----ALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDE----STGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLF-TQTKYVATAV-ENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQ-YFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAI-VTITVADAQDTPPTFARDDYSF---VVFENVAPGTLVGSVSASTLDLNAN 690          

HSP 6 Score: 150.599 bits (379), Expect = 4.913e-37
Identity = 173/707 (24.47%), Postives = 296/707 (41.87%), Query Frame = 3
Query:  438 QVTYSKNIKILNFLFLVEDINDNVPQF-EDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTS--KLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKG-FNSKITCHI----EENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVV--DKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSM-----ILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVS-FDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETK 2498
            Q TY   ++++     V D+NDN P F E     +   E+    +   L +A D+D G        Y++    ++ RL   + +         L +    DRE+   Y   + A+D        ++ + V + D ND+ P F        +  + E+  +G  +              ++++      R +  +   +  K G +   + +D E R  Y +++ A+D G P         I++LDVNDN P    +         SV+E++   T    + V D D    N +++  I    E   F   L    +    + K+ ++L  DRE+     + +   D+G  P+  S T ++ V   D ND+ P    +       +SE     SY+  V A D D   N +L Y I   + L    FS+D  TG+V +    DRE+       +  +D G    +   ++TVT+LD ND  P+ FT      T +EN+ P   ++ ++  D D G NG V       +  +  + F L +  GK++  + +DRE   E+ L + A+D G  P  S+  V + V D+NDN P F +P   +Q   S  +   G   +T +TA DPD G NG + +              +  D+ + F VN   G ++   SL    R    + + A D G+    S   + I++ + +
Sbjct:    2 QPTYPTEVRVV-----VGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPV--TKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFE---KPAYRASVAEDSPVGAALR-------------DLLH------RGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHF--VLHAPGVPGLRVLKVASQL--DRERIPMYNLTILASDNG-KPVARSATASLVVYVNDVNDHAPRFALSA--YAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGW--FSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPL-FTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF-YP---VQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL------------TAGDAAR-FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQ 652          

HSP 7 Score: 148.288 bits (373), Expect = 2.858e-36
Identity = 127/488 (26.02%), Postives = 217/488 (44.47%), Query Frame = 3
Query: 1074 FYEITISASDNG----IPTQMSSI-KIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIK-----FSYINQVKATDIDIQDNGRLHYFI--NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQ---SSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            F  +  S  DNG    I   MSS  ++ I + DVNDN P F +    +     VEEN+     I T+   D D+G N+ +T  +   S   ++         + +   RL  DRE+    L+ ++  D       +   +++ V D NDN P    +  + +++++E+         + I  V A D D    G + Y +  +E    +   F +   TG +      DRE +  Y       D G   L+ +A + V +LD NDN P     + L   + E+  P  +L+ ++  D DEG+N ++  S+   +    F++  +G++S+ R +DRE  S + L +   D    P    SS++ V + + D+NDN+P F  P   L      D  VG  ++  + AVDPD G+N  + +    L     +           F++N   GE+ L+  L    R+   + + A D G PPL+ST  + +++
Sbjct: 1476 FSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMEL----EVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVV---DAASGVLRASRRL--DREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRH--AYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQN-DSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPE---DSPVGA-VVATVQAVDPDSGRNSYVEY---ALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTV 1939          

HSP 8 Score: 121.709 bits (304), Expect = 4.235e-28
Identity = 111/431 (25.75%), Postives = 191/431 (44.32%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLH-GNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDN--EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNI----FKIQTRLAIDREKDGQLLMV-LKCCDSGLDPLMSSVT----ITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRE 1730
             V+D+NDN PQF    +   + E+   +      +A D D G    L Y ++ GN+           F ++    ++    S DRE    Y   + A D   +   A   + V++LDEND+ P+F   +  +      E+ R+G  +I    +D D G +G++ Y++   N   T      F + +  GS+F++  +D E +  Y + +SA D G P + S+  + + + D NDN P F+    ++    S+ EN  I T + T+   D D   N ++        +S   +      F I     +I T   IDRE  G L  V ++  D  + P+ +  +    +T+ V D+NDN P   T T  L   +       S +  ++A+D D  +N  + Y +   D   +  F +D  TG++++    DRE
Sbjct:  961 FVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNE--------GGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHAT------FAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL--PGDVF--ASIMENIPIGTRVITVTARDPDADVNGEL-------HYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAI-PVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGL--RAAAGSVVGTLQASDPDEAENAAVRYAVTGGDAAIL--FRLDRRTGIIETSTELDRE 1358          

HSP 9 Score: 96.2857 bits (238), Expect = 2.366e-20
Identity = 77/326 (23.62%), Postives = 139/326 (42.64%), Query Frame = 3
Query:  480 FLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGN--KDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKS-KILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCD 1442
             ++ D+NDN P F      L   ++ +   + ++  A D D G+ S +EY L  +  +      +    F LN    E+      DRE+   Y   ++A D       +   + V + D ND+ P+F     +  +  I E+   GTE++  +  D DEG NGE+ Y + + D T   ++ P      G+L V+  +DRE    YE+ + A D G P +  +  + + + DVND  P F L    +   ++ E        I  +   D D G + ++T      +      +      ++ +     ++DRE   Q ++++   D
Sbjct: 1824 LILTDVNDNAPAFTSPRSALAPEDSPVGAVVATV-QAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF---PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVL----GTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTV---HARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLR-----SLDREAQPQHVLIITATD 2133          

HSP 10 Score: 82.0333 bits (201), Expect = 5.351e-16
Identity = 88/346 (25.43%), Postives = 149/346 (43.06%), Query Frame = 3
Query:  414 TCSIELIVQVTYSKNIKIL---NFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP---SAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD---NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKS--KILPFYMSKKGSLFVSENIDREIR-EFYEITISASDNGIP--TQMSSIK-IHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDRE 1403
            T S  L+V  T S    +         V D NDN P+F +    +   E+    ++G L    +A D+D G +  + Y +  GN          + F ++     +F     D E+   Y   + A+D      + A I++ V + D ND+ P F           I EN  IGT +I     D D  VNGE+ YS+  +    +   I P    + G +  +  IDRE+    +E+T+ A+D  IP  T+ S++K + + + D NDN P F+  T  +++       S     +GT++  D D+  N+ +   +     +   +L++        I+T   +DRE
Sbjct: 1040 TASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALES---TRVGELLITLTASDEDTGPSGDVRYAIVAGN--------THATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILV-VHVRDFNDNPPAFLPGDVFAS---IMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDP----ESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSV----VGTLQASDPDEAENAAVRYAVTGGDAAILFRLDR----RTGIIETSTELDRE 1358          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 204.912 bits (520), Expect = 7.915e-55
Identity = 175/626 (27.96%), Postives = 284/626 (45.37%), Query Frame = 3
Query:  171 EEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNI-KILNFLFLVEDINDNVPQFEDKFHVLQIHEN-----RLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKY-ELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKP----DFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEIS--ENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMS---QFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPL-----YLTIIENTNPPYALIHLTCKDRDEGINGKVS-MILQEN 1976
            EEQP GT VG + + +    A   +      F L  +   + L+ + +  G +  +  ID +  C                +C I   V  T  + + ++++    + DIND+ P F      ++I E+     R+P++      A D D G  +   Y L    D+   F +      +  KY EL      DRE   EY   L A D  D       ++++ +LD ND+ P F   S  +    + E+   GT ++  N TD DEG NGE+VYS ++    + + L     K G L +   +D E+   YEI+I A D G  +  +  K+ + + D+NDN P    DFI+Q++   +   V E +  ++ +G + V D D   N  + CH+  +   K L        + + + T  ++DRE+     +VL+  D G  P +++   T+ ++D+NDN P    +T    +E S  ENN   +Y+  V A D D + NG + Y + ES+    S     SI+  +G + +    D E      F V  RD G P L T+ATV+V I+DENDN P+  T  PL      + +  +    Y +  +  +D D   NG++S  I+Q N
Sbjct:   37 EEQPAGTLVGRLSDDLQGRVAEHPSR----HFRLMRRDDFS-LVHVEEADGTVSAREVIDREQQC------------GQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLE-----GARDLDVGGNALRAYHL----DENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVT---VREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRG--DTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYR-----DDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRST----YEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPV-VTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGN 621          

HSP 2 Score: 156.377 bits (394), Expect = 3.188e-39
Identity = 146/588 (24.83%), Postives = 256/588 (43.54%), Query Frame = 3
Query:  798 IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFY-MSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNI----FKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIP-----IVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQEN-------TDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPD-KNLQMNVSFDYTVG-KKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEI-----TLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            +  +V +LD ND  P F   +      +I E+  +GT + L    D D G N    Y L+  +R    +      +K   L V   +DRE    Y + ++A D G P +  +  + I +LD NDN P F   + N+    +V E++   T + T+   D D+G N ++       SFS  +  E   +F +     K+  +  +D E + +  + ++  D G   + +   + + V D NDN P      +  + G   + +SE     S++  V  +DID  +NG +   +       +  +  D    VV +    DRE    Y  ++   D G P    +   TV +LDENDN P F  +     +++EN +P   +  +T  D D   NG ++  + E+       + Y S+   +G I   RP+D E  +    ++ A+D G+ P  ++  V + + D NDN+P    P  +N    V      G   L+T + A D D   NG + +     ++  N+        +  F +N+  GE+     ++ ++     R   ++++  +D G P LS+T  IEI +
Sbjct:  120 VHAEVELLDINDHAPDF---ARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNV----TVREDATPGTVLLTLNATDVDEGPNGEVV-----YSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVF-VSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDY---VVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRST-YEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYR----IVQGNE--------RNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMV--RDRGSPALSATAAIEIRV 676          

HSP 3 Score: 127.872 bits (320), Expect = 2.654e-30
Identity = 118/465 (25.38%), Postives = 200/465 (43.01%), Query Frame = 3
Query: 1131 IKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPPY-ALIHL-TCKDRDEGINGKVSMILQENTDYFSLA--ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTF---IFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +   +E+LD+ND+ PDF         H  + E+  + T +      D D G N+    H++EN         + +     ++  +  +DRE++G+  + L   D G  P   +  + I V+D NDN P+      S N  + E+    + +  + ATD+D   NG + Y F +  D      F +D +TG +  K   D EL   Y+  +  RD G  S+     V V + D NDN P   + F       T+  +    Y + + L T  D D   NG V+  L+ +  +  L   ++  +     +DRE  +++ L + A D G  P+ ++    + + D NDN P F    +    L+ N    Y      +T +TA D D   NG+I ++    V+ S     S+     + S+N  +G I  +  L           + A+D G PPL +   + + IV+
Sbjct:  120 VHAEVELLDINDHAPDFARSEM----HVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQT--SCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAY------VTTVTAWDADAEHNGMIAYN----VVESEVAGASVS---TYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVD 565          

HSP 4 Score: 107.071 bits (266), Expect = 7.784e-24
Identity = 99/346 (28.61%), Postives = 165/346 (47.69%), Query Frame = 3
Query: 1326 SKYLKLEKIEIFNIFKIQ-------TRLAIDREKD-GQL------LMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETG----VVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV-----SMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPT----FIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFH 2279
            S++ +L + + F++  ++        R  IDRE+  GQ         VL     GL  L   V   ++++D ND+ P  D     ++ EISE+    + +    A D+D+  N    Y ++E++   ++  +          VVKS++  DRE +  Y   +   D G P  S +  V +T+LD NDN P+F   +   +T+ E+  P   L+ L   D DEG NG+V     S +  E    F L  + GK+SLK  +D E +SE+++ I A+D G     +   V++ V+DINDN+P     FI   +   + VS +    +  +  +T  D D  +NG++  H
Sbjct:   61 SRHFRLMRRDDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQL---VHAEVELLDINDHAP--DFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRL--DREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTS-CNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVS-EGAAYESFVGLVTVSDIDSAENGLVACH 397          
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 189.889 bits (481), Expect = 3.811e-49
Identity = 176/642 (27.41%), Postives = 283/642 (44.08%), Query Frame = 3
Query:  426 ELIVQVTYSKNIKILNFLFL---VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYR-LHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKV--RILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVE--ENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQL---LMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTV------GKKLITKITAVDPDFGQNGVILFHHDE 2288
            EL+V+   S       +L L   V DINDN P+F       ++ EN  P  I  L +A DKD G   +++Y  + GN        I ++F +N    E+ S  + DRE+V  Y   + A D         +KV   + DEND+ P+F     +I    + E+  +G  ++  +  DADEG N  I +SL +        LPF +    G + VS  ++RE R  Y + + ASD   P    S  + I + DVNDN P F  QT      Y +E  E SE +  +  +   D D G N ++   +   + +  +  +  EI ++  ++ R          L     V+   D G  PL S  T+TI++V  N N P       S    ++      + I  + A D D   NG++ Y +   +  +  +F +D+  G +  +     +   ++   V  RD G+P LS+ AT  +++ +EN   P  F   PL L++ EN     +L  +T  D D G+NG +  S+   + +  F ++  +G + L   +D ET   + L + A D G + ++    V I V D+NDN P          +N S  Y V          +  + AVD D   N V ++  D+
Sbjct:  303 ELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVL-TAVDKDSGINGQVDYSIIDGN--------IGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF----TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS------LPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRF-GQTA-----YYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYST--PVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGN--ASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPR-FAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPP---------MLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDD 901          

HSP 2 Score: 184.111 bits (466), Expect = 2.460e-47
Identity = 172/696 (24.71%), Postives = 301/696 (43.25%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGS---LPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEA---KIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNI----FKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF---FTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSF-DYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRR------------KCLIIIYAKDLGYPPLSSTVKIEISIV 2489
            LVED NDN+P+F        + E+     IGS   L +A D D G  + + YRL G             F +N    ++ +  S DRE    Y+  + A D            + V + D ND  P+F +N+  +       +   GT +      DAD G NG++ +SL+        + P    ++G +  +  + +  R+   +T+  SD G P + +   + +   D  +  P F    ++    +S  E+    T I  +      +     ++ H+              ++F +     ++    A+D E      +V++  DSG  P  + + + +DV+D NDN P   +   S  W     N     I  + A D D   NG++ Y I + +  ++  F ++  +G ++S    DRE    Y+  V   D G P+   +  V +++ DENDN P F   F+A+     + E+    + ++ ++  D DEG N  ++  L + +  FS+    G+I++ R ++RE  S + +K+ A D      + S +V I V D+NDN+P F          + F + + G+ L+ +++A D D G NG + F               ++   + F V +D+GE   I+S++PL  R            K   ++ A D G PPLSS   + I+IV
Sbjct:   15 LVEDENDNLPRFGAAELRAAVPED---APIGSDVALVNATDADAGLNAIISYRLRGGDGH---------FSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRF-LNAPYVAYAP--SSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDP----RRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRS----FSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGG-------NLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSS---SRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNV--FRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAH-----VREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAW---TVSTDVTIVVDDVNDNAPRF----GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFF--------------MRSQTENFRVGRDSGE---IHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIV 642          

HSP 3 Score: 176.022 bits (445), Expect = 7.285e-45
Identity = 154/566 (27.21%), Postives = 252/566 (44.52%), Query Frame = 3
Query:  804 IKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNG-IPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIV 2489
            + V + DEND++P+F        +  + E+  IG+++ L N TDAD G+N  I Y L   D   S + P      G +  + ++DRE RE Y + ++A D G  P   SS  + + + DVND+ P F+    N         ++   T +  +   D D G N  +   +  ++ + +    +  +     I    A+   +D  L + ++  D G  P  +  T+T+   D  +         G  ++   E+    + I  V A     +  G + Y +     L    F++D ++G V      D E Q  Y+ +V  RD G P  S    + V +LD NDN P F ++   +  + ENT PP  ++ LT  D+D GING+V  S+I     + F +  N G+I     +DRE  + ++L + A D G   Q  ++ V+I V D NDNSP F    +    +V  D  VG  ++ +++ +D D G N  I F              SL D    FS++   GEIT+   L    R    + + A D  +     TV  +++IV
Sbjct:   12 VTVLVEDENDNLPRFGAAE---LRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGDGHFS-VNP----STGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFL----NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-----IHAARALQGPRD-DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE---FPRFAPGPRSFSFREDQPPGTTITVVAARSS--RRAGPVSYHLASGGNLG-DVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSR-FWAKVPENT-PPRTIVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVL-RVSTLDADEGPNAAITF--------------SLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAW-----TVSTDVTIV 528          

HSP 4 Score: 167.162 bits (422), Expect = 5.257e-42
Identity = 155/629 (24.64%), Postives = 284/629 (45.15%), Query Frame = 3
Query:  669 IKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVD--DNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKS-KILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQ-------------DLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFT---ANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +  +F ++    E+  H + D E  + Y   + A+D       A + ++V +LD ND+ P+F  +S++    ++ EN    T I++    D D G+NG++ YS+ + +     ++ P      G +     +DRE    YE+T+ A+D G PTQ  ++K+ I + D NDN P F   TQ    H  V E++ +   +  +  +D D+G N+ IT  + + S    +     EI     +  RL  +RE      + ++  D     + + VTI +D  D NDN P       +   E  E +   + + +V A+D D   NG++ +F+          F +  ++G + S     R L+             + Y F+V   D G+P LS+ ATVT+ I+  N N P F     + P+  T+   T     ++ ++  D D  +NG++  S++    +  F +   G + L+  +  +  S F + + A+D G  P SS    +I V + N  +P F  P   L++++  ++  G  L  ++TA D D G NG I++              +  D    F +++ +G++ L+  L     +   + + A D G+   +    + IS+ +
Sbjct:  275 LGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEF--SSSRFWA-KVPENTPPRT-IVVLTAVDKDSGINGQVDYSIIDGNIGNVFRVNP----NSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF---TQIFSAH--VREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEI----TVSRRL--NREDRSGYAVKVRASDPAWT-VSTDVTIVVD--DVNDNAPRFGQT--AYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQ----TENFRVGRDSGEIHSV----RPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTR----ILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPP--LELSLPENHPAGSSL-ARVTATDTDAGVNGAIVYSI------------ASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTD 852          

HSP 5 Score: 138.658 bits (348), Expect = 3.141e-33
Identity = 138/564 (24.47%), Postives = 245/564 (43.44%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKI---MIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSEN-IDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDS--GLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGIN-GKVSMILQEN----TDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDN 2144
            V + N   P+F      L + EN       +  +A D D G    + Y +              +F ++    ++      D E+   Y   + A D    +AK     + + + D ND+ P   +N++      I EN   GT +++ +  DAD   N   +YSL++ +        F +++K  +  ++  +D E ++ YE+T+ A +       S+ ++H++I  VN+  P F+ +  N +    V E++ +   +G++   D+D G +  +   +   S SK   +   E      + ++L  +RE    L ++ K   S  G D  +  V + + + D ND  P+  +     +  +SE     +++  V A D D     R   F+ +S     + FSI++ TG++      DRE   LY   V   D G+P  + +  V V + D NDN P   T++     + EN      +++L   D D   N G  +  L  +      YFSL+ +G +   RPIDRE   EF L +   D G  P +S++ + + V D NDN
Sbjct:  745 VTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG-------SGLFDISRASGDVLLVGELDYETEKLYNLSVCAAD-GGWQAKTECSGVSISVTDVNDNPPM--LNASDYYPV-IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADL-----FVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFV----VSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVN--EHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFD--VDEVLVNVAITDANDP-PVFSSAL--YHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRA-FSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSS---AKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 6 Score: 123.635 bits (309), Expect = 1.311e-28
Identity = 154/683 (22.55%), Postives = 281/683 (41.14%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFH-LNECKYELFSHISFDRESVNEYMFYLIAKDVDDN--EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKD--GQLLMVLKCC--DSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSMIL--QENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQ----PLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            +V+D+NDN P+F    + ++  E      + +  SA D D G   ++ + +    +  R+       H +   +Y   +       ++N+Y F + A D       +   + + I+  N + P+F     +     +    R GT I+  +  D D  VNG+I YS+   + ++     F +   G L +  ++  +    + +T+ A D G P   S     I + + N   P F      +    S+ EN    +++  +   D D G N  I   I     S         +F+I +    + +  E D   + L  L  C  D G         ++I V D NDN P++  N       I EN    + +  + A D D   N    Y +++ +      F ++ +TGV+ ++   D E +  Y+  V   ++      ++A V V I   N+ FP F      Y  ++  + P  A +  +   DRD GI+G V  +L  +  +  FS+ E+ G+I +   +DRE  +   L++IAK+ G         V++ V   + N P  +F        VS   +VG  ++  ++A D D    G   F     ++ S        ++ + FS+N   G I + + L     PL+     + + A D+G PP + T  + +++
Sbjct:  528 VVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAG-GGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFL---RERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRR----FDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLEL----SLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSG--------LFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML--NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEA---DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQRE--YNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPP-VFSSALYHGRVSEAASVGTHVV-GVSAHDFD-SPPGWRTF---SFLIQSG-------NAGRAFSINAHTGLIVVASPLDRESVPLYN----LTVVAVDMGEPPATGTTVVVVAL 1166          

HSP 7 Score: 119.013 bits (297), Expect = 2.812e-27
Identity = 152/680 (22.35%), Postives = 285/680 (41.91%), Query Frame = 3
Query:  498 NDNVPQF-EDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSV-EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFI-NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLST----SATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV-SMILQEN--TDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQN-GVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL---IIIYAKDLGYPPLSSTVKIEISIVE 2492
            N N P+F  +++        R   +I  + SA D D     ++ Y + G  +  R F + +   L+     L + ++ D  S+         +      ++    + + +EN   P+F   ++   +  + EN   G+ +     TD D GVNG IVYS+ + D   S +     +    L V E +D E  + Y +++ A+D G   +     + I + DVNDN P       N  ++Y V  EN+   T +  ++ +D D   N+     +++     ++  +K  +     + T+  +D E      + ++  +       S+  + + +   N+  P         N+ +SE+    + +  V ATD D   +G + Y +  ES +     FS++  TG +      DRE +      V  ++ G  S+         V V I D ND  P  F++   +  + E  +    ++ ++  D D     +  S ++Q       FS+ A  G I +  P+DRE+   + L ++A D G  P + +  VV+ ++D+NDN P  +     +  N     TV       + A DPD   N G   F     +L S+         + +FS++       L+ + +P+ R +     + +   D G PPL+STV + +S+++
Sbjct:  645 NANAPRFLRERYSTPVAATVRAGTRILDM-SAVDPDRDVNGQIAYSVVGG-NASRRFDVDAGGFLH-----LRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRF---AHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGD--GSGLFDISRASGDVLLVGE-LDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPML-----NASDYYPVIPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGV-----LTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQR--EYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRS---KGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAG--SIRGFDVDEVLVNVAITDAND--PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTV-----LNLEAGDPDLPPNKGPYTFQ----LLGSDPA------WRGYFSLSSSG----LLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLD 1273          

HSP 8 Score: 103.605 bits (257), Expect = 1.431e-22
Identity = 92/349 (26.36%), Postives = 157/349 (44.99%), Query Frame = 3
Query: 1458 LMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGK-PSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPP-YALIHLTCKDRDEGINGKVSMILQENTDY-FSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            L  + T+T+ V D+NDN+P        L   + E+    S +  V ATD D   N  + Y +   D      FS++  TG + +    DRE ++ Y   V   D G  P LS+SAT+ V + D ND+ P F  A   Y+    ++ P   A+  +T +D D G NG +   L  +    FS+    G I   R + +    +  L +   D G  P+S+   V +  +D  +      FP +      SF +   +   T IT V     +    + +H  L    N     L D    F+V+  +GE+++  +L   ++    +++ A+D G+PP S+ +K+E+ +++
Sbjct:    6 LTGTGTVTVLVEDENDNLPRF--GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGGD----GHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAP--YVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARAL-QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE------FP-RFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYH--LASGGN-----LGD---VFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLD 328          

HSP 9 Score: 86.6557 bits (213), Expect = 2.631e-17
Identity = 72/241 (29.88%), Postives = 108/241 (44.81%), Query Frame = 3
Query: 1773 GKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENT--NPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQ-SSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKF-FSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEI 2480
            G+P L+ + TVTV + DENDN P F  A  L   + E+       AL++ T  D D G+N  +S  L+    +FS+    G+I     +DRE    + L++ A D G  P  SSS  +V+ V D+ND++P F+       +  +         +  +TA D D G NG + F              SL  S    FSV+   G I    +LQ   R    + +   D G PP S+   + +
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRFGAAE-LRAAVPEDAPIGSDVALVNAT--DADAGLNAIISYRLRGGDGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFL---NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRF--------------SLSGSASAGFSVDPRRGVIHAARALQGP-RDDLTLTVRVSDGGAPPRSAVTTVTV 221          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 253.062 bits (645), Expect = 4.198e-69
Identity = 230/788 (29.19%), Postives = 352/788 (44.67%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSV--EENSEIDTNIGTIEVIDKDKGFNS----KITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQEN----TDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIV 2489
            ++EEQP GT+VG V                 S+FE   K         N  +GV+ T  RID     E+  +     ++ N +   I + VQV               +DINDN P+F   ++ L+I E+        + +A D D G    ++Y +  + D    FS+ +          + +    DRE+ + Y   + A D          +I + ILDEND  P F  NS       I EN + G  I+  +  D D G NG+I Y++ + D  +S  +    S  G +   +N+D E++  Y   + ASD G+P++     + I +LD NDN P   +      N       ENS I+TNI  I V DKD   NS    KIT   +E  F       K+E    + IQ +  +DRE      + L   D G+    +   + IDV D NDN P   +N  + N  ISE     SY+ Q+ ATD D  DNG + Y I   + L    F +D ++G+V +    DRE        +  +DHG    + S TVTVTI+D NDN P F  ++    TI E  +    ++ ++  D D G NG+++  +  +       F L  + G +  K  +DRET S +   ++AKDHG     SS+ V + + DINDN+P F +P +    ++  +   GK L  ++TA D D G N VI +     ++  N            FS++   G I+ + SL         +II AKD G    + T  + ++++
Sbjct:   16 VQEEQPPGTYVGKVDGA--------------SAFEGSPKQ-----FGFNSNTGVISTTARID----RETTTQISLQLRTLNPSNQPISVQVQV---------------DDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTI-ASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNS---YLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI-DWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCF-------KVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTAN--ISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGW--FQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSS-YKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEYF-ASIMENEPPGKLL--QVTATDADEGTNAVISYD----IIGGNN--------NGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVL 732          

HSP 2 Score: 219.55 bits (558), Expect = 2.185e-58
Identity = 192/681 (28.19%), Postives = 314/681 (46.11%), Query Frame = 3
Query:  492 DINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHV------NSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRT---KSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS--MILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            D ND+ P F    ++  I EN  P       SA D+D G    ++Y +  +  Q       SIF L+     + +  + D E  N Y F +IA D  V        + + +LD ND+ P+  +      N +K  +    EN  I T I    VTD D   N +    + N D     K + L FY      + + + +DRE+  FY +T++ +D G+P++ +   + I++ DVNDN P F   T N     ++ E ++  + +  +   D D+G N  ++  I   +   + +++    F    + T   +DRE+   + + +   D G  P   S T+T+ ++D NDN P    +  S    ISE     + + QV ATD+D  DNGR+ Y I+ SD      F ++++TGV+ +K   DRE + LY F V  +DHG P L +S  V +TI D NDN P+F+     + +I+EN  PP  L+ +T  D DEG N  +S  +I   N   FS+ +  G IS    +D E    F L I AKD G +  + +  V + V +  DN P F++   N  +   ++      L+ ++ A   D  +NG I +      + S        D    F V+   G I +   +    + + L+ + A+     PLS+   + I +++
Sbjct:  198 DENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQS-----NSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIR---SENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYF-----IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAF---TSNAYTA-NISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVD----FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKS--SYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVE-YFASIMEN-EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTV---YENVPKGTLVGRVYATTKD--KNGSISY-----AIVSG-------DPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLD 836          

HSP 3 Score: 175.637 bits (444), Expect = 1.539e-44
Identity = 180/690 (26.09%), Postives = 296/690 (42.90%), Query Frame = 3
Query:  468 LNFLFL-VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTN-----IGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSMILQENTDYFSL--AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPD------KNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            L F+ + V D+NDN P F    +   I E           +A D D G    + Y + G  D L  F +     L      L      DRE V+     + A+D           + V I+D ND+ P+F  +S    K  I E   IG  ++  + TD D G NG I Y +++ D   + +     ++ G L+    +DRE +  Y  T+ A D+G P  MSS+K+ + I D+NDN P F          Y VE  + I  N     +  +   D D+G N+ I+  I   + +    ++     +   I T  ++D E +    +++   D G      +  + + V++K DN+P+        N+ + EN  K + + +V AT  D   NG + Y I   D  ++  F +DS  G++K     DRE +  Y   V  R      LS  ATV + +LD NDN P F T++   +  I+ T     +++     D D G NG V   L  N +      + +G I L R +     +++ ++++A D G  PQ S++ + I +  IN + P F           +  ++  F Y V         AVD D G+NG + +           +P+   + +  F +    G++ +  SL    +    +I+ A D G P  S++V + I I
Sbjct:  408 LGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGND-LGWFQVDFQSGLVTTAKPL------DREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSS---YKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFEL-NTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF----------YPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDS----STGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEM--YNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNL--FLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSS--VIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLS-IN-HPPKFTLSSYVTHVLASQPLSYQFFYVV---------AVDQDSGKNGQLFY----------SIPQG--NEEGLFGIFP-GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYI 1040          

HSP 4 Score: 173.326 bits (438), Expect = 8.290e-44
Identity = 201/820 (24.51%), Postives = 354/820 (43.17%), Query Frame = 3
Query:  144 FLY--YLQPIKEEQPQGTFVGNVKNFILE-NNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKF-------HVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHI--EENSFSKYLKLEKIEIFNIFKIQTRLAIDREK----DGQLLMVLKCCDSGLDPLMSSVTITID-------VVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF----FTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL----AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSL----QPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            FLY  Y   + E  P+GT VG V     + N ++    +      LF   S   ++K+N            D+D   ++       ++       S +  V      NI++L       D NDN PQF     ++ I    L  ++    +A D D G+   + Y+L  N + L   +  S         +L   ++   E+  +Y   ++A D         + + I    +  PKF       HV +++   +Q +    +          D D G NG++ YS+   NE+        F +   G L++ +++ + ++  Y++ + A+D G+P+  +S+ + I I D ND++  F+    N    ++V ENS   T +GT+     D      I   +   E+ F+  ++  +I         TR+ +DRE+     G  + +++      + + +  TI  D       V D NDN P+      ++   +SE ++  S + ++KA D D  DN +  Y +       M +F I+S TG +      DRE    Y  +V   D    +L ++A + +T+ D ND  P+F    +T N     I E+      +I+L   D+D G NG +   +  N +  ++    +  G++ + + +D ET   ++L I A+DHGL P SS++NV + V D+NDN+P  +FP + + + V  +   G   + + TA D D G N  I F      ++S       +   K FSVN    EIT I ++     P  R    +++ A D G P LS+   I + + +
Sbjct:  741 FLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKING-----------DMDREEKAQYLLAVIARVGTVKPLSAQATV------NIEVL-------DRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTS------GVIKLARKLTDGDET--QYTVQVLASDSGSPPQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAV----------DQDSGKNGQLFYSIPQGNEEGL------FGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFV----NNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQI--------TTRVRLDREELIKNTGSNVYIMQA-----EAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAIT--VSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSG--TGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVN-----ITEDALIGSLVINLNASDKDIGQNGLIKYSI-SNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LFPTQPVTLTVRENVNTGFP-VGRCTASDRDTGTNAHIAFS-----MYS-------QTPSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTD 1470          

HSP 5 Score: 152.525 bits (384), Expect = 2.581e-37
Identity = 172/705 (24.40%), Postives = 310/705 (43.97%), Query Frame = 3
Query:  447 YSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAK--DVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIF---KIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRE--------------LQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            Y+    ++N   L  +  DN+P F  + +   ++EN     +     A  KD  +   + Y +  + D   LF + S   + +   ++      DRE   +Y+  +IA+   V    A+  + + +LD ND+ P+F  +S  +    I     +G  +      D D G NG + Y L     + ++ L +  S  G + ++  +       Y + + ASD+G P Q S++ IHI  L +N + P F L +   + H  V  +  +      +  +D+D G N ++   I + +        +  +F IF   K+  R ++ +   G   ++++  D G+    +SV +TI + D ND+  +   NT    + ++EN+   + +  + A  +D      + Y +  S+    S F++D  +G + +++  DRE               + +Y      RD         A V VT+ D NDN P+F  A  +Y +T+ E + P   +  +   D DEG N K   S++     D F + +  G++ L + +DRET S + L + A D       S+  + I V D ND  P  +FP+ +  +N++ D  +G  L+  + A D D GQNG+I            K   S  +    F V    G + +  SL     +   + I A+D G  PLSSTV + +++++
Sbjct:  720 YAAKTAVVNVTVL--NKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIV-SGDPTNLFLVDSTGGIIKINGDM------DREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVD---IDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT----SNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHI-TLSIN-HPPKFTLSS--YVTH--VLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGN--------EEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNT--FRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSE----SHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDK--------AIVIVTVTDLNDNAPVFSRA--VYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPESDYTVNITEDALIGS-LVINLNASDKDIGQNGLI------------KYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLD 1361          

HSP 6 Score: 143.665 bits (361), Expect = 1.225e-34
Identity = 171/654 (26.15%), Postives = 287/654 (43.88%), Query Frame = 3
Query:  420 SIELIVQVT------YSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESV------NEYMFYLIA--KDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKD---GQLL-MVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISEN-NIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDREL----QDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYA-------LIHLTCKDRDEGINGKVSM-ILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDIN-DNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFH 2279
            S +LIV+ T      +S ++ +  +   ++D ND+   F +      + EN  P  +     A   D  +T  + Y L          S +S F ++    ++ + +  DRE +      N Y+    A   D      K ++ V + D ND+ P F   S  +    + E    G+ +      DADEG N +  YSL     + + +  F++ S  G L +S+ +DRE    Y + + A+D       S+ KI I + D ND +P F      +    ++ E++ I + +  +   DKD G N  I   I   + +         +F++     RL + +  D    QL  + +   D GL PL S+V +T++V+D NDN P+  T   +L   + EN N  F  + +  A+D D   N  + + +  S T S + FS++S T  + +    D E     +D ++ +V   D G P LST  ++TV + DENDN P F +             PP A       ++ +T +D D   NGKV+  I+  N  YF+L    G++ +   I  +  + ++L I A D G +P   +  VV   K+      PTF   D   Q +V+ +   G  ++T + A  P    NG I ++
Sbjct: 1015 SYDLIVRATDGGVPSFSASVPVTIY---IQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL---------ISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVF---SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSL----VSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTV----NITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAA--------MFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLT--VRENVNTGFP-VGRCTASDRDTGTNAHIAFSM-YSQTPSKT-FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVS-------------PPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI-PDNPTIYQLTIQASDGG-QPSRQTQTVVSVFKEGPIGGGPTFSSAD--YQGSVTENKVAGTSVVTVLAAY-PQSSLNGNIEYY 1614          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 235.728 bits (600), Expect = 1.877e-63
Identity = 202/730 (27.67%), Postives = 334/730 (45.75%), Query Frame = 3
Query:  291 NRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIM--IKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSS 2462
            N    +++F+G + T+  +D +++        Y S + N +  S+   +  T + NI I        D NDN P F          ++    ++G L +A D+D G    + Y +  GN+         + F L+     L    + DRE++  Y   + A D    +  I   I V +LD ND+ P+F      +   +I E+  + + ++   V D DEG NG I  SL+ E         F +   G +     +D E    Y++T++A D G P++ ++ ++ I I++VNDN P F+   Q      S+ E+  I+T++  +   D D    + +T  I E +     K+++     +  +  RL  DRE      +V++  ++G          TI V+D NDN P+   N GS    + EN      + +V ATD D  +N ++ Y ++  DT   S+F ++  TG+V +K   DRE Q  Y   V   DHGKPS S  A +T+TI D NDN P  F+ +   LT+ ENT     ++ +   D D G NG+V  S+I   + + F + +  G+I++   +DRE  + + L I AKD G+ P  S+  V I V D NDNSP  IF        +    ++G + +  +TA D D G N  + +               ++     F++N  NG +T+   +         + I A D G P ++S
Sbjct:  730 NMAFAMDRFTGEITTRVPLDRETIA------SY-SLTINADDGSLVRFMAAT-TVNISI-------ADENDNQPTFTGPSRFNISEDSPTGTRVGQL-TATDRDIGPNGAVTYAIISGNQ--------GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFE---KSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-----FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQ----VTSIPEDVAINTHVVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSS--GLISVAKRL--DRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVF--NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT---SKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQ-FSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSP--IFASNETSYGIDEGVSIGSR-VAVVTATDRDEGSNAQVFYSI-------------VRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTS 1394          

HSP 2 Score: 231.876 bits (590), Expect = 2.543e-62
Identity = 203/689 (29.46%), Postives = 314/689 (45.57%), Query Frame = 3
Query:  462 KILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL----HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFI---NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLII---IYAKDLGYPPLSSTVKIEISIVE 2492
             +      + D+NDN PQF    + L + EN           A D D G   ++ Y +    HGN            F ++     +      DRE++  Y   + AKD  V    +   + + + DEND+ P F  N      + I E   IG+ + +   TD DEG N ++ YS+   D +   I     +  G L V + I+RE    Y +TI ASD G P   S  ++ + + DVNDN P  +  +Q+ +   SV ENS   T++ T+   D D G N+ +   I   +  K  K+          I T   +D E+  Q  + +   DS      +   +TI V++ ND  P       +    + EN+   + + +V A+D D    G L Y I    +SD     +FSID  +G++ +  V DREL  LY   V + D G P LS    VT+ ILDENDN P F +++    +I+EN+ P      L   D DEG N +++  L  N  +   A +G I+L +P+DRE  S + L I A+DHG  PQ+SSI + + V DIND+ P  +    +L+ +V  +    +  + +I A D D G N  + F      L SN+        K  F+++   G+I+   +  PL R +  +    I   D G P LSS   + I +++
Sbjct: 1185 AVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNA-----------FRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETS---YGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAI----NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP--VFNSQSYIG--SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV----IMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQ--NYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSD-----KFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSS-YSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP--LINSSSLRGSVR-ENQPKETHVMRILASDADTGLNAELTFS-----LLSNEH-------KSVFTLDNTTGDIS---TKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVID 1816          

HSP 3 Score: 209.149 bits (531), Expect = 4.288e-55
Identity = 186/670 (27.76%), Postives = 306/670 (45.67%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS--MILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            V+D NDN P+F    +V  I EN    ++ ++ +A D+D G  + + Y L         FS ++ F +N    E+ +    D E+ + Y   + A   D      +  + + D ND+ P F ++   + K  +YE+  +G+ +      D D G+N  + YSL + D +      F +  +G +      DRE +  Y++ + A D G P++     + IEILDVNDN+P F     +     SV+E+  I   + T+   DKD G N+ +       + +    L+ +       +    ++D E+     + L   D G  PL  +  + I+V D NDN P+   +  +    + EN    +   QV ATD D   NG L + I + +   +  F+ID  TG++      D E +  Y   V  RD G P    +A VT+ I D ND+ P+F  +N     I E+T     ++ +T  D D G  G++   +I       F++ A +G I +   +DRET   + L++ A+D G   +SSS  V I ++DINDNSP F  P       VS   + G + I ++ A D D   NG + +              +L D+   FS+N   G ITL   L    + + ++ + AKD G P  SS   +++ +
Sbjct:   60 VKDENDNAPEFPLNSYVFNIRENTPAAQV-AIVTATDRDSGTNAAITYSL---------FSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISA--FDGKHTTFVPLITVDDVNDNAPFFALS---VYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSY-----FTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF----SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGV----VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVF--SPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGV--FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSN-YSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGP---YVFRVSESSSPGHQ-IGQVAATDADDSSNGDVRY--------------ALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMV 675          

HSP 4 Score: 195.282 bits (495), Expect = 1.223e-50
Identity = 186/684 (27.19%), Postives = 312/684 (45.61%), Query Frame = 3
Query:  492 DINDNVPQFEDKFHVLQIHENRLPMKIGSL---PSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD----NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS--VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYL-TIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN---GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            D+NDN P F    +   + E+   + IG+     +A DKD G  + L Y    GN +          F L+     +    S D E  + Y   L   D       + + ++I V   D ND+ P F   S    + ++ EN   GT++   + TD D   NG +V+ +   N+D        F +    G + ++++ D E +  Y++T+ A D G+P +  + ++ I I DVND+ P F        ++YS  + E++ I + + T+   D D G   ++   +   +      ++     N   I+    +DRE      + ++  D G     SS  +TI + D NDN PI     G   + +SE++     I QV ATD D   NG + Y ++++  +    FSI++ TG++  K   D E +  Y   V  +D G PS S+   V V + D NDN P F  A  LY  T+ EN     A+ ++T  D D G NGK+S  +    +  + A +   G+I+ + P+DRET + + L I A D  L    ++  V I + D NDN PTF  P +    N+S D   G + + ++TA D D G NG + +     ++  N+           F ++  +G +++ ++L         +++ A D G P  S T  I +S+++
Sbjct:  263 DVNDNRPVFSSAQYTASVDED---VAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA--------FTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVN--DINDNPPVF---SPSAYQSRVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGV------FTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSP------SNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDA----NSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQ---GPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV----FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQF--AKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR---FNISEDSPTGTR-VGQLTATDRDIGPNGAVTY----AIISGNQ--------GNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLD 886          

HSP 5 Score: 184.882 bits (468), Expect = 2.309e-47
Identity = 176/646 (27.24%), Postives = 296/646 (45.82%), Query Frame = 3
Query:  477 LFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP---SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVD--DNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLE-KIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKL-----ITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEIT 2375
            L  V+D+NDN P F    +   ++E+   + +GS+    +A D D G  ++L Y          L S  + +   + +  + +  +FDRE+   Y   L A+D        +  +++ ILD ND+ P F   S+      + E+  IG  ++    +D D G N ++ YS  + +   +  L    +  G + VS ++D E R  Y + +S +D G P    +  + I + D+NDN P F            V+EN+   T    +   D+D   N  +   I + +      ++    I +I K     + D E   +  + ++  D G+     +  +TI + D ND+ P+   +  + + +I E+ +  S +  V ATD+D    GRL Y +   +      F+ID+ +G ++     DRE    Y   V  RD G  S S+S  VT+ + D NDN P+F    P    + E+++P + +  +   D D+  NG V   L +NTD FS+    G I+LK  +D E  +++ + + AKD G  P  SS+ VV + V D+NDN P F    K+L     +  TVG+ L     +  +TA D D G NG I +     +L  N+           F++++  GEIT
Sbjct:  155 LITVDDVNDNAPFFALSVYKTGVYED---VAVGSIVRQLTAVDLDVGINARLSY---------SLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF---SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLD---AVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAY----QSRVKENTPAGTQ---VSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAK-----SPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF--SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNV--KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF--QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGT-PSRSSLTVVKVMVDDVNDNPPQFA---KSL-----YTCTVGENLAAGVAVCYVTATDADSGANGKISYS----ILSGNE--------NMAFAMDRFTGEIT 743          

HSP 6 Score: 164.851 bits (416), Expect = 3.267e-41
Identity = 142/525 (27.05%), Postives = 249/525 (47.43%), Query Frame = 3
Query:  726 FDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGK-VSMILQENTD-YFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFH 2279
            FDRES + Y   ++A+D  +  ++ + ++ + + DEND+ P+F +NS     F I EN     ++ +   TD D G N  I YSL + E++       F M SK G +     +D E ++ Y + ISA D     + ++    I + DVNDN P F L     +    V E+  + + +  +  +D D G N++++  +     S Y  ++   +     I+T+ A DRE      + L+  D G        T+ I+++D NDN P+   ++      + E+    + +  V A+D D  +N  L Y     +T     F++D+ TGVV      D E +  Y   + + D G P L+ ++ + + + D NDN P+F  +   Y + ++   P  A   ++  DRD   NG  V  I++ N D  F++    G IS+ +  D E  + + L + A+D G+  +  +  V I ++D+ND+SP  +F   N    +     +G  ++T +TA D D G  G + + 
Sbjct:   28 FDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNS---YVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGENK-------FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFALS----VYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTS-YFTVDSQGV-----IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF--SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT--NHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPS--AYQSRVKENTP--AGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSP--VFSPSNYSKQIPESTVIGSTVVT-VTATDLDSGPRGRLEYR 516          

HSP 7 Score: 158.303 bits (399), Expect = 3.675e-39
Identity = 128/488 (26.23%), Postives = 228/488 (46.72%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL-NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRD 1934
               +V D+NDN P F  + ++  + EN          +A D D G  + L Y +    D+ R       F +N     + +    D E  ++Y   + A D     AK  + +R+++ ND  P F   + +     + EN    T ++  + +D D    G + YS+   +D  K  I      + G +  ++ +DRE+   Y I +  +D G P   +   + I+ILD NDN P F     +     S+ ENS   +    +   D D+G N++IT ++  N    ++      +  + +      +DRE      + ++  D G  P  SS+TI + V+D ND+ P++  N+ SL   + EN  K +++ ++ A+D D   N  L + +  ++  S+  F++D+ TG + +K+  DRE Q +Y   + + D G PSLS+ A V + ++DE+DN P  F      +TI E+     +++ +T +D D
Sbjct: 1398 LTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR-------FKINSTSGVIMTTTPLDFEEKSQYGLEVTATD-SKYTAKTNVTIRVINLNDITPAF---TQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDKFSI----DQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKF----DSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRND--AFMIGASSGVITLAQ-----PLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLI--NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSV--FTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPR-FQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 8 Score: 156.377 bits (394), Expect = 1.376e-38
Identity = 164/603 (27.20%), Postives = 278/603 (46.10%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGS---LPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD------VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL---NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV--SMILQENTDYFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPD 2249
            V D NDN P F        I E    + IGS   + +A D+D G  +++ Y +   +     F+I ++  +   K E+      +RE+V  Y   + A D        D E  +++     D ND+ P F+  S       + EN    T ++     D+D G N  + YS+   N+E R K        S  G +  +  +D E +  Y + ++A+D+      +   + I ++++ND  P F  Q        SV ENS   T++  +   D+D  F S     +      K+   ++  I     I T   +DRE      + ++  D+G  PL +   +TI ++D+NDN P  D++  S +  I EN+   S+  ++ ATD D   N R+ Y ++ +D      F I + +GV+      DRE +  Y   +  RDHG P  ++S T+ VT++D ND+ P+  +++ L  ++ EN      ++ +   D D G+N ++  S++  E+   F+L    G IS K P+DRE  + + L+I   D G    SS  +V+I+V D +DN P F   + N+ ++ S         I ++TA D D
Sbjct: 1298 VADENDNSPIFASNETSYGIDEG---VSIGSRVAVVTATDRDEGSNAQVFYSIV--RGDTSAFAINAMNGVLTVKKEI------NRETVPTYTLTIRASDRGSPMMTSDKELTVVVN----DVNDNPPVFNSQS---YIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFK------INSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTA----SVRENSPTSTSVVKVSASDRDS-FGSLSYSIVGGKDSDKFSIDQRSGI-----ISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSS--SYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRND-----AFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSS-LRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGAS---IVQVTARDID 1852          

HSP 9 Score: 145.976 bits (367), Expect = 2.242e-35
Identity = 139/498 (27.91%), Postives = 227/498 (45.58%), Query Frame = 3
Query: 1020 SKKGSLFVS-ENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHI--EENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCD---SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSM-ILQENTDY-FSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            S  GS+  +    DRE    Y +T+ A D           + I++ D NDN P+F L +      +++ EN+     +  +   D+D G N+ IT  +   EN F    K          +I+T   +D E      M +   D   +   PL     IT+D  D NDN P    +       + E+    S + Q+ A D+D+  N RL Y +   DT   S F++DS+ GV+++K  FDRE +  Y+  +  +D G PS S  ATV + ILD NDN P+F +A     ++ E+     A++ +T  D+D G N  +       NT++ F+L A  G +++ R +D E  S + L +   D G  P + + +++I V DINDN P  +F     Q  V  +   G    T+++A D D   NG ++F     ++  N            F+++   G I++  S     + +  + + A+D G P    T ++ I I
Sbjct:   16 SSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSY----VFNIRENTPA-AQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTG--------EIRTVTPLDHETKDSYTMRISAFDGKHTTFVPL-----ITVD--DVNDNAPFFALSV--YKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT---SYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQ-YTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP--VFSPSAYQSRVKENTPAG----TQVSATDRDSSTNGALVFG----IIKGND--------DGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFI 468          

HSP 10 Score: 135.961 bits (341), Expect = 3.263e-32
Identity = 126/446 (28.25%), Postives = 202/446 (45.29%), Query Frame = 3
Query:  294 RLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKD-FGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAK--IMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVT-ITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDID 1610
            +  K+N  SGV+ T T +D +      ++  Y             L V  T SK     N    V ++ND  P F  + +   + EN  P     +  SA D+D FG    L Y + G KD  +       F +++    + +    DRE V+ Y   +   D  +        + ++ILDEND+ PKF           I EN    +       TDADEG N  I Y+L+  D         +M  +  G + +++ +DRE +  Y++ I A D+G P Q SSI I + ++D+ND++P  ++ + ++    SV EN   +T++  I   D D G N+++T  +  N       L+         I T++ +DRE+     + +   D G +P +SSV  + IDV+D++DN P         N  ISE+  + + I QV A DID
Sbjct: 1458 KRFKINSTSGVIMTTTPLDFE------EKSQYG------------LEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENS-PTSTSVVKVSASDRDSFG---SLSYSIVGGKDSDK-------FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDS---SSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDA--------FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRP--LINSSSL--RGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDN----TTGDISTKVPLDREQQAVYTLRIGVADKG-NPSLSSVADVIIDVIDEDDNCPRFQPT--EYNVTISESLPRGASIVQVTARDID 1852          

HSP 11 Score: 85.5001 bits (210), Expect = 9.825e-17
Identity = 80/295 (27.12%), Postives = 129/295 (43.73%), Query Frame = 3
Query: 1674 FSIDSETG-VVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVET---KSSIYSNKISASNDHD 2543
            F+IDS TG +  +   FDRE +  Y+  V  +D           V + + DENDN P  F  N     I ENT P   +  +T  DRD G N  ++  L    + F + ++ G+I    P+D ET   + ++I A D     + ++   +I V D+NDN+P F       +  V  D  VG  ++ ++TAVD D G N  + +               +     +F+V+   G I    +     +    + + A+D G P  S    +EI I++    +    S + +AS D D
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPE-FPLNSYVFNIRENT-PAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFAL--SVYKTGVYEDVAVG-SIVRQLTAVDLDVGINARLSYSL-------------VSGDTSYFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDED 283          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 208.379 bits (529), Expect = 1.165e-54
Identity = 212/825 (25.70%), Postives = 373/825 (45.21%), Query Frame = 3
Query:  111 LLLLQFVMP---YQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIE-LIVQVTYSKNIKILNFLFL-----VEDINDNVPQFEDKFHVLQIHENRLPMKIGS---LPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDN---EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPF-YMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSK-YLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTI--IENTNPPYALIHLTCKDRDEGINGKVSMIL-QENTD-YFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGE-ITLINSLQPLFRR---------KCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            L +++F  P   Y  L Y+Q + +  P      + K  + EN+   +  L     +    S+ +  +       V +  ++ D D   +   +   N+ S   +   ++  ++ ++ S      N  FL     VED NDN P+F +  +   I EN   + +G+     SA DKD G  ++++Y +  + D       ++IF ++     + +++  D E+   Y+  + A+D   +    +  ++++ +LD ND+ P  HV+      +Q+ EN  IGT++   +V+DAD G NGE+  +L   D   S  + F  ++ +  + V +++DRE  + + +     D G P + +     I + DVND  P F   T        V EN+ ++T +  +  +D+D G NS++   I   + S+ YL    I+  +   I T   +DRE+  Q+++ +   D G  PL  + ++ +++ D NDN P    N  S N  + EN+   S + Q+ A D DI +N  + Y I   +T     F +D   G+V +    D E+Q  Y F V   D G    S +ATV V++ D NDN P+F   +P   ++   ENT    ++  L   DRD         I+ Q N D  FS+  +G I+L + +DRET   + L + A D G +   +   V I V D+ND  P F   + N  +    +++    +I  + A+  D G N  ++                       +S++K N + I LINS   L+ +            + + AKD G PPL     + I++++
Sbjct:   30 LTIVEFSTPPKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDG--DLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPEN---IDVGTSILQVSASDKDIGTNAEIQYSIETHSDP------QAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFS--MKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTY----ETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGM-ITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYF--NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNT----PFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQ---EHSQALSVIGHVHAISRDKGTNAEVV-----------------------YSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVID 799          

HSP 2 Score: 183.341 bits (464), Expect = 8.797e-47
Identity = 188/729 (25.79%), Postives = 310/729 (42.52%), Query Frame = 3
Query:  297 LLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEG--VNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVK-SKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLT-IIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDY--FSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAV---DPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPP 2453
               ++  SG++ T T +D + + + +     + +     + +  +IV +T               D NDN P F    +   + EN           A D D G+ S + Y +          +  + F L+  K  + +  + D E  + Y F + A D         + V + D ND+ P F  +S  ++ F   EN RIG  I      D D         +    N D        F +   G + +++ +DRE ++ Y +T+ A D G    ++   ++I +LDVND  P F     N    ++++E+S+  + IG +  I +DKG N+++   I + +    + +          +Q+   +D EK   L + ++  D G  PL     +TI V+D NDN P    N+ S+   + E+         V   D D    GR+ +  ++   TL    F++DS TG +  +K++        Y   V  +D G P  S++A + + ++D ND  P+F   N  Y   ++E T P   +I +   D D G NG++S       D   F L   GKI +K  +DRE   E+ LK+IA DHG   +SSS +V + V D+NDN+P F       Q + +F     + + T + AV   D D G NG + +  D  V                F V+K  G+IT    L    +   +  I A D G  P
Sbjct:  440 WFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLT---------------DSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSI---------LTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYF---ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV------FSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYN----FTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINST---GTLYLQSE--VDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSP--QFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTL----FNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF--GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHF------QQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ--------------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSP 1098          

HSP 3 Score: 181.8 bits (460), Expect = 2.706e-46
Identity = 195/680 (28.68%), Postives = 303/680 (44.56%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVI---DKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAI----DREKDGQLLMVLKCCDSGLDPLMSSVT-ITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTS-ATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMIL--QENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV---IEVKDINDNSPTFIFPDKNLQM---NVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSS 2462
            V D+ND  P F +  +   + E   P        A D D G+  ++ Y      D        S F L     ++F     DRE + EY   +IA D       +   +KV + D ND+ P F   S     F + EN  + T +   + +D+DEG NG + Y      R  +++  F + K+ G +  S+ +DRE +  Y  +I A+D G   ++   ++ + + DVND  P F        N YSV  N ++      + +I   D  +G NS IT          Y+ +   + F++ ++   L +    DRE   + ++ +   D G +  + ++T I I+V+D NDN P+    T      + E     S +  V A D D  DNG++ Y I   +T     F I+  TGV+ +    D E+ + Y   V   D GK    TS   VT+ + D NDN P F   NP+   I EN      +  +   D D G+N ++   +  Q    +F + +E G I    PIDRE  SE+ LK+ A D     Q    N     I ++D+NDN+P F+   +NL     +  F++ V     T ITA+DPD GQ G + +    +V      P++ K     FS++   G + LI SL      +  + I A DLG PPL+S
Sbjct:  902 VVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVD-------TSKFGLRNGG-KIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQAS---YAFFVKENEPVATYLGAVSASDSDEGSNGHVTY------RFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSK------NKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDIT----------YMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINET--TFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT--DGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF-DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFV--SRNLTYVMEDEPFNFQV-----TSITALDPDTGQGGNVEYR---IV-----SPDTGK-----FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS 1523          

HSP 4 Score: 171.014 bits (432), Expect = 5.023e-43
Identity = 198/724 (27.35%), Postives = 321/724 (44.34%), Query Frame = 3
Query:  294 RLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAF---DKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKI---MIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNED-RTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQ---MSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHI---EENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIP--IVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKV-SMILQENTD-YFSLAEN-GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILF-------------HHDELVLHSNKMPESLKDSKKFFSVNKDNGE 2369
            +   LN+ +GVL   + +D +     I     + K  N    S+E I  +     I +L       D+NDN P F ++     + E +LP  IGS+ +A    D D G   K+ Y++ +GN D          F +NE    + +  + D E  N Y+  + A D+   + K    ++ + + D ND+ P F  + N I  + IYEN  I T +      D D G+N  I Y+++++  R   KI     S+ G +  +  IDRE    Y + + A+D     Q    ++  + I I D+NDN P F+ +     N   V E+   +  + +I  +D D G    +   I   +   FS  LK   +++          ++D E   Q  + +   D G  PL S     + VVD NDN P    D   G+    +SEN    + + +V A D D   N  L Y I     + M +FSID  +G++ +  + DRE +D Y   V       P   +S +V + ++D NDN P F +  P+    +   +P   +  LT +D D G N KV   I+  NTD  F++  + G++S    +DRET + ++L + AKD      ++  N+ I ++D NDN P F    ++L  +   + T     I  +TA D D G NG I++                 +V  + +   S+K    FF + KD G+
Sbjct: 1164 KAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQ---SLETITYI----EINVL-------DVNDNYPVFINETTFKTVPE-KLP--IGSVVAAVLAVDSDQGDNGKVRYKIVNGNTD--------GTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTF--DKNPIITW-IYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKI----NSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR-----NLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIG--------SLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGT----VSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSG--VEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFIS--PVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVF---QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQ 1831          

HSP 5 Score: 158.303 bits (399), Expect = 4.556e-39
Identity = 165/650 (25.38%), Postives = 270/650 (41.54%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHEN------RLPMKIGSLPSAFDKDFGQTSKLEYRLH-GNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGT----------------------------EIILFNVTDADEGVNGEIVYS--LNNEDRTKSKILPFYMSKKGSLFVSENIDREIRE-FYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFN-SKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENT-------DYFSLAENGKISLKRPIDRETHS--EFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKL---ITKITAVDPDFGQNGVILF 2276
            V D NDN P F     + Q+ E+      R  +K+    +A D D G   K+ Y +  GN+          +F ++    E+ +    DRE+   +   +   D  +        +KV + D ND+ P F    + + +  I E+ R G                              I+  + TD D G N +I YS  + N D+   KI     +  G +     ID  IR+ F +I + A D G+P Q + + + I I      +P F L +        V EN+ + T++ T+ V D   G    +I+ +IE +++ +  +   +       I     +D E   + L+V+   D         V + I+V D ND  P+   +     W  SE     + +  V A D D   NGR+ + I   D      F+ID +TGV++++   D E    +   V   D G P + T  +VT+ +LD NDN P+F    P  + ++EN      L  +   DRD G N ++S  +   T       D FS    G ++     D E  +  ++ L I A D G  P SS+I +++ V D ++  P+F       +M+  FD     K+   + ++TA D D G  G + F
Sbjct: 2057 VIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKV----TATDVDSGTNGKVTYSIWTGNE--------AGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF----DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKI----DADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIIT----REPKFELPSY----FGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGV-------ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQW--SEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGD--DKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFS----GWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF------NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFF 2657          

HSP 6 Score: 157.918 bits (398), Expect = 5.407e-39
Identity = 180/710 (25.35%), Postives = 302/710 (42.54%), Query Frame = 3
Query:  153 YLQPIKEEQPQGTFVGNVKNFILENNA-LDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYR-LHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDN--EAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGV--VKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNP--PYALIHLTCKDRDEGINGKV--SMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPD 2249
            ++  + E +P GT V  V  +  ++ +  + TY   S  E+           ++K SG++ T      +S+ +  K+  Y    H T          V+Y   +   +    V D NDN P+F      L++ EN  P ++    +  D D+G  +K+ Y  + GN D          F +     EL +    DRE+   Y   + AKD+      A   I + I D+ND+ P F      +    I E    GT I+    +D D G NG IVY+L+N+      I     S+ G ++ +   +  I++ Y     A D G   +M+ + + I+I D N++ P F      +  H     ++     + T    D DK  N K+T  ++++  S  L + +    N   ++T         G+  + +   D G  PL     + I + +  D+ P    N       I EN+   SYI  V+A       + ++ Y I   +      F +D  TGV  V S    D E    ++  +     G  SL+    + + ++D NDN P F  +N +   + E+T    P  ++ +T  D D G NGKV  S+        F++ +  G+I+  + +DRET + F L I   D G+ P+S++  V + V D+NDN P F   D   ++N+  D   G  ++T + A D D
Sbjct: 1546 FIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEM-------DKFSIDKHSGLIVT------NSILDREKKDTYFLTVHATG---------VSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENS-PARLIYTLTVQDLDYGNNTKVLYSIMSGNTD--------GAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQ---QSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSI----DSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEV--HIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVE---SNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRF-LNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGN--KGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSN-MLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF---DPLSEVNIREDTRTG-AVVTSVVATDTD 2201          

HSP 7 Score: 154.836 bits (390), Expect = 5.176e-38
Identity = 186/683 (27.23%), Postives = 309/683 (45.24%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENR-LPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEA--KIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADE-GVNGEIVYSLNNEDRTKSKILPFYMSK-KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIK-IHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVT-ITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHG---KPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVS-MILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMN-VSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +V+D+NDN P F+   +   + EN  +   +G++ SA D D G    + YR      Q         F +++   ++ +    DRE+   Y+F ++A D   +    K  + V + D ND  PKF  N   +    + E+  +G+ ++    TD D+ G N +I Y +    +       F +++  G L +   +DRE+   + + + ASD G    + +I  I I +LDVNDN P FI +T       +V E   I + +  +  +D D+G N K+   I   +     K+ +        I T  A+D E   + ++ +   D G     +S   +TI V D NDN P  D N   + W I EN    + +  +KA D D   N R+ Y I+       + F I+SETG++++    DRE    Y   V   D     +  L  +AT+ + I D NDN P F + N  Y+   E  N  + +  +T  D D G  G V   I+  +T  FSL  + G + L   +D E   ++ L I A D G  P +S     + V D+NDN P F    ++L +  VS +   G  ++ K+TA D D G N  + +           +P  ++  K  FS++K +G I   + L    +    + ++A  + YP   S+  + I++++
Sbjct: 1005 IVDDVNDNNPHFQQASYAFFVKENEPVATYLGAV-SASDSDEGSNGHVTYRFDTQVAQ---------FIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVT---VNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKA------FSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINET----TFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGV----ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNP-IITW-IYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQS--PRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFN--FQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFT---RDLFIGTVSENKPTGTSVV-KVTAYDRDSGSNAELTY----------SIPSGVEMDK--FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMD 1638          

HSP 8 Score: 143.665 bits (361), Expect = 1.336e-34
Identity = 156/671 (23.25%), Postives = 284/671 (42.32%), Query Frame = 3
Query:  510 PQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYEN--CRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEI-FNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDI--QDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRP--IDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            P+F     +  + EN+         +A+D+D G  ++L Y +    +  +       F +++    + ++   DRE  + Y   + A  V      +   +++ ++D ND+ PKF    + +   ++ EN   R+   I    V D D G N +++YS+ + +   +    F + +  G L  +  +DRE +  Y++++ A D   P   +   I I I D NDN P F    Q  L   ++ E +   T+I  +   DKD G N  I   +  +++  Y    +  I ++  + +T +    +++     + K  D G DP M+ V + I + DKN++ P   T T      I  N    + +  V ATD D     NG++ Y +++S   S S F ++S TG V++   F    Q  +   +   DHG P L     V + I +  D+ P F    P  ++I EN+     +  +  +   +       +   +   ++     G IS+     +D E+   F+L ++A   G    +  + + I V D NDNSP F  P   L            + + K+TA D D G NG + +     +   N+           F+++   GEIT    L         ++I   D G PP S+  ++++ + +
Sbjct: 1539 PEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK-------FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFI---SPVVTLKVPENSPARL---IYTLTVQDLDYGNNTKVLYSIMSGNTDGA----FTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVF----QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSI----KQEYNFFCIAK--DQGQDPKMAIVPVRIKIEDKNNHAPQF-TKT-PYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKN-STSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAF-HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYS----IWTGNEA--------GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTD 2166          

HSP 9 Score: 130.568 bits (327), Expect = 1.399e-30
Identity = 163/712 (22.89%), Postives = 302/712 (42.42%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHV-LQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIA--KDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLE----------------------------KIEIFNIFKIQTRLAID-REKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKND-NIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQ-DNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALI-HLTCKDRDEGINGKVSMILQENTDYFSLA---ENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEIT--LINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ +I D+ P+F ++    + I EN    K+GS  +         +++ Y +  GNK   R F +     +      + S  + D ES   +  +L+A  +        +++ + ++D ND+ P FH  SN + +            ++    TD D G NG++ YS+     T ++   F + S  G +  ++ +DRE    +++ I  +D+GIP + ++ ++ + + D+NDN P F     + L+  ++ E++     + ++   D DK   S++T +++  S      L                             KI+  +   I  R  ID R +D  + + ++  D G+ P  + V + I +  +    +P       S   ++ EN +  + +  V+ TD       GR+ Y I  S+      F I   +GV+      D E +  +  +V   D   PS      V + + D ND  P+F  +   Y+       P   ++ +++  D+D G NG+V   +Q   D  S A   + G I  +R +D ET     + + A D G  P  + ++V I V D+NDN P F  P  N  + V  +  +  +L  +I A D D G N  + F     V+            +  F ++K +G +T  +    +     +  + I A D G PPLSS + I +++ +
Sbjct: 1951 VIGNIQDDPPRFLNQTPARVSIPENS---KVGSYITTVRARASSDAQVTYSIISGNKG--RAFYVDPFTGV----ISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFH-PSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI----WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF-----DPLSEVNIREDTRTGAVVTSVVATDTDK--ESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDA-DTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELP-------SYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN-----YFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSG--YMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPN-DVQVLENLPLNSRLY-EINATDRDSGANARLSF----TVIGGT--------GQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVAD 2612          

HSP 10 Score: 119.398 bits (298), Expect = 4.293e-27
Identity = 129/527 (24.48%), Postives = 233/527 (44.21%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHEN-------------------RLP--MKIGSLP-------SAFDKDFGQTSKLEYRLH-GNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVN-GEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIR--DHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMIL 1967
            +V D+NDN P F D    + I E+                   RL   +K  S P       SA D+D G  ++++Y     N DQ+  + I +   +   +  +   I   R+S  +     + + V    A + +++ I  E    PKF + S      ++ EN  +GT ++   VTD   G+  G I Y++ N +  +         + G + V++ +D E +  + + +SA D+  P++   + ++I + DVND KP  +      +  +S  E   + T +  +   DKD G N ++   I+         +++        I+T+ A+D E      + ++  D G  P+ + V++TI V+D NDN P+     G  + ++ EN    S + ++ ATD D   N RL + +       +  F ID  +G + + I FD E   +Y++ + I+  D G P LS++ T+ V + DE++  P F   +     +  N      +  +T  DRD G  G+V  + 
Sbjct: 2163 VVTDLNDNPPLF-DPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQID-YKIDADTGVISARRTIDVRI---RDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPS---YFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFR------IGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKP--VFGQSGYMAQWS--EGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDR----KTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRV-PGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGL--FLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMD-YKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVF 2659          

HSP 11 Score: 99.3673 bits (246), Expect = 5.703e-21
Identity = 95/397 (23.93%), Postives = 177/397 (44.58%), Query Frame = 3
Query:  558 LPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIK------SIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE----AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDG--QLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINE-SDTLSMSQFSIDSETGVV 1703
            LP   G +P   +     TS L  R+  N   L L  I       + F + +    +  +   D E+  +  F L+   +DD       ++ + + + D ND  P F  +       Q  E   +GT ++  +  D D G NG + +++ + D   S    F + +K G +     +D E  + + +++ A+D G P   + + + I +LD+NDN P F +   N +    V EN  +++ +  I   D+D G N++++  +   +      ++K   +    + T +  D E     Q  + +K  D+G  PL S++TI ++V D+++  P    N     +++  N     ++ QV ATD D  D GR+ + F N  S+ L M     ++ TG++
Sbjct: 2306 LPSYFGKVP---ENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYET--KRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSG---YMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS----FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQ---VLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGW----LTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF--NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKM-----NATTGII 2676          

HSP 12 Score: 56.225 bits (134), Expect = 7.415e-8
Identity = 77/288 (26.74%), Postives = 114/288 (39.58%), Query Frame = 3
Query: 1695 GVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEG---------INGKVS----MILQENTD---YFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKL-----ITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP-PLSSTVKIEISIVE 2492
            GV+ +K V DRE    Y   +   +   P    S TV V + D NDN P F       L + EN         L   D D G         ++G V     +I + +TD   Y  L  N        +DRE    + L I A D G       + + I V+D NDN P F         NVS+  T+ + +     I +++A D D G N  I +             E+  D +  F ++   G I     L    +R  LI++ A+D G    LSS+  + I +++
Sbjct:   12 GVITTKTVLDREKVSAYNLTIV--EFSTP--PKSYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKD--FRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNAS---SIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEF--------SNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSI-----------ETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLD 271          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 206.453 bits (524), Expect = 3.666e-54
Identity = 167/568 (29.40%), Postives = 289/568 (50.88%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIM-IKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS-VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRDEGINGKVSM-ILQENTD--YFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFP 2165
            V D+ D+ P F      +++ EN       +  +A DKD G T  + Y +  N D   LF+I ++        E+ +    DRE+V +Y  ++ AKD  +  + ++ + V++ D ND+ P F +    I+    +E    GT I+     DAD G N  ++YS+  N  D      +   +S       S  +DRE+ E++  TI A+D+G+P++ S+  + I+++D+NDN P F     N  ++Y+ V EN    T +  +   DKD G N+K++  +    ++++     I+  +   I TR  ++RE+ G   + L+  DS +     +  + I V D ND++P   T +G   + + E+      + +V  TD DI DN R+ Y+I+  +T  M  FS++  TG++ +    DRE    Y  I+  +DHG P+L ++ +V +TI D NDN P+F  +  +Y +T+ E+      ++ +   D DEG NG+ +  I   +TD  ++  A  G I++K  +D E  S + L + A+D G  P + +  V I V D++DN+P F  P
Sbjct: 1182 VTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDT--ISYSI-ANGDPYGLFTIDNVTG------EIRTVAELDRENVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIE---YWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVIS-----LGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVF-----NNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRF----AIDP-DTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF-TQSG-YAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLM--FSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF--SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKP 1716          

HSP 2 Score: 179.874 bits (455), Expect = 9.521e-46
Identity = 191/715 (26.71%), Postives = 327/715 (45.73%), Query Frame = 3
Query:  411 NTCSIELIVQVTYSKNI--KILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGN-KDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLY-LTIIENTNPPYALIHLTCKDRD-EGINGKVSMILQE-NTDYFSL--AENGKISLK-RP---IDRETHSEFKLKIIAKDH-GLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYT--VGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKC---LIIIYAKDLGYPPLSSTVKIEISIVE 2492
            N    EL VQ   S N+   +L  +  VED+NDN P F    + ++  E   P     L   A D D G  + + Y +  N  D + + +I  +  L   +         DRE    + F + A D  V    +   + ++++D ND+ P F+   N      + EN   GT +++   +D D G N ++ Y L+    T+  I P      G++   E ++RE    Y +T+ A D+ I  +  + ++ I + D ND+ P F   TQ+    +SV E+ ++   +G +   D+D   N+++  +I   + S    + +        I T   +DRE++    +++   D G+  L S+ ++ I + D NDN P+   +    N  + E+    + + QV ATD D   NG+  Y I   DT  +  F ID+ TG++  K   D E   LY   V  +D G P L+ +  V + + D +DN P+F    P Y   + EN    + +I +   D D E  + +V   ++  NTD   L   ++G I+L   P   ++RETH+ ++L++ A     L  Q S +  VI V D+NDN+P F   D    +    + T  +    I  + A D D G++G I+F     ++  N+           F ++   G +T     +PL R       +++ A+D G P LSS+V + I++++
Sbjct: 1257 NVTQYELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEES-PEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQ--------LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFN---NTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDP----DTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF---TQSGY-AFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTG----IISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSV--YNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV--FYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFH--KPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF---DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIF----TIVSGNE--------NGVFQMDNKTGVLT---RTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLD 1923          

HSP 3 Score: 179.489 bits (454), Expect = 1.020e-45
Identity = 187/709 (26.38%), Postives = 326/709 (45.98%), Query Frame = 3
Query:  474 FLFLVEDINDNVPQFEDKFHVLQIHEN-RLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKF---QIYENCRIGTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGT--IEVIDKDKG-FNSKITCHI---EENSFS-----------KYLKLEKIEIFNIFKIQ------TRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTS-ATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTD--YFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITL-INSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            F  +V+D NDN P F ++ ++ +I EN R+   I  + SA D D G  S+++Y+          F     F LN    EL      D E    YM  +IA+D  V   E++  + + + D +D  P+F      +Q F   +I EN  IG+ ++     D D G+N  I+Y +   N D        F + S  G + V+ +ID E  + + IT+ AS+   P   +++ + + ++DVNDN+P F LQ+  I   + V E+  +   + +  ++V D DK     ++  H+   + + F+           K L  EK +I   F  +           D    G+   V+       +   ++ ++T+ +++ NDN P+   +  S N+ + E     ++I  + ATD D+   G L Y +        + FS++++ G + +  + D +    Y+F + ++D G      + ATVTVT+ D NDN P  FT  P    I EN      +  +T  D+D G NG++S  +    D  +FS+  +G ++  R +DRET + + L + A DHG+  +   + + + V D NDN+P  I     +  N+S     G  L++ I AVDPD G NG + +              S+      F++N   G + +    L    +    +II   D G PP +++  + ++I++
Sbjct:   32 FFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKI-SAIDADSGTNSQVQYKFSNATATQTPF-----FSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRF------LQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGV------FTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAF-LQSVYI---FDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEK-QINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKS--SYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGG---QAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPE-FTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQ-ITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTY--------------SMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILD 696          

HSP 4 Score: 166.777 bits (421), Expect = 8.994e-42
Identity = 154/558 (27.60%), Postives = 257/558 (46.06%), Query Frame = 3
Query:  828 NDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKK-GSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLN-WEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVK-SKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQE--NTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            ND  P F      +    + E+   G  I     TD DEG+N  I YS N  +        FY+S+  G + V   +DRE +  Y + ++A++     Q ++ ++HI + DV D+KP F   +  +     + EN+ I TN+  I  +DKD G    I+  I          ++ +      +I+T   +DRE   Q  + ++  DS ++ +   + + + V D NDN P+      ++  WE S      + I QVKA D DI DN  + Y I E+ T      ++++ TGV+       DRE+++ + F +   D G PS S++A+V + ++D NDN P+F   +  Y  + EN      ++ +T  D+D G N K+S +L     T +    + G I+ + P++RE    + L + A D  +R +  +  V+I V D ND+ P F         +V  D  VG   + ++   D D   N  + ++             S  ++   FSVN+  G I+  ++L         +II AKD G P L S   + I+I
Sbjct: 1083 NDESPLFE---KSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAE------AKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTV----KLSENASIGTNVTKITALDKDIG--DTISYSIANGDPYGLFTIDNV----TGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEG---TSILQVKAIDADIGDNAAVLYSIVENVT---DYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTD-YYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFT--QSGYAFSVREDVKVGHT-VGRVATTDEDINDNARVRYYI------------SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITI 1598          

HSP 5 Score: 165.622 bits (418), Expect = 2.256e-41
Identity = 184/687 (26.78%), Postives = 292/687 (42.50%), Query Frame = 3
Query:  447 YSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVT--DADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSE-NIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSV---EENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREK---------DGQLLMVLKCCDSGL---DPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWE--ISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENT--DYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSI--NVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLII 2423
            + + I I      ++D+NDN P+F    +   I EN     I    +A DKD G+  +L + +    D    FSI     +   +         DRE++  Y   + A D  V      + + V +LDEND+ P+  +         I E    GT ++L ++   D D G NG++ YS++  D        F + S  G L +S   +DRE+++ Y++ I+ +DNG P   +S  +H+ ILDVNDN P F       L  Y +   E    I+  +  I   D D   N K+   +  +    + +L+ +      ++  R  +DRE          DG+ L+ +   D      D   ++V ++I V D NDN P       S N+E  +SE     S + QV ATD D++  G++ Y I + D     +            K+V  R      K  V  ++  K S+  +  V + + D NDN P+ F  +     ++EN+     ++ +   DRD+G NGK++  L      D FS+    G+I++   IDRE    F L + A+D G  P S      VVI VKD NDN P F F     +  ++ +  VG                   I    D+ +  S   P S   +       ++   ITLIN   PLF +    +
Sbjct:  471 FYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH-FSINGSGLVTTAR-------ELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQ--ITDGLTITTNISEGAGGGT-VLLSSIAAVDPDAGSNGQLTYSMSGGDSR------FTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHG-FFRLDPV----TGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQ----SQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEV----------EKLV--RHYNWHKKNCVLCKES-KCSVERTY-VVIYVDDVNDNDPV-FNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQG-EPSSRKTFAEVVITVKDENDNFPQFSF--TGYEGEIAENSPVGS-----------------TITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYV 1096          

HSP 6 Score: 163.696 bits (413), Expect = 8.917e-41
Identity = 181/695 (26.04%), Postives = 301/695 (43.31%), Query Frame = 3
Query:  126 FVMP-YQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSEN-IDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQ-DNGRLHYFINESDTLSMSQFSIDSETGVVK----SKIVFDRELQDLYKF-IVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCK--DRDEGINGKVSMIL---QENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFP 2165
            F MP Y   Y+     EE P+GT +  VK       A+D    DN++       ++   + +N  +GV+   +   +D   E        +      + S       T S  IK++       DINDN P F +  +   + EN+       + +A DKD G  +KL Y L G         + + F ++     + +    +RE    Y   L A D  +   E    + + + D ND VP+F   +     F + E+ ++G  +     TD D   N  + Y +++ + +    L F +++   +  + + +DRE    Y + I+A D+GIP   S+  + I I DVNDNKP F     N+    ++ E+  + T +  +   D D+G N + T  I          ++     N   I  +  +D EK     + +   D G  PL  +  + I V D +DN P+   +    + E+ EN  +  ++  V ATDID +  + R++Y I   +T SM  F I  ++GV+          +RE    Y+  +  I         +     +T+LD NDN P F  +     +++E+T P      LT K  D DEG +G++   +    EN  +    + G ++  RP+DRE  S + L ++A+D G    SSS+ V I V D+NDN P    P
Sbjct: 1294 FSMPGYTIEYW-----EESPEGTSILQVK-------AIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSS-QLDREVEEYFNFTIRATDSGVPSKS------STASVAIKLV-------DINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG--------VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF---TQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTS----LMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNV----TLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDA----NTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVF--HKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSM--FLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF-DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTP 1934          

HSP 7 Score: 162.155 bits (409), Expect = 2.332e-40
Identity = 170/678 (25.07%), Postives = 308/678 (45.43%), Query Frame = 3
Query:  495 INDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDV--DDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM----SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVE--ENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIE-IFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSM-ILQENTD-YFSLAENGKISLKRP-IDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCL--IIIYAKDLGYPPLSSTVKIEISI 2486
            IND  P FE   + + + E+     +    +A D+D G  + + Y  +G + +         F+++    ++      DRE  N Y+  + A ++     +    + + + D  D  P F+ +S  ++   + EN  IGT +    +T  D+ +   I YS+ N D       P+ +    +  G +     +DRE    YE+ + A D+ +      +K+ +++ DVNDN P F +        Y++E  E S   T+I  ++ ID D G N+ +   I EN  + Y+ +  I  + ++   Q    +DRE +      ++  DSG+    S+ ++ I +VD NDN P+ + NT    + + EN    + +  V A+D D+  N +L Y ++    +  ++F+ID +TG + ++   +RE    Y   +   D    +   +  V +T+ D ND+ P F T +    ++ E+    + +  +   D D   N +V   I   NT   FS+ E   I      +DRE ++ + L I AKDHG+    S+ +V+I ++D+NDN P F     N+ +  S      K  + ++ A DPD G NG   +              +  D+   F ++ + G IT+   L   + +  L  + + A+DLG PPL+    +EI +
Sbjct: 1082 INDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAK---------FYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVK---LSENASIGTNVT--KITALDKDIGDTISYSIANGD-------PYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVFSMP------GYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVEN-VTDYVTVNAITGVISLGSSQ----LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFN-NTDYYAY-VRENQPAGTPVLVVTASDKDVGTNAKLSYVLS---GVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF-TQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESV---FLKTQVVQVIATDPDEGANGQFTYKI------------TAGDTDDVFYIDANTGLITIKAKLD--YEKTSLYNLTVSAQDLGTPPLTGACFVEIHV 1703          

HSP 8 Score: 151.369 bits (381), Expect = 5.922e-37
Identity = 144/532 (27.07%), Postives = 244/532 (45.86%), Query Frame = 3
Query:  762 LIAKDVDDNE---AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIK-IHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYI-NQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVK-SKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMF--FTANPLYLTIIENTNPPY----ALIHLTCKDRDEGINGKVSMILQ-ENTDYFSLAE-NGKISLKRPIDRET---------HSEFKLKIIAKDHGLR---PQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFH 2279
            ++A + D +E   A   + + +++ ND+ P F  +S     + + E    GT I     TDAD G  G + Y L    R          +  G++  ++ +D +    Y+ ++   D G   Q  +I  + + + DVNDN P+F      +     + EN    T +  +   DKD G N +++ +I       +  +    +     + T   +DRE      + +   D G+      V +T++V+D+NDN P + T+  ++   ISE     + + + + A D D   NG+L Y ++  D    S+F+++S TG ++ S    DREL+D Y  I+ + D+G P  + S TV VTILD NDN P F    A  L   +I     P      LI +   D D   NGKV+  L  +   +F L    G++S+++ +DRE+            F L I A D        +S+++ V I V+D NDNSP   F  +N +  +S     G  +I +++A D D    G ++++
Sbjct:  358 VVATETDTSEKFSANASVTLTLINVNDNKPMFAKSS---YNYTMDEEITPGTHIADITATDADLGTFGALTYEL----RGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFT----GMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSGL-----VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI-TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD----SRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQ--FQSQNYETRLSEAARPGSNVI-QVSATDQDLEYKGKVIYN 865          

HSP 9 Score: 144.436 bits (363), Expect = 7.663e-35
Identity = 171/677 (25.26%), Postives = 294/677 (43.43%), Query Frame = 3
Query:  492 DINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIK---VRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNI-GTIEVIDKDKGFNSKITCHIE--ENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTG-SLNWEISENNIKFSYINQ----VKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRE-------LQDLYKFIVFIR--DHGKP-SLSTSATV--TVTILDENDNFPMFFTANPLYLT-IIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            ++NDN P F    +   + E   P    +  +A D D G    L Y L G +         + F +N     + +    D +++ +Y F L+ KD      +I I    V + D ND+ P+F   +       I EN   GT +     TD D G NG + ++++  D        F ++  G +  +  +DRE    Y +T+SA D+G+ ++   +++ + +LD NDN P     T  +    ++ E +   T +  +I  +D D G N ++T  +   ++ F+      +++I       +   +DRE      +++   D+G  P  +S T+ + ++D NDN P  D N   SL   +   +     IN+    + ATD D   NG++ Y ++  +      F +D  TG +  +   DRE        Q   +F++ I   D   P S   SATV  ++T+ D NDN P F + N  Y T + E   P   +I ++  D+D    GKV   + +        EN K  +++ + R  +   K  ++ K+     + +   VVI V D+NDN P  +F       +V  +   G  ++ ++ A D D G NG I +          K+    KD    FS+N   GEIT+   +        ++ + A+D G P
Sbjct:  381 NVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQ--------AAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEF---TGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGH----FSINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQI---TDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQI-------SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDE---HGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQN--YETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGD------ENRKCEVEKLV-RHYNWHKKNCVLCKESKCSVERTY--VVIYVDDVNDNDP--VFNQSKYAADVLENSPTGTPVL-RVHASDRDQGANGKITY----------KLTNGNKDDA--FSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEP 1003          

HSP 10 Score: 140.969 bits (354), Expect = 1.053e-33
Identity = 152/586 (25.94%), Postives = 251/586 (42.83%), Query Frame = 3
Query:  153 YLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHEN-RLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVE--ENSEIDTNIGTIEVIDKD-KGFNSKITCHIEE-NSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQL-LMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIE 1883
            Y   ++E QP GT V       L   A DK    N+                   SGVL T+  ID D+   + +E   N +   + T ++  +     ++       +  V D ND+VPQF    +   + E+ ++   +G + +  D+D    +++ Y +      L       +F +NE    + +  + DRE    Y   + AKD  +   E+   + + I D ND+ P F   S  +    + E+  + T+++    TD DEG NG+  Y +   D        FY+ +  G + +   +D E    Y +T+SA D G P    +  + I + DV+DN P F          YS E  EN     ++ T+   D D +  + ++   IE  N+ S +L  E+  +  +        ++RE   +  L V       L    S V   I V+D NDN P  D+ +   +       I  + I  VKA D D  ++G + + I   +   +  F +D++TGV+      DRE    Y  +V   D G+P+LS+S TV +T+LD NDN P+  T  P+ + I E
Sbjct: 1404 YYAYVRENQPAGTPV-------LVVTASDKDVGTNAKLSYV-------------LSGVLYTRFAIDPDTGNITTREPL-NREETGSYTLTLRAVDSAIRARE-GTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATT-DEDINDNARVRYYISSGNTSL-------MFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF---SKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV----FYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKP------RYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITL-NCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNENGV--FQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQT--PMDVLIPE 1941          

HSP 11 Score: 125.946 bits (315), Expect = 4.251e-29
Identity = 196/809 (24.23%), Postives = 325/809 (40.17%), Query Frame = 3
Query:  138 YQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVL-QIHENRLPMKIG-SLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYEL-FSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVN-SNKIQKFQIYENCRIGT---EIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREF---------YEITISASDNGIP---TQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEK-IEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPS-LSTSATVTVTILDENDNFPMF-FTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +  + Y   I E  P GT V  V     ++    +   + S+ +  G  SIN        SG++ T   +D     E+I        +++    S    VQ+T       +N L    D NDN PQ  D   +   I E      +  S  +A D D G   +L Y + G           S F LN     L  S    DRE  + Y   +   D     N     + V ILD ND+ P F  N +  +  + I  +   GT    +I  N TD D   NG++ YSL+ ++    ++ P      G L V + +DRE  +          + + I+A+D   P    + +++++ I + D NDN P F  Q+QN     S  E +   +N+  +   D+D  +  K+  +I +   ++  ++EK +  +N  K          K+  L    KC        +    + I V D NDN P+   N      ++ EN+   + + +V A+D D   NG++ Y +   +      FSI++ TG +    V DRE    +   V   D G+PS   T A V +T+ DENDNFP F FT    Y   I   +P               +   ++M+  +     +L         RP  R +       + A++   RP          +  IND SP  +F      +NVS   + G  +I ++TA D D G N +I +              S   ++  F V++  G+I + + L   F+   ++ + A ++      +T ++ I++ +
Sbjct:  494 FTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSING-------SGLVTTARELD----RETIATYTLTVSAYDHGVSSRHKHVQLT-------VNVL----DENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGD---------SRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFFRLDPV----TGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF--QSQNYETRLS--EAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHK----------KNCVLCKESKCS-------VERTYVVIYVDDVNDNDPVF--NQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGN--KDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTG---YEGEIAENSP---------------VGSTITMVPDQKISSSTL---------RP--RSSPRAPAALLTAREK--RP----------ITLINDESP--LFEKSMYYVNVSESASRG-IVIGRVTATDRDEGINAIIFY--------------SSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTD 1184          

HSP 12 Score: 65.855 bits (159), Expect = 8.640e-11
Identity = 126/502 (25.10%), Postives = 211/502 (42.03%), Query Frame = 3
Query: 1065 IREFYEITISASD--NGIPTQMSSIKIHIEILD-VNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAI----DREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYL-TIIENTNPPYALI----HLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKL-----------------------KIIAKDHGLRPQ-SSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKL-----ITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLG 2444
            I++ YE T+   D  NG        K    I+D  NDN P F  Q         + EN+ + T I  I  ID D G NS++     +  FS     +    F++  +   L +    D E     ++V+   D G+  L S  T+ I+V D +D +P     +  L  EI EN    S +  V+A D D+  N  + Y I   +  S   F+IDS TGV+      D E  D+++  V   +   P+ +T+ TV VT++D NDN P F  +  +Y+  + E+   P  ++     +T  D++      +  ++  ++D F++   +G + + + +D E    F                         K++A +     + S++ +V + + ++NDN P F           S++YT+ +++     I  ITA D D G  G + +             E       +FSVN DNG I+    L     R+    +  KD G
Sbjct:    5 IQDNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPY----MAKIAENARVGTTILKISAIDADSGTNSQV-----QYKFSNATATQT-PFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISD-MPPRFLQSFYLK-EIEENTPIGSTVVTVEARDGDVGINNPILYEIISGN--SDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQS--VYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYINKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMF--------AKSSYNYTMDEEITPGTHIADITATDADLGTFGALTY-------------ELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGG 469          
BLAST of Protocadherin vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 195.282 bits (495), Expect = 1.548e-51
Identity = 179/687 (26.06%), Postives = 302/687 (43.96%), Query Frame = 3
Query:  477 LFLVEDINDNVPQFEDKFHVLQIHENR---LPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHIS----FDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFI-----RDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            L  + D NDNVP+F    +   I EN    +P+++ S   A D+D    + + YRL+G+       SI+  F +N     + + +S     D E    Y F++IA D     +E+   + + +LD ND+ P+F  +S  IQ   I E   IG  +      D D G+NG I +S+N+    K +I        G + VS ++DRE +  Y + +SA D     +     + + + DVNDN P F     N+     V E   + + I      D D+G N+ IT  +    F+       + I       TR  +DRE        +   D G   L S+V + +++ D+NDN P   T       ++ +     + +  V A D D+ +NG + Y I       +  F I  +TG + +    DRE Q LY  + ++      DHG    ++ A + +++ D NDN P F   +    T++EN      +  +T +D D GIN ++   L      FS+    G+I L++ I+RE    + + I A D G    SS   V + V D+NDN P  +F  +  +  +S       + + ++ A D D  +NG + +     ++H          +   F++N+  G I     L    +    +I+ A+D G  P      I++ +++
Sbjct:  210 LVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSD------SIQ--FAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSS--IQS-TISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEI----GRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNV----DVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINSNTGSVTI-------TR-PLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTV--QYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQF-NQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPP--VFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTY----TIMHG---------ALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVID 843          

HSP 2 Score: 181.415 bits (459), Expect = 5.508e-47
Identity = 191/686 (27.84%), Postives = 289/686 (42.13%), Query Frame = 3
Query:  483 LVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP-SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIK-VRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFN---VTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLT-IIENTNPPYALIHLTCKDRDEGINGKVS---MILQENTDYFSLAENGKISLKRPIDRETHS-----EFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +V D+NDN P F    +   + EN  P+    L  +A D D GQ + + Y +          ++  +   N    E+  ++  DRE  + Y   + A D  V  +   I I  VRILD ND+VPKF   S+      I EN   G  + + +    TD D   N ++ Y LN  D  +  + P        +    ++D E    Y   + A+D       S  ++ I +LD NDN P FI  +       ++ E + I  ++  +   D D G N +I   I   S  K+   E      + ++   L  DRE     ++ +   D    P     T+T+ + D NDN P       + N ++SE     S I    ATD D   N  + Y      ++S   F+I+S TG V      DRE +  Y F V  RD G   L ++  V V I DENDN P F T    Y T +I+ T     ++ +  +DRD G NG V+   +IL     +  + + G I+    +DRE  S      + L +   DHG+   +S   + I V D NDN P F          V  +  VG K +T +TA D D G N  I++              SL      FS+    G+I L  ++    +    + I A D G P LSS  K+ + +++
Sbjct:  103 VVGDLNDNNPVFNPTNYSTTVFENS-PVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKV--SNHGTIEVAGNL--DREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKF---SHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSI----QSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKF---EIGRSDGVVRVSGSL--DREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKF--TKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITY------SMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQ--YQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP----FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQF--NQSEYSATVLENMPVGTK-VTMVTARDEDSGINSQIMY--------------SLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLD 738          

HSP 3 Score: 174.096 bits (440), Expect = 1.327e-44
Identity = 143/541 (26.43%), Postives = 254/541 (46.95%), Query Frame = 3
Query:  903 GTEIILFNVTDADEGVNGEIVYSL--NNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNH-YSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEE-NSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTIT-IDVVDKNDNIPIVDTN--TGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKI----VFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDY-FSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISI 2486
            G  I     TD+D+G NG++ YS+   N    +S          G +  + N++R+    Y +TI A+D+G+P+  ++ ++ I + D+NDN P F     N  N+  +V ENS + T++  +   D D G N+ +T  +   +S   +  + K+      ++   L  DRE +    + +   D G+    +++ I  + ++D+NDN+P       TGS+  E S   +     + + ATD DI+ N  + Y +N SD++   QF+++  TGV+ +++      D E    Y F V   D       + A V + +LD NDN P F  ++ +  TI E  +   ++  +T  D D G+NG++   +   ++  F +   +G + +   +DRE  + + L + A D    P+     V + ++D+NDN+P F  P  N+  +VS    VG  +I   TA DPD G N  I +                  S   F++N + G +T+   L    ++     ++A+D G   L S V + + I
Sbjct:   20 GVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVF-----NPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNL--DREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSI-QENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSI---QFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSS-IQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNV--DVSEGVAVG-SVIVNATATDPDQGSNAAITYSM----------------SYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEI 527          

HSP 4 Score: 167.162 bits (422), Expect = 2.082e-42
Identity = 157/578 (27.16%), Postives = 255/578 (44.12%), Query Frame = 3
Query:  588 AFDKDFGQTSKLEYRL-HGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNED-----RTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIH-IEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNI---GTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAEN---GKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILF 2276
            A D D G    ++Y +  GN    R     S F L+     + +  + +R+    Y   + A D  +    A   + + + D ND+ P F+  +       ++EN  +GT ++    TDAD G N  + YS+   D     R  +K+     S  G++ V+ N+DRE+ +FY +TI+A+D G+P   ++I I  + ILD NDN P F     +     S++ENS     +    +I   D+D   N+ +   +  +   ++    +  +    ++    ++D E+       +   D       S   + I V+D NDN P    +  S+   ISE       + +V A D D   NGR+ + IN     S  +F I    GVV+     DRE + +Y   V   D          TVTVT+ D NDN P  FT     + + E       +++ T  D D+G N  ++  +     Y   A N   G +++ RP+DRET   +   + A+D G    + ++NV  E+ D NDNSP   FP    Q +V  D T    ++  + A D D G NG + +
Sbjct:   28 ATDSDDGANGDVDYSIVDGNVGDPRS---NSDFTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTN---YSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKV-----SNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKF----SHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITT-RVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPS--SIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSG---SEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPK-FTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS----YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNV--EIGDENDNSPQ--FPTVQYQTDV-IDRTPVGTIVLAVNAEDRDVGNNGHVTY 574          

HSP 5 Score: 157.532 bits (397), Expect = 2.074e-39
Identity = 128/469 (27.29%), Postives = 217/469 (46.27%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSL---PSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQ-KFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM-SKKGSLFVSENIDREIREFYEIT-----ISASDNGIPTQMSSIKI-HIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNI----FKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFS-YINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPM 1844
            ++D+NDN P+F      + + E    + +GS+    +A D D G  + + Y +               F +N     +      DRE+   Y F + A+D    E+ + + V I DEND+ P+F      +Q +  + +   +GT ++  N  D D G NG + Y++         ILPF +    G++  S  +DRE +  Y +      +S +D+G+ TQ +S  + +I + D NDN+P F     +     +V EN  + T +  +   D+D G NS+I           Y       +F+I     +I+ + AI+RE      + +   D G   L S   + + V+D NDN P+  +        +SE N     ++ QV ATD D++ NG + Y I      ++  F+I+  TGV++++ V +RE +D Y  IV  RD G        T+ V ++D+NDN P+
Sbjct:  428 LQDVNDNTPKFTKPAFNVDVSEG---VAVGSVIVNATATDPDQGSNAAITYSMS-----------YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPT----VQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI--------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGV-TQFTSFALLNISVTDFNDNQPQFNQSEYSA----TVLENMPVGTKVTMVTARDEDSGINSQI----------MYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRV--YERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHG---ALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 6 Score: 143.665 bits (361), Expect = 5.812e-35
Identity = 155/576 (26.91%), Postives = 246/576 (42.71%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSH-------ISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDF-ILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMV-----LKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYA--LIHLTCKDRDEGINGKVS-MILQENTDYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSP 2150
            V D NDN P+F        I E     +  +  +A D D G   ++             FSI S    +E K+E+           S DRE+   Y+  + A D      E    + V + D ND+ PKF   +       + E   +G+ I+    TD D+G N  I YS++          P +   S  GS+ ++  +DRE ++ Y  T+ A D G     S++ +++EI D NDN P F  +Q Q       V + + + T +  +   D+D G N  +T  I        L L  I + +   I T   +DRE+     +V     L   D G+    S   + I V D NDN P    N    +  + EN    + +  V A D D   N ++ Y +   D +    FSI+  TG ++ +   +RE ++ Y   +   D G P LS+ A V V +LD NDN P+F +   +Y   +   N      ++ +   D D   NG V+  I+      F++ E  G I  +  ++RE+   + L ++A+D G  P      + + V D NDN+P
Sbjct:  324 VLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRI------------FFSINS---GSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKF---TKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS---------YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQT-----DVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI--------LILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQP--QFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGV----FSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSR--VYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 256.914 bits (655), Expect = 6.487e-71
Identity = 225/789 (28.52%), Postives = 360/789 (45.63%), Query Frame = 3
Query:  111 LLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            LL   ++ P      + PI+EE  +   +GN+ K+  + + +       N  + L  K+  + L+++   +G +  T  RID + LC           S     CS E+ V V  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D    +  +  +++V + D ND+ P F  N  ++    I EN  IGT ++    TDAD G N EI Y    +    +K L    S  G + V   +DRE    +++++ ASD    +  +   + I + DVNDN P+  L+     I     + E   I+T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI       +   + ENN +  ++  + ATD D   N  + Y +      + S F +D +TGV+ +  VFDRE QD + F V  RD+G P L   A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  +S+ IL +N ++     +G I      DRE  S +   + A D G  P SS+  V I V D+NDN+P  I+P  N    +    ++   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   12 LLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPG--------SSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVH---IPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGP----NASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPK-FTHNHFQFFVSENL-PKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 124.79 bits (312), Expect = 1.399e-28
Identity = 144/566 (25.44%), Postives = 244/566 (43.11%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNV--TDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEE--NSFSKY----LKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPPY--ALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N+  T A  G +  +VY L +  +     L   +   G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G NS    H  E  N  S +    ++  + E +    +Q  L  DRE+    +M +K  D G     S+  + + V D NDN P+   N   +   I EN+   + + Q++ATD DI  N  +HY F  +    +   F+++S +G++  +   DRE   ++K  V   D    S    ATV + + D NDN P   + +  +P+  T+  +   P    +  +T  D+D  INGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +       +T ++A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G PPL +   + +++++
Sbjct:   33 ELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS--KAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTGPNS---VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN--QIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNKRDLFLTTLSATDEDSGKNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 256.529 bits (654), Expect = 2.783e-70
Identity = 225/789 (28.52%), Postives = 360/789 (45.63%), Query Frame = 3
Query:  111 LLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            LL   ++ P      + PI+EE  +   +GN+ K+  + + +       N  + L  K+  + L+++   +G +  T  RID + LC           S     CS E+ V V  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D    +  +  +++V + D ND+ P F  N  ++    I EN  IGT ++    TDAD G N EI Y    +    +K L    S  G + V   +DRE    +++++ ASD    +  +   + I + DVNDN P+  L+     I     + E   I+T I  I V DKD   N K+ C IE++    +LK     ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI       +   + ENN +  ++  + ATD D   N  + Y +      + S F +D +TGV+ +  VFDRE QD + F V  RD+G P L   A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  +S+ IL +N ++     +G I      DRE  S +   + A D G  P SS+  V I V D+NDN+P  I+P  N    +    ++   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   12 LLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPG--------SSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVH---IPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKD-VPFHLK----AVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGP----NASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPK-FTHNHFQFFVSENL-PKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 125.176 bits (313), Expect = 1.501e-28
Identity = 144/566 (25.44%), Postives = 244/566 (43.11%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNV--TDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEE--NSFSKY----LKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPP--YALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N+  T A  G +  +VY L +  +     L   +   G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G NS    H  E  N  S +    ++  + E +    +Q  L  DRE+    +M +K  D G     S+  + + V D NDN P+   N   +   I EN+   + + Q++ATD DI  N  +HY F  +    +   F+++S +G++  +   DRE   ++K  V   D    S    ATV + + D NDN P   + +  +P+  T+  +   P    +  +T  D+D  INGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +       +T ++A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G PPL +   + +++++
Sbjct:   33 ELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS--KAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTGPNS---VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN--QIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNKRDLFLTTLSATDEDSGKNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 256.529 bits (654), Expect = 3.071e-70
Identity = 224/789 (28.39%), Postives = 357/789 (45.25%), Query Frame = 3
Query:  111 LLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNV-KNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNE--AKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQ--TQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIF-NIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIH-LTCKDRDEGINGKVSM-ILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            LL   ++ P      + PI+EE  +   +GN+ K+  + + +       N  + L  K+  + L+++   +G +  T  RID + LC           S     CS E+ V V  +   +++    +V+D NDN P F      + I EN L     ++PSA D D G  S  +Y L   +    L  +++     E   +L    + DRE  + Y+  +  +D    +  +  +++V + D ND+ P F  N  ++    I EN  IGT ++    TDAD G N EI Y    +    +K L    S  G + V   +DRE    +++++ ASD    +  +   + I + DVNDN P+  L+     I     + E   I+T I  I V DKD   N K+ C IE     K +      ++ N + ++T   +D E   +    +   DSG   L  +  + + + D+NDN PI       +   + ENN +  ++  + ATD D   N  + Y +      + S F +D +TGV+ +  VFDRE QD + F V  RD+G P L   A V VT+LDENDN P  FT N     + EN  P Y+ +  +T  D D G N  +S+ IL +N ++     +G I      DRE  S +   + A D G  P SS+  V I V D+NDN+P  I+P  N    +    ++   ++ ++ AVD D G N  + +     ++  N        +K  F ++   G ITL     P       +++   DLGYP
Sbjct:   12 LLACIWLDPSIAQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPG--------SSFEDAECSFEIEVVVLPNDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVET--PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVH---IPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE-----KDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPV--IELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGP----NASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPK-FTHNHFQFFVSENL-PKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKY----TIVSGN--------NKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 125.176 bits (313), Expect = 1.458e-28
Identity = 144/566 (25.44%), Postives = 244/566 (43.11%), Query Frame = 3
Query:  879 QIYENCRIGTEIILFNV--TDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSEN-IDRE----------IREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEE--NSFSKY----LKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY-FINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFP---MFFTANPLYLTIIENTNPP--YALIHLTCKDRDEGINGKVSMILQENTDYF--SLAENGKI-SLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            ++ EN  IG      N+  T A  G +  +VY L +  +     L   +   G +F + N IDRE              +EI +    N        IKI I + D NDN P F     NI    S+ EN+ I++        D D G NS    H  E  N  S +    ++  + E +    +Q  L  DRE+    +M +K  D G     S+  + + V D NDN P+   N   +   I EN+   + + Q++ATD DI  N  +HY F  +    +   F+++S +G++  +   DRE   ++K  V   D    S    ATV + + D NDN P   + +  +P+  T+  +   P    +  +T  D+D  INGKV   ++++  +   ++ +N  +      +D E   E+  KI+A D G    + +  V + ++D NDN P F  P   L +    +       +T ++A D D G+N  I++               L  +  FF +++  G +T         + + L  + A+D G PPL +   + +++++
Sbjct:   33 ELQENVLIGNIPKDLNISHTSAATGASANLVYRLVS--KAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECSFEIEVVVLPNDY---FRLIKIKIIVKDTNDNAPMFPSPVINI----SIPENTLINSRFAIPSATDPDTGPNS---VHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNL--DREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFREN--QIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGS--SSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAV---MENNKRDLFLTTLSATDEDSGKNAEIVYQ--------------LGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLD 563          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 240.35 bits (612), Expect = 2.695e-65
Identity = 206/775 (26.58%), Postives = 353/775 (45.55%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESI---KECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN+   +  N            F+   K+    L+++   +G +  T  RID + LC  +   K C Y            E+ V V   +  +++   FL+ED+NDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    + DRE  + ++  +  +D  +    +  +++V I D ND+ P F  +  ++    + EN   GT +   + TDAD G N +I ++ +N+  + +K      S  G + V + +DRE+   +++ + ASD G  +  S   + + + DVNDN P   + T+ I+N  +    + EN+ ++T I  I V DKD     K+ C+ + +     +      +FN  F ++T   +D E   +  + +   D G  PL +S  + I + D+NDN PI       +   I ENN   + + ++ ATD D   N  + Y +      +   F ID  +G++      DRE Q+ + FIV  RD+G   L ++ TV + + D NDN P F   +P Y   +    P Y  + L T  D D G N  +++ +    D F +  + G I      DRE  S +   + A D G  P SS   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +     ++ ++++       +  F+++K +G ITL   +         +++  +DLG P
Sbjct:   30 VKEEQPENVRIGNLLKDLDLNLDPSIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLCSGVFTEKRCYY------------EIEVAVLPDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTEFGLDIIET--PEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEV---SVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGG--STPSRATVIVNVTDVNDNVP--AIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFP--QPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPD---APDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRV-----SPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP 766          

HSP 2 Score: 159.844 bits (403), Expect = 2.094e-39
Identity = 176/667 (26.39%), Postives = 285/667 (42.73%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFH-------VNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK----KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFI-NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENT---------DYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITK------ITAVDPDFGQNGVILFHHDELVLHSNKMP-----ESLKDSKKFFSVNKDNGEI 2372
            + D+NDN P F+D    + + EN       +   A D D+G  +++ +      +    R F+I S   L   K  L      DRE    +   ++A D     ++  + V + D ND+VP          VN   +    + EN  + T+I L  VTD D  + G++    +++       +PF +      +  L  +  +D E    Y I I ASD G P   +S  + I+I D NDN P  I     I    S+ EN++  T +  I   D D G N++I   +  ++   +    +  I ++ K      +DREK  +   ++   D+G  PL S+VT+ + V D NDN P         N+ + EN   +  +  +  TD D  DN  +   I N  D      F ID +TGV+K  I FDRE Q  Y F+V   D G+P  S+ A VT+ ++D NDN P+F   ++N  Y  +   T P   +  +   D D G+N ++   +  +            F++ + +G I+L+  I        +L +  +D G      +I +V + V D   N+ TFI       M    D  +G   +T       I  +    G   VIL      ++   + P     +  K S ++ S N+DN +I
Sbjct:  239 ISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPL------DREVTPVHKLIVLASDGGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVL----LSENAPLNTKIALITVTDKDADLYGKVACYTDHD-------VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAP--IFPQPEI--QLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGK-----RLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKD-----NFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQPESLQAITLVHLFVNDTVSNA-TFIQEQLRKSMETPLDRNIGDSEVTPQANGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHKVVQKGKQSGEWVSPNQDNRQI 871          
BLAST of Protocadherin vs. Ensembl Medaka
Match: pcdh11 (protocadherin-11 X-linked [Source:NCBI gene;Acc:101161492])

HSP 1 Score: 239.965 bits (611), Expect = 6.305e-65
Identity = 206/775 (26.58%), Postives = 353/775 (45.55%), Query Frame = 3
Query:  165 IKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSG-VLQTKTRIDIDSLCESI---KECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS----VEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFN-IFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHL-TCKDRDEGINGKVSMILQENTDYFSL-AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYP 2450
            +KEEQP+   +GN+   +  N            F+   K+    L+++   +G +  T  RID + LC  +   K C Y            E+ V V   +  +++   FL+ED+NDN P F+     + I EN        +PSAFD D G      Y L  +  +  L  I++     +   +L    + DRE  + ++  +  +D  +    +  +++V I D ND+ P F  +  ++    + EN   GT +   + TDAD G N +I ++ +N+  + +K      S  G + V + +DRE+   +++ + ASD G  +  S   + + + DVNDN P   + T+ I+N  +    + EN+ ++T I  I V DKD     K+ C+ + +     +      +FN  F ++T   +D E   +  + +   D G  PL +S  + I + D+NDN PI       +   I ENN   + + ++ ATD D   N  + Y +      +   F ID  +G++      DRE Q+ + FIV  RD+G   L ++ TV + + D NDN P F   +P Y   +    P Y  + L T  D D G N  +++ +    D F +  + G I      DRE  S +   + A D G  P SS   V I V D+NDN P F+ P  N   ++    T    ++T++ A+D D G N  + +     ++ ++++       +  F+++K +G ITL   +         +++  +DLG P
Sbjct:   30 VKEEQPENVRIGNLLKDLDLNLDPSIRLSSPLQFKPVYKTGDVPLVRVEANTGEIFTTNHRIDREKLCSGVFTEKRCYY------------EIEVAVLPDEIFRLVKIRFLIEDVNDNAPLFQSTVINISIPENTAINTRYPVPSAFDPDVGINGIQNYELVKSVTEFGLDIIET--PEGDKWPQLIVQQNLDREKRDTFVMKIKVEDGGNPPKSSTAILQVTISDVNDNRPIFQDSELEV---SVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPLDREVTPVHKLIVLASDGG--STPSRATVIVNVTDVNDNVP--AIDTRYIINLVNGTVLLSENAPLNTKIALITVTDKDADLYGKVACYTDHD-----VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAPIFP--QPEIQLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPD---APDGFHIDRRSGILSVGKRLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKDNFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRV-----SPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQP 766          

HSP 2 Score: 159.073 bits (401), Expect = 4.182e-39
Identity = 176/667 (26.39%), Postives = 285/667 (42.73%), Query Frame = 3
Query:  486 VEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHG--NKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFH-------VNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSK----KGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFI-NESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFF--TANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENT---------DYFSLAE-NGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVV-IEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITK------ITAVDPDFGQNGVILFHHDELVLHSNKMP-----ESLKDSKKFFSVNKDNGEI 2372
            + D+NDN P F+D    + + EN       +   A D D+G  +++ +      +    R F+I S   L   K  L      DRE    +   ++A D     ++  + V + D ND+VP          VN   +    + EN  + T+I L  VTD D  + G++    +++       +PF +      +  L  +  +D E    Y I I ASD G P   +S  + I+I D NDN P  I     I    S+ EN++  T +  I   D D G N++I   +  ++   +    +  I ++ K      +DREK  +   ++   D+G  PL S+VT+ + V D NDN P         N+ + EN   +  +  +  TD D  DN  +   I N  D      F ID +TGV+K  I FDRE Q  Y F+V   D G+P  S+ A VT+ ++D NDN P+F   ++N  Y  +   T P   +  +   D D G+N ++   +  +            F++ + +G I+L+  I        +L +  +D G      +I +V + V D   N+ TFI       M    D  +G   +T       I  +    G   VIL      ++   + P     +  K S ++ S N+DN +I
Sbjct:  239 ISDVNDNRPIFQDSELEVSVPENAPTGTSVAQLHATDADWGSNAQIHFAFSNQISSSTKRHFAINSSTGLITVKQPL------DREVTPVHKLIVLASDGGSTPSRATVIVNVTDVNDNVPAIDTRYIINLVNGTVL----LSENAPLNTKIALITVTDKDADLYGKVACYTDHD-------VPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDRGTPPLNTSAMVLIKIKDENDNAP--IFPQPEI--QLSIPENNDPSTQLIKISATDADSGSNAEIIYTLGPDAPDGFHIDRRSGILSVGK-----RLDREKQERFSFIVIARDNGSTPLQSNVTVRLIVQDLNDNSPAF--THPEYNFYVPENLPLYGTVGLITVTDADAGDNAAITLSILNGKD-----NFIIDPQTGVIKPNITFDREQQSSYTFMVKAIDGGQPPTSSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVRTTTTPGAVVTRVFAIDNDTGMNAELQYSIISSIIITSRVSPRGLFTIDKISGNITLQEKIVGADLGLHRLVVKVRDLGQPESLQAITLVHLFVNDTVSNA-TFIQEQLRKSMETPLDRNIGDSEVTPQANGYVIVVIAIIAGTMTVILVIFVTALVRCRQTPRHKVVQKGKQSGEWVSPNQDNRQI 871          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000035568.1 (SMESG000035568.1)

HSP 1 Score: 1855.88 bits (4806), Expect = 0.000e+0
Identity = 958/961 (99.69%), Postives = 958/961 (99.69%), Query Frame = 3
Query:   93 MQFEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDXXXXXXXXXXXXXXXXXXXXXGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELXXXXXXXXXXXXXXXXIHLMQEKNYISTLRPIKLGAPKYSNPSRTSNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI 2975
            MQFEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDK HVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIE FNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDIFNISVIIIGCISVIIITVMIGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELSSPSSINKNLSMSSSNIHLMQEKNYISTLRPIKLGAPKYSNPSR SNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI
Sbjct:    1 MQFEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKLHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIENFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDIFNISVIIIGCISVIIITVMIGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELSSPSSINKNLSMSSSNIHLMQEKNYISTLRPIKLGAPKYSNPSRISNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI 961          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000035568.1 (SMESG000035568.1)

HSP 1 Score: 1828.91 bits (4736), Expect = 0.000e+0
Identity = 945/948 (99.68%), Postives = 945/948 (99.68%), Query Frame = 3
Query:  132 MPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDXXXXXXXXXXXXXXXXXXXXXGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELXXXXXXXXXXXXXXXXIHLMQEKNYISTLRPIKLGAPKYSNPSRTSNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI 2975
            MPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDK HVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIE FNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDIFNISVIIIGCISVIIITVMIGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELSSPSSINKNLSMSSSNIHLMQEKNYISTLRPIKLGAPKYSNPSR SNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI
Sbjct:    1 MPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKLHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRTKSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIENFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETKSSIYSNKISASNDHDIFNISVIIIGCISVIIITVMIGAVMMLIFQKERNHRYEVDSCLMTSLSGKLTSALNEYELSSPSSINKNLSMSSSNIHLMQEKNYISTLRPIKLGAPKYSNPSRISNYYEVIMPKETLNNQKSQKEITVAYHEPVKKDAELIEI 948          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000072628.1 (SMESG000072628.1)

HSP 1 Score: 257.684 bits (657), Expect = 2.432e-71
Identity = 245/830 (29.52%), Postives = 402/830 (48.43%), Query Frame = 3
Query:   93 MQFEVILLLLQFVMPYQFLY---------YLQPIKEEQPQGTFVGNVKNFILENNALDKTYLDNS-SFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLC--ESIKECCYNSKSHNTNTCSIEL-IVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQIHENRLPMKIGSLP--SAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKD--VDDNEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNN-EDRTKSKILPFYM--SKKGSLFVSENIDREIREFYEITIS--ASDNG--IPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNSKITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAE-NGKISLKRP-IDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFP-DKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPES---LKDSKKFFSVNKDNGEITLINSLQPL-FRRKCLIIIYAKDLGYPPLSSTVKIEISIV 2489
            M F V   LL  ++ +Q L+         + Q IKEE P G+ V  + + + E ++  KT+      F L   S  ++    NK S  ++T  ++D +SLC    +K CC + KS   + C ++  +     + N++I+  L  +ED+NDN P F +    + + EN   +K+G +      D D    S     + G+      F+ +   + ++ K  L  H+  DRE V+ +   + A D   + N   +++ + I D ND+ PK+   +  +    I E+  I   II     D D G NG++ Y   N  +  +S++  F++  S  G + V + +D E  +  EI +   A DNG  I   +S++ + I ++D+NDN P+    + +    + ++EN +    + +I V D D G   ++ C I+  +F + L L+   +   + + T  +IDRE  G  ++++KC D G   L S+  + I V D+NDN PI  +      + I ENN+   YI  V ATD DI++NG + Y ++ +   + +  SIDS TG + +   FDRE  D Y F V  RD+G   LS+S+ V +TILD ND+ P F      + +I E++NP   +  +   D D G N K++  LQ     F +   +GKI L+   IDRE  S ++LK+IA D G         V I ++D+NDN P F FP  KN ++NVS +  +   LI +I A D D  Q       +  L   S   P     L   +  F ++   G++ LIN      +  +  + I A D G P LSS   + + ++
Sbjct:    1 MDFRVRTKLLFILLSFQILFKSTIQLKLLFRQTIKEELPSGSLVLQIASPV-EISSFMKTHKSKVVEFSLL-DSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCC-DPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKEN---VKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNAR--LYQDQVKLYLIKHL--DRELVDNFKLVITAIDGGSNPNTGTLIVNINITDINDNQPKWITENFSVS---IKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV-VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDN-PLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTL--YQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN---AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ--YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETIVNINIEDVNDNPPVFQFPSSKNNEVNVSCN-QMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 806          

HSP 2 Score: 88.9669 bits (219), Expect = 1.167e-17
Identity = 126/495 (25.45%), Postives = 234/495 (47.27%), Query Frame = 3
Query: 1077 YEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKD-KGFNSKI----TCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIP--IVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHY----FINESDTLSMSQFSIDSETGVVKSKIVFDRE-LQDL-YKFIVFIRDHGKPSL-STSATVTVTILDENDNFP----MFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSM-ILQENTDYFSL----AENGKISLKRPIDRETHSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVSFDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE 2492
            +++T  A +N +      I++ IE+ DVNDN P F L +Q+ +    V+EN ++   I   +V D D K F++K       H+ +  F+  L  ++++++ I        +DRE      +V+   D G +P   ++ + I++ D NDN P  I +  + S+  ++  N++    I ++ A D D+ +NG+++Y      NE ++   + F ++S +G ++ +   D E LQ    +  V  +D+G+  + S S  V +T++D NDN P    +  + + L+  I EN      +  ++  D D G  G+V+  I  +N    SL     +   ++    IDRET   + + I   D G    +S+  + I V+D NDN P  IF     Q  +  +  +G+  I  + A D D  +NG +++      L SN        ++   S++ + G +T           K    + A+D G   LSS+  + ++I++
Sbjct:  122 FQMTAKADNNNVEI----IQVLIELEDVNDNSPSF-LNSQDTI---YVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLI------KHLDRELVDNFKLVITAIDGGSNPNTGTLIVNINITDINDNQPKWITENFSVSIKEDVPINHL----IIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLF-KIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP--IFHSTLYQFRIPENNVLGQ-YIGHVNATDKDIEENGHVIYS-----LSSN--------AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILD 580          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 252.677 bits (644), Expect = 2.312e-69
Identity = 217/797 (27.23%), Postives = 371/797 (46.55%), Query Frame = 3
Query:  183 QGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYS--KNIKILNFLFLVEDINDNVPQFE-DKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIIL-FNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS-VEENSEIDTN-IGTIEVIDKDKGFNSKITCHIE--ENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRE-----LQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMI--LQENTDYFSLAENGK---ISLKRPIDRETHSEFKLKIIAKDH-GLRPQSSSINVVIEVKDINDNSPTFIFPD-KNLQMNVSFDYTVGKKLIT-KITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETK 2498
            + +F+ N+ +F    +     Y  N  F L   +  NRL  L+  +G L +   ID + LC +++ CC     H  + C I L + V     +  +       +EDINDN P+F  DKF  + I E+     + SLP A D D  Q S  +Y+L  N     +FS++          +L   +  DRE   +Y F L+A D  +     +++I + +LD ND+ P     +  IQ    YE  +   + +L     D DE  N ++V+ + NE   K     ++      G++++ E +D E  E +   +  S+N      ++  + I+++++ND  P+  +   N  N  + ++EN +  T  +    V DKDKG   ++ C +   EN F  + +   I   N + I+TR+ +DRE  G   + ++C D G  PL +   I + V D+NDN P++       N  + EN    + +  + A DID   NG L Y I+ES  L+     I+S TG +K+++  DRE     LQ  +  I+ + D G+P   +     V++ DENDN P F   + +   + EN    Y L  +   D+D+    +VS++    E +  F L E      ++  R +D E    +  KI+A D  G +  +++  V + ++D ND++P+FIFP+  N    +S+  +    ++T  +  +D     NG   FH              + D K  F ++++ G+IT   ++      K +I + A+D G PP  S++ I I I  +K
Sbjct:   27 ENSFISNLNSF----DVYSTPYTQNKKFNLLSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCC-----HKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKF-TINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKL--DREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQ----YEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPS-NKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN---NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQS-FPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYS-IQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFH-------------LVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSK 787          
BLAST of Protocadherin vs. Planmine SMEST
Match: SMESG000051236.1 (SMESG000051236.1)

HSP 1 Score: 252.292 bits (643), Expect = 2.753e-69
Identity = 217/797 (27.23%), Postives = 371/797 (46.55%), Query Frame = 3
Query:  183 QGTFVGNVKNFILENNALDKTYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYNSKSHNTNTCSIELIVQVTYS--KNIKILNFLFLVEDINDNVPQFE-DKFHVLQIHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLNECKYELFSHISFDRESVNEYMFYLIAKDVDD--NEAKIMIKVRILDENDSVPKFHVNSNKIQKFQIYENCRIGTEIIL-FNVTDADEGVNGEIVYSLNNEDRTKSKILPFYM--SKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIHIEILDVNDNKPDFILQTQNILNHYS-VEENSEIDTN-IGTIEVIDKDKGFNSKITCHIE--ENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCDSGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQVKATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRE-----LQDLYKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTNPPYALIHLTCKDRDEGINGKVSMI--LQENTDYFSLAENGK---ISLKRPIDRETHSEFKLKIIAKDH-GLRPQSSSINVVIEVKDINDNSPTFIFPD-KNLQMNVSFDYTVGKKLIT-KITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKFFSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVETK 2498
            + +F+ N+ +F    +     Y  N  F L   +  NRL  L+  +G L +   ID + LC +++ CC     H  + C I L + V     +  +       +EDINDN P+F  DKF  + I E+     + SLP A D D  Q S  +Y+L  N     +FS++          +L   +  DRE   +Y F L+A D  +     +++I + +LD ND+ P     +  IQ    YE  +   + +L     D DE  N ++V+ + NE   K     ++      G++++ E +D E  E +   +  S+N      ++  + I+++++ND  P+  +   N  N  + ++EN +  T  +    V DKDKG   ++ C +   EN F  + +   I   N + I+TR+ +DRE  G   + ++C D G  PL +   I + V D+NDN P++       N  + EN    + +  + A DID   NG L Y I+ES  L+     I+S TG +K+++  DRE     LQ  +  I+ + D G+P   +     V++ DENDN P F   + +   + EN    Y L  +   D+D+    +VS++    E +  F L E      ++  R +D E    +  KI+A D  G +  +++  V + ++D ND++P+FIFP+  N    +S+  +    ++T  +  +D     NG   FH              + D K  F ++++ G+IT   ++      K +I + A+D G PP  S++ I I I  +K
Sbjct:   33 ENSFISNLNSF----DVYSTPYTQNKKFNLLSNTKANRLFHLHS-NGKLYSAQTIDREELCINVESCC-----HKKDPCDISLSIAVKSDSIEEPRTFECRIQIEDINDNAPRFRTDKF-TINIKESEPVGSLFSLPIATDDDSEQYSIRDYKLEENSIFPPIFSLEQNRPTGSLNLQLIQKL--DREKRAKYEFVLLAIDRGNPPKTGRLVININVLDVNDNPPHLSQTNYNIQ----YEESKFSMQPLLKIGAKDEDENDNAKMVFKIVNEQPVKVDANKYFRIEENSGNIYLKEKLDYERDEQHRFYVEVSNNAGHVDTATATVLIQVINLNDETPEIAIDYVNENNKNAFIKENEDQKTKFVALATVTDKDKGLGGQVHCRLSNNENVFEIHNRDSSIPS-NKYSIRTRVTLDRETKGYYELQMECEDKGDPPLRAKALIKVVVKDENDNAPVIKLEN---NVSVYENKPIGTLVTHITAKDIDEGKNGELTYSISESSDLTKKYLEINSHTGDLKTRMKIDREQDSETLQS-FPVILTVSDKGQPPQISRKAFDVSVKDENDNAPEFENYS-IQFQVTENQQALYTLGEIRVHDKDDNSQLRVSLVHLPNEMSSPFVLFERDNKYYLNTTRSLDWEKEKNYSFKILASDGTGYKSHTATATVTVIIEDENDHAPSFIFPNYSNFTKYISYHESAEIAILTVSVGDLDSKDSMNGKCSFH-------------LVNDHKGLFKIDQNKGKITTSRTMSESDMGKHVITVIARDHGNPPKESSILITIVIDNSK 793          
The following BLAST results are available for this feature:
BLAST of Protocadherin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH93.583e-7028.54protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH97.547e-7028.41protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH99.516e-7028.41protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH91.048e-6928.41protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11X1.163e-6827.90protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-14.785e-4627.37FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-17.026e-4027.34FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-16.132e-3524.78CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-46.569e-3025.97Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-12.335e-2826.66Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stan5.181e-5325.56gene:FBgn0024836 transcript:FBtr0304900[more]
stan6.615e-5325.56gene:FBgn0024836 transcript:FBtr0304899[more]
stan6.615e-5325.56gene:FBgn0024836 transcript:FBtr0300578[more]
stan6.631e-5325.56gene:FBgn0024836 transcript:FBtr0339463[more]
stan9.224e-5325.56gene:FBgn0024836 transcript:FBtr0303223[more]
back to top
BLAST of Protocadherin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh117.887e-7127.96protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.392e-7027.96protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh92.431e-7028.23protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.254e-7028.23protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.254e-7028.23protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047798.11.252e-7129.20protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.12.380e-7129.20protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.12.810e-7128.42pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
ENSXETT00000047801.12.898e-7129.20protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
vapa7.506e-7028.18VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh92.859e-7028.76protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh11x8.293e-7027.84protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.454e-6927.84protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh92.086e-6928.29protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.079e-6928.29protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN3.624e-6928.41Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q6WYY1|PC11X_PANPA4.877e-6828.03Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q71M42|PC11X_PANTR5.690e-6828.03Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6X862|PC11X_GORGO5.846e-6828.03Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6KEQ9|PC11X_PIG1.045e-6728.04Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
back to top
BLAST of Protocadherin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G5AQQ62.759e-8129.14Protocadherin gamma-A11 (Fragment) OS=Heterocephal... [more]
A0A3P9JRD16.827e-7730.13Protocadherin 2 alpha a 15 OS=Oryzias latipes OX=8... [more]
L8HNP43.236e-7628.75Protocadherin gamma-C3 (Fragment) OS=Bos mutus OX=... [more]
A0A401PCT75.521e-7629.46Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A401S1S58.249e-7629.59Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of Protocadherin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh95.621e-7128.30protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh91.154e-7028.30protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh118.320e-6727.86protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh111.070e-6627.86protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh113.691e-6628.08protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.12.556e-5925.32pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
pcdh112.633e-5927.49protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.13.493e-5629.26pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.17.915e-5527.96protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000004042.13.811e-4927.41pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354124.198e-6929.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461891.877e-6327.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404701.165e-5425.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303643.666e-5429.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348151.548e-5126.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh96.487e-7128.52protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh92.783e-7028.52protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh93.071e-7028.39protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh112.695e-6526.58protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh116.305e-6526.58protocadherin-11 X-linked [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Protocadherin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035568.10.000e+099.69SMESG000035568.1[more]
SMESG000035568.10.000e+099.68SMESG000035568.1[more]
SMESG000072628.12.432e-7129.52SMESG000072628.1[more]
SMESG000051236.12.312e-6927.23SMESG000051236.1[more]
SMESG000051236.12.753e-6927.23SMESG000051236.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033491 ID=SMED30033491|Name=Protocadherin|organism=Schmidtea mediterranea sexual|type=transcript|length=3098bp
TTTCGATTATTACATTAAAATATCAGTGATGAAATATCAGTCTATTATTG
TTGAAAAAATGTAAATATATACAGAAATAATAAATTAACATCATGCAATT
TGAGGTTATTTTATTACTGCTTCAATTTGTTATGCCATATCAATTTCTAT
ATTATTTGCAACCAATAAAAGAGGAACAGCCCCAAGGGACATTTGTAGGT
AACGTTAAGAATTTTATTTTAGAAAATAATGCTTTGGACAAAACTTATTT
GGATAATTCCTCATTCGAGTTGTTCGGAAAATCGTCAATTAATCGTCTGT
TAAAGTTAAATAAATTTTCCGGTGTTCTTCAAACAAAAACCAGAATTGAT
ATCGATTCGCTCTGTGAATCCATAAAAGAATGCTGCTACAATTCAAAAAG
TCACAATACAAATACATGTTCTATTGAACTAATTGTCCAGGTCACTTATA
GCAAAAATATTAAAATTTTAAATTTTCTTTTTCTCGTTGAAGACATCAAT
GATAATGTTCCACAGTTCGAAGACAAGTTCCATGTCCTTCAGATCCATGA
AAACCGATTACCAATGAAAATCGGTTCACTTCCTTCGGCGTTCGACAAAG
ATTTCGGCCAGACTTCAAAATTGGAATACCGCCTTCACGGTAATAAAGAT
CAGTTGAGATTATTTAGTATCAAAAGTATATTTCATTTAAATGAATGTAA
ATATGAACTCTTTTCGCACATTTCTTTCGATCGGGAATCCGTGAATGAAT
ATATGTTTTATTTAATTGCAAAGGACGTTGATGATAATGAAGCGAAAATT
ATGATAAAAGTTAGAATTTTAGACGAAAATGATTCGGTTCCAAAGTTTCA
CGTCAATTCAAACAAAATTCAAAAGTTTCAAATTTATGAAAATTGCCGAA
TAGGAACGGAAATCATTTTATTTAACGTCACCGACGCAGACGAAGGCGTC
AATGGAGAAATTGTTTATTCTCTCAATAATGAAGACAGAACAAAATCCAA
GATCTTACCTTTTTACATGAGTAAAAAAGGCTCTCTATTTGTCTCTGAAA
ATATTGATAGAGAAATCAGAGAGTTTTATGAAATTACAATCTCCGCTTCA
GATAATGGCATTCCTACTCAAATGAGCTCAATAAAGATTCACATAGAAAT
ACTCGATGTGAATGATAACAAACCAGATTTTATTCTTCAAACCCAAAATA
TACTCAACCACTATTCAGTGGAGGAAAACTCAGAAATCGACACAAACATT
GGTACCATAGAGGTGATTGACAAGGATAAGGGTTTCAATTCAAAGATCAC
TTGCCATATTGAGGAGAATTCTTTTTCTAAGTATCTCAAGTTAGAGAAAA
TTGAAATCTTTAATATTTTTAAAATACAAACTCGGTTGGCAATTGATAGA
GAAAAGGATGGCCAGCTGTTGATGGTGTTAAAGTGCTGTGACTCTGGATT
GGATCCGTTAATGTCCAGTGTGACCATTACCATAGATGTCGTGGATAAAA
ACGATAACATCCCAATTGTGGATACTAATACCGGTTCTCTCAATTGGGAA
ATAAGCGAAAATAATATTAAGTTTTCATACATAAATCAGGTCAAAGCCAC
CGATATAGACATCCAGGATAATGGGAGATTGCATTATTTTATTAATGAGT
CTGACACTTTATCTATGTCACAATTTTCAATAGACTCTGAAACAGGAGTG
GTTAAATCAAAAATTGTTTTCGATCGTGAACTTCAAGACCTTTACAAATT
TATCGTATTTATTCGAGATCATGGAAAGCCTAGTCTTTCCACCTCGGCAA
CAGTGACAGTGACAATATTAGACGAAAATGACAACTTTCCAATGTTCTTT
ACAGCAAATCCTCTCTATTTAACAATAATTGAGAATACAAATCCACCCTA
CGCCCTCATTCATTTGACTTGCAAAGATCGCGATGAAGGAATCAACGGAA
AGGTTTCAATGATTTTACAAGAAAATACCGACTACTTTTCTTTAGCTGAA
AATGGGAAAATATCCCTTAAAAGACCAATTGATCGGGAAACTCATTCTGA
GTTCAAATTGAAAATCATAGCCAAAGACCATGGACTACGACCGCAATCAA
GTTCTATTAACGTTGTCATAGAAGTCAAGGACATTAACGACAATTCGCCG
ACATTTATATTTCCGGACAAAAATCTACAAATGAATGTCAGCTTTGATTA
TACGGTCGGAAAGAAACTTATCACCAAAATTACCGCAGTAGATCCAGATT
TCGGTCAAAACGGAGTCATTCTTTTCCATCACGATGAACTGGTTTTACAC
AGCAATAAAATGCCAGAATCATTGAAAGATTCTAAAAAGTTTTTTTCTGT
TAATAAAGACAACGGTGAAATAACATTGATCAATTCTTTGCAACCGCTTT
TTCGGAGGAAATGCCTCATAATTATTTATGCTAAAGATTTGGGGTATCCT
CCTTTAAGTTCTACGGTAAAAATCGAGATCTCAATTGTTGAAACAAAAAG
TTCAATTTATTCTAACAAAATTTCAGCAAGCAATGATCATGATATTTTTA
ACATATCTGTCATAATAATCGGATGCATTTCTGTCATAATTATTACCGTG
ATGATCGGGGCTGTGATGATGCTGATTTTTCAAAAGGAAAGAAATCATAG
ATACGAAGTGGACTCCTGTTTAATGACGAGTTTATCTGGGAAACTTACAT
CAGCGTTAAATGAATATGAGTTAAGCAGTCCTTCATCTATTAACAAGAAT
CTTTCGATGTCATCCTCAAATATACATTTAATGCAAGAAAAAAATTACAT
CTCCACTTTACGACCGATCAAACTAGGAGCTCCTAAATATTCCAATCCGA
GTCGCACTTCAAATTATTATGAAGTCATAATGCCCAAGGAAACTCTGAAC
AATCAAAAGTCACAGAAAGAAATCACTGTGGCATATCATGAGCCAGTGAA
AAAAGATGCTGAACTCATTGAAATATTAACCAGAAATGTAGCAGATTCTT
CATAAAAGTTATGACTTGACAAATATGCCTTGTATAACTTATTAACGGTT
GGTTATTTGACCAGTTGAACAAATTTCACTGTAAAGTTGTTAATATAA
back to top

protein sequence of SMED30033491-orf-1

>SMED30033491-orf-1 ID=SMED30033491-orf-1|Name=SMED30033491-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=971bp
MQFEVILLLLQFVMPYQFLYYLQPIKEEQPQGTFVGNVKNFILENNALDK
TYLDNSSFELFGKSSINRLLKLNKFSGVLQTKTRIDIDSLCESIKECCYN
SKSHNTNTCSIELIVQVTYSKNIKILNFLFLVEDINDNVPQFEDKFHVLQ
IHENRLPMKIGSLPSAFDKDFGQTSKLEYRLHGNKDQLRLFSIKSIFHLN
ECKYELFSHISFDRESVNEYMFYLIAKDVDDNEAKIMIKVRILDENDSVP
KFHVNSNKIQKFQIYENCRIGTEIILFNVTDADEGVNGEIVYSLNNEDRT
KSKILPFYMSKKGSLFVSENIDREIREFYEITISASDNGIPTQMSSIKIH
IEILDVNDNKPDFILQTQNILNHYSVEENSEIDTNIGTIEVIDKDKGFNS
KITCHIEENSFSKYLKLEKIEIFNIFKIQTRLAIDREKDGQLLMVLKCCD
SGLDPLMSSVTITIDVVDKNDNIPIVDTNTGSLNWEISENNIKFSYINQV
KATDIDIQDNGRLHYFINESDTLSMSQFSIDSETGVVKSKIVFDRELQDL
YKFIVFIRDHGKPSLSTSATVTVTILDENDNFPMFFTANPLYLTIIENTN
PPYALIHLTCKDRDEGINGKVSMILQENTDYFSLAENGKISLKRPIDRET
HSEFKLKIIAKDHGLRPQSSSINVVIEVKDINDNSPTFIFPDKNLQMNVS
FDYTVGKKLITKITAVDPDFGQNGVILFHHDELVLHSNKMPESLKDSKKF
FSVNKDNGEITLINSLQPLFRRKCLIIIYAKDLGYPPLSSTVKIEISIVE
TKSSIYSNKISASNDHDIFNISVIIIGCISVIIITVMIGAVMMLIFQKER
NHRYEVDSCLMTSLSGKLTSALNEYELSSPSSINKNLSMSSSNIHLMQEK
NYISTLRPIKLGAPKYSNPSRTSNYYEVIMPKETLNNQKSQKEITVAYHE
PVKKDAELIEILTRNVADSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR013164Cadherin_N
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion