Histone-lysine N-methyltransferase

Overview
NameHistone-lysine N-methyltransferase
Smed IDSMED30033482
Length (bp)4432
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-lysine N-methyltransferase (SMED30033482) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30033482) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-lysine N-methyltransferase (SMED30033482) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-lysine N-methyltransferase (SMED30033482) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033482

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30033482SMESG000062296.1 DN308184ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30033482SMESG000062296.1 DN308184ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033482SMESG000062296.1 DN308184ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30033482SMESG000062296.1 DN301487ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30033482SMESG000062296.1 DN301487ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30033482SMESG000062296.1 DN301487ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: SETD1A (SET domain containing 1A, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:29010])

HSP 1 Score: 230.335 bits (586), Expect = 3.788e-60
Identity = 124/250 (49.60%), Postives = 162/250 (64.80%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGF-QNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P D    H TGSAR++GYY I+  EK              +  + + P +A      R+ E    +D +   R  + E RSEQRRL +    +     +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP E++KIPCLCG+  CRG+LN
Sbjct: 1482 PQDGPREHQTGSARSEGYYPISKKEK--------------DKYLDVCPVSA------RQLEG---VDTQGTNRV-LSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN 1707          

HSP 2 Score: 112.849 bits (281), Expect = 3.034e-24
Identity = 71/205 (34.63%), Postives = 110/205 (53.66%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSA-SKIETISDVTTQPNNDVDSGS----EYCSDDS 759
            +DPR    + ++  +  L +P+F  D+  IG+ P KEVTF+ LNDN+ +  L+DMCR  G VEE++IL HP+T +HLGLA+V+F S+R AK  V+  H TS MGNI+  ++D+ G+ R + +  +VN                  Y P  +PT    +S +       +++A S+  + SD    P      G+      CS D+
Sbjct:   61 QDPR--CHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVNG----------------SYTPQTVPTGGKALSEKFQGSGAATETAESRRRSSSDTAAYPAGTTAVGTPGNGTPCSQDT 247          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: SETD1B (SET domain containing 1B, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:29187])

HSP 1 Score: 227.254 bits (578), Expect = 3.683e-59
Identity = 128/256 (50.00%), Postives = 159/256 (62.11%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSP------MDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K                          +Y+   ++  D P      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1694 DGIREHVTGCARSEGFYTIDKKDK-------------------------LRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1923          

HSP 2 Score: 113.235 bits (282), Expect = 2.966e-24
Identity = 60/125 (48.00%), Postives = 85/125 (68.00%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLV 537
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV
Sbjct:   70 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLV 193          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: SETD1B (SET domain containing 1B, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:29187])

HSP 1 Score: 227.254 bits (578), Expect = 3.977e-59
Identity = 128/256 (50.00%), Postives = 159/256 (62.11%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSP------MDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K                          +Y+   ++  D P      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1694 DGIREHVTGCARSEGFYTIDKKDK-------------------------LRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1923          

HSP 2 Score: 113.235 bits (282), Expect = 2.966e-24
Identity = 60/125 (48.00%), Postives = 85/125 (68.00%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLV 537
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV
Sbjct:   70 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLV 193          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: SETD1B (SET domain containing 1B, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:29187])

HSP 1 Score: 226.868 bits (577), Expect = 5.308e-59
Identity = 128/256 (50.00%), Postives = 159/256 (62.11%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSP------MDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K                          +Y+   ++  D P      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1737 DGIREHVTGCARSEGFYTIDKKDK-------------------------LRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1966          

HSP 2 Score: 112.849 bits (281), Expect = 3.308e-24
Identity = 60/125 (48.00%), Postives = 85/125 (68.00%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLV 537
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV
Sbjct:   70 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLV 193          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Match: SETD1B (SET domain containing 1B, histone lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:29187])

HSP 1 Score: 226.868 bits (577), Expect = 5.308e-59
Identity = 128/256 (50.00%), Postives = 159/256 (62.11%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSP------MDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K                          +Y+   ++  D P      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1737 DGIREHVTGCARSEGFYTIDKKDK-------------------------LRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1966          

HSP 2 Score: 112.849 bits (281), Expect = 3.308e-24
Identity = 60/125 (48.00%), Postives = 85/125 (68.00%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLV 537
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV
Sbjct:   70 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLV 193          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 219.55 bits (558), Expect = 2.411e-59
Identity = 103/173 (59.54%), Postives = 130/173 (75.14%), Query Frame = 1
Query: 3754 REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            ++ R  QRRL T   +  +  +  +IN L  RKK++ FA+S IH WGL A+E+IAPDEM++EY+GQ +R  +AE REK YE +GIGSSYLFRID   VIDAT  G+ ARFINHSCQPNC A+V+T++G+K+IVIYS+  I   EEITYDYKFP E+DKI CLCG+  CRG LN
Sbjct:  569 KDMRLLQRRLLTSLGD--ANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 739          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 220.32 bits (560), Expect = 1.239e-57
Identity = 103/173 (59.54%), Postives = 130/173 (75.14%), Query Frame = 1
Query: 3754 REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            ++ R  QRRL T   +  +  +  +IN L  RKK++ FA+S IH WGL A+E+IAPDEM++EY+GQ +R  +AE REK YE +GIGSSYLFRID   VIDAT  G+ ARFINHSCQPNC A+V+T++G+K+IVIYS+  I   EEITYDYKFP E+DKI CLCG+  CRG LN
Sbjct: 1337 KDMRLLQRRLLTSLGD--ANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 1507          

HSP 2 Score: 62.7734 bits (151), Expect = 2.117e-9
Identity = 33/102 (32.35%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  256 PPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMF----NNLVNPVL 549
            PP++EV+  N++DN  +  L D  + CG VE+  +  HP+T RH+ +A V F + + A +    YH  + +      +ID    I NE +    N  V P+L
Sbjct:  123 PPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYVKFATVKEAHNFYSMYHAQNLLATKCTPRIDPFLSILNEEYEVATNGQVLPIL 224          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-2 (Histone-lysine N-methyltransferase set-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18221])

HSP 1 Score: 220.32 bits (560), Expect = 1.276e-57
Identity = 103/173 (59.54%), Postives = 130/173 (75.14%), Query Frame = 1
Query: 3754 REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            ++ R  QRRL T   +  +  +  +IN L  RKK++ FA+S IH WGL A+E+IAPDEM++EY+GQ +R  +AE REK YE +GIGSSYLFRID   VIDAT  G+ ARFINHSCQPNC A+V+T++G+K+IVIYS+  I   EEITYDYKFP E+DKI CLCG+  CRG LN
Sbjct: 1340 KDMRLLQRRLLTSLGD--ANNDFFKINQLKFRKKMIKFARSRIHGWGLYAMESIAPDEMIVEYIGQTIRSLVAEEREKAYERRGIGSSYLFRIDLHHVIDATKRGNFARFINHSCQPNCYAKVLTIEGEKRIVIYSRTIIKKGEEITYDYKFPIEDDKIDCLCGAKTCRGYLN 1510          

HSP 2 Score: 63.1586 bits (152), Expect = 1.931e-9
Identity = 33/102 (32.35%), Postives = 53/102 (51.96%), Query Frame = 1
Query:  256 PPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMF----NNLVNPVL 549
            PP++EV+  N++DN  +  L D  + CG VE+  +  HP+T RH+ +A V F + + A +    YH  + +      +ID    I NE +    N  V P+L
Sbjct:  123 PPKREVSLFNMDDNCTEVLLRDFAKDCGKVEKAYVCIHPETKRHMKMAYVKFATVKEAHNFYSMYHAQNLLATKCTPRIDPFLSILNEEYEVATNGQVLPIL 224          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-16 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:G5EGI1])

HSP 1 Score: 120.939 bits (302), Expect = 4.495e-27
Identity = 63/143 (44.06%), Postives = 91/143 (63.64%), Query Frame = 1
Query: 3865 FAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKY--EDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDG---KKKIVIYSKRQINIMEEITYDYKFPYE--EDKIPCLCGSVGCRGTLN 4272
             A+S I   GL A   I+  + +IEY G+++R  + E RE +Y  +++G+   Y+FRID++ VIDATM G  AR+INHSC PNC  +++       +KKI+I + R I+  EE+TYDY+F  E   DKIPCLCG+  C   +N
Sbjct: 2336 LARSRIAGLGLYAKVDISMGDFIIEYKGEIIRSEVCEVREIRYVAQNRGV---YMFRIDEEWVIDATMAGGPARYINHSCDPNCSTQILDAGSGAREKKIIITANRPISANEELTYDYQFELEGTTDKIPCLCGAPNCVKWMN 2475          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Match: set-12 (Histone-lysine N-methyltransferase [Source:UniProtKB/TrEMBL;Acc:Q21404])

HSP 1 Score: 102.064 bits (253), Expect = 1.748e-22
Identity = 53/136 (38.97%), Postives = 76/136 (55.88%), Query Frame = 1
Query: 3862 TFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGK--KKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRG 4263
            TF        GL A E IA  ++++EY G+ + K     R K+Y+  GI  SY F +  +  +D T  G++ARFINHSC PN + +V TV  +  K + I++ + I   EEIT+DY   +  D+ PC CG   CRG
Sbjct:   99 TFLTDNGIGHGLRATEEIATGKLILEYRGEAITKAEHNKRVKRYKKDGIKHSYSFEVGRNYYVDPTRKGNSARFINHSCNPNALVKVWTVPDRPMKSLGIFASKVIKPGEEITFDYGTSFRNDQ-PCQCGEAACRG 233          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: Set1 (gene:FBgn0040022 transcript:FBtr0302246)

HSP 1 Score: 252.292 bits (643), Expect = 2.339e-67
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.749e-25
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: Set1 (gene:FBgn0040022 transcript:FBtr0302248)

HSP 1 Score: 252.292 bits (643), Expect = 2.339e-67
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.749e-25
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: Set1 (gene:FBgn0040022 transcript:FBtr0302243)

HSP 1 Score: 252.292 bits (643), Expect = 2.339e-67
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.749e-25
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: Set1 (gene:FBgn0040022 transcript:FBtr0113869)

HSP 1 Score: 252.292 bits (643), Expect = 2.339e-67
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.749e-25
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Match: Set1 (gene:FBgn0040022 transcript:FBtr0113870)

HSP 1 Score: 252.292 bits (643), Expect = 2.339e-67
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.749e-25
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase a [Source:NCBI gene;Acc:567970])

HSP 1 Score: 244.588 bits (623), Expect = 8.522e-65
Identity = 127/247 (51.42%), Postives = 164/247 (66.40%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++GYY+I   +K    + + L S   ++       T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1617 DGIRDHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDV------DTQGKSI---------PAQPQVSTRAG-SERRSEQRRLLSSFS---CDSDLLKFNQLKFRKKKIRFCRSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1844          

HSP 2 Score: 120.168 bits (300), Expect = 1.219e-26
Identity = 59/127 (46.46%), Postives = 83/127 (65.35%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  +G  P KEVTF+ LNDN+ +  L DMC+  G +EE++ILY+PK  +HLG+AKVVF + + AK  V+  H TS MGNI+ V++D  G+ R   F  L+N
Sbjct:  104 RDPRIG-RLWTKYKETDLPVPKFKIDECYVGRVPPKEVTFAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFETVKAAKDAVQNLHNTSVMGNIIHVELDPKGENRQRYFQRLIN 229          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase a [Source:NCBI gene;Acc:567970])

HSP 1 Score: 244.588 bits (623), Expect = 8.522e-65
Identity = 127/247 (51.42%), Postives = 164/247 (66.40%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++GYY+I   +K    + + L S   ++       T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1617 DGIRDHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDV------DTQGKSI---------PAQPQVSTRAG-SERRSEQRRLLSSFS---CDSDLLKFNQLKFRKKKIRFCRSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1844          

HSP 2 Score: 120.168 bits (300), Expect = 1.219e-26
Identity = 59/127 (46.46%), Postives = 83/127 (65.35%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  +G  P KEVTF+ LNDN+ +  L DMC+  G +EE++ILY+PK  +HLG+AKVVF + + AK  V+  H TS MGNI+ V++D  G+ R   F  L+N
Sbjct:  104 RDPRIG-RLWTKYKETDLPVPKFKIDECYVGRVPPKEVTFAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFETVKAAKDAVQNLHNTSVMGNIIHVELDPKGENRQRYFQRLIN 229          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase a [Source:NCBI gene;Acc:567970])

HSP 1 Score: 244.588 bits (623), Expect = 8.993e-65
Identity = 127/247 (51.42%), Postives = 164/247 (66.40%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++GYY+I   +K    + + L S   ++       T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1620 DGIRDHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDV------DTQGKSI---------PAQPQVSTRAG-SERRSEQRRLLSSFS---CDSDLLKFNQLKFRKKKIRFCRSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1847          

HSP 2 Score: 120.168 bits (300), Expect = 1.199e-26
Identity = 59/127 (46.46%), Postives = 83/127 (65.35%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  +G  P KEVTF+ LNDN+ +  L DMC+  G +EE++ILY+PK  +HLG+AKVVF + + AK  V+  H TS MGNI+ V++D  G+ R   F  L+N
Sbjct:  104 RDPRIG-RLWTKYKETDLPVPKFKIDECYVGRVPPKEVTFAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFETVKAAKDAVQNLHNTSVMGNIIHVELDPKGENRQRYFQRLIN 229          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: AL928885.1 (SET domain containing 1A, histone lysine methyltransferase [Source:NCBI gene;Acc:556535])

HSP 1 Score: 232.261 bits (591), Expect = 8.003e-61
Identity = 121/243 (49.79%), Postives = 153/243 (62.96%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK +             +  P+       Y            D   + R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 2024 HVTGCARSEGYYAISRKEKDVYL----------ELDQPVTLREIGDY------------DTAGSNRV-LSERRSEQRRLLSAIGTPAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRYAQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPIEENKIPCLCGTESCRGTLN 2243          

HSP 2 Score: 116.316 bits (290), Expect = 1.929e-25
Identity = 72/192 (37.50%), Postives = 113/192 (58.85%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSG 735
            RDPR +  I +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F ++R AK  V+  H TS MGNI+ V++D+ G+ R + ++ +V+   +        K++   + PP +PT     S    +      +A    T++  +T P + VD+G
Sbjct:   57 RDPRPR-RIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEMEILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLIVSGSYTPQTVPTGGKALTEKFQPP-VPTQPDTSSDIRRRLSTDQMAAPAAATLNSGSTTPCS-VDTG 245          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 231.876 bits (590), Expect = 8.749e-61
Identity = 121/243 (49.79%), Postives = 155/243 (63.79%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK              ++ + L      + + D         D   + R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 2034 HVTGCARSEGYYAISRKEK--------------DVYLELDQPVTLREIGD--------YDTAGSNRV-LSERRSEQRRLLSAIGTPAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQSIRQMVADNREKRYAQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPIEENKIPCLCGTESCRGTLN 2253          

HSP 2 Score: 116.316 bits (290), Expect = 2.346e-25
Identity = 72/192 (37.50%), Postives = 113/192 (58.85%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSG 735
            RDPR +  I +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F ++R AK  V+  H TS MGNI+ V++D+ G+ R + ++ +V+   +        K++   + PP +PT     S    +      +A    T++  +T P + VD+G
Sbjct:   57 RDPRPR-RIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEMEILFHPKTRKHLGLARVLFTNTRGAKDTVKHLHNTSVMGNIVHVQLDIKGQQRMKYYDLIVSGSYTPQTVPTGGKALTEKFQPP-VPTQPDTSSDIRRRLSTDQMAAPAAATLNSGSTTPCS-VDTG 245          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: setd1b (SET domain containing 1B [Source:NCBI gene;Acc:780106])

HSP 1 Score: 243.432 bits (620), Expect = 2.898e-64
Identity = 129/247 (52.23%), Postives = 163/247 (65.99%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K         L +NR++   L   T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E I  DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCG+  CRGTLN
Sbjct: 1733 DGLREHVTGCARSEGYYKIDKKDK------LKYLINNRSLTEELPIDTQGKSI---------PAQPQASTRAG-SERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN 1962          

HSP 2 Score: 119.783 bits (299), Expect = 2.580e-26
Identity = 59/127 (46.46%), Postives = 84/127 (66.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    I T+  E+DL +P+   D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PK  +HLG+AKV+F S + A+  V+  H TS MGNI+ V++D  G+ R   ++ LVN
Sbjct:   87 RDPRIGR-IWTKTKELDLPVPKLKIDEFYVGPVPPKQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFASVKGARDAVKHLHNTSVMGNIIHVELDTKGETRMRFYDLLVN 212          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: setd1b (SET domain containing 1B [Source:NCBI gene;Acc:780106])

HSP 1 Score: 243.432 bits (620), Expect = 3.158e-64
Identity = 129/247 (52.23%), Postives = 163/247 (65.99%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K         L +NR++   L   T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E I  DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCG+  CRGTLN
Sbjct: 1643 DGLREHVTGCARSEGYYKIDKKDK------LKYLINNRSLTEELPIDTQGKSI---------PAQPQASTRAG-SERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN 1872          

HSP 2 Score: 119.783 bits (299), Expect = 2.513e-26
Identity = 59/127 (46.46%), Postives = 84/127 (66.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    I T+  E+DL +P+   D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PK  +HLG+AKV+F S + A+  V+  H TS MGNI+ V++D  G+ R   ++ LVN
Sbjct:   87 RDPRIGR-IWTKTKELDLPVPKLKIDEFYVGPVPPKQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFASVKGARDAVKHLHNTSVMGNIIHVELDTKGETRMRFYDLLVN 212          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ckap4 (cytoskeleton-associated protein 4 [Source:Xenbase;Acc:XB-GENE-5855800])

HSP 1 Score: 234.958 bits (598), Expect = 1.320e-61
Identity = 124/250 (49.60%), Postives = 163/250 (65.20%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQN---LESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY I+  +K            ++ +++ LV A   +             D +   R  + E RSEQRRL +   +   L+S  +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1510 DGLREHQTGCARSEGYYAISKKDK------------DKYLKVLLVAAEEQE------------ADTQGTNRV-LSERRSEQRRLLSAMGSTALLDS--DLLKLNQLKFRKKKLRFGRSHIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYSQQGIGSSYLFRMDQDTIIDATKCGNLARFINHCCSPNCYAKVITIESQKKIVIYSKQPIGINEEITYDYKFPLEDNKIPCLCGTENCRGTLN 1732          

HSP 2 Score: 128.257 bits (321), Expect = 6.107e-29
Identity = 60/127 (47.24%), Postives = 90/127 (70.87%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR+   + ++  EI L +P+F FD+  +G+ P+KE+TF++LNDN+ +  L DMCR  G VEE++IL HPKT +HLGLAKV+F SS+ A+  V   H TS MGNI+  ++D+ G+ R + ++ +VN
Sbjct:   57 RDPRQH-RMWSKPREISLPVPKFKFDEFYVGQLPQKEITFAHLNDNVREPFLADMCRKFGDVEEVEILLHPKTRKHLGLAKVLFSSSKAARDTVTHLHNTSVMGNIIHAELDLRGQQRQKYYDLIVN 182          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: ralgapa2 (Ral GTPase activating protein, alpha subunit 2 (catalytic) [Source:Xenbase;Acc:XB-GENE-957487])

HSP 1 Score: 159.458 bits (402), Expect = 2.313e-38
Identity = 80/153 (52.29%), Postives = 103/153 (67.32%), Query Frame = 1
Query: 3823 LRINHLG-ARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE--DKIPCLCGSVGCRGTLN 4272
            +R  HL    K+ +   +S IH  GL     I   EMVIEY G V+R  L + REK Y+ KGIG  Y+FRIDD  V+DATM+G+ ARFINHSC+PNC +RVI +DG+K IVI++ R+I   EE+TYDYKFP E+  +K+ C CG+  CR  LN
Sbjct: 3513 MRFRHLKKTSKEAVGVYRSPIHGRGLFCRRNIDAGEMVIEYSGNVIRSILTDKREKYYDGKGIGC-YMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVIPIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDANNKLACNCGTKKCRKFLN 3664          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Match: kmt2b (lysine methyltransferase 2B [Source:NCBI gene;Acc:100144721])

HSP 1 Score: 156.762 bits (395), Expect = 1.701e-37
Identity = 81/153 (52.94%), Postives = 103/153 (67.32%), Query Frame = 1
Query: 3823 LRINHLG-ARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE--DKIPCLCGSVGCRGTLN 4272
            +R  HL    K+ +   +S IH  GL     I   EMVIEY G V+R  L + REK Y+ KGIG  Y+FRIDD  V+DATM+G+ ARFINHSC+PNC +RVI V+G+K IVI++ R I   EE+TYDYKFP E+  +K+PC CG+  CR  LN
Sbjct: 2536 MRFRHLKKTSKEAVGVYRSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDSKGIGC-YMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVIHVEGQKHIVIFALRSIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRRFLN 2687          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Gm49388 (predicted gene, 49388 [Source:MGI Symbol;Acc:MGI:6121614])

HSP 1 Score: 232.261 bits (591), Expect = 2.138e-61
Identity = 124/250 (49.60%), Postives = 160/250 (64.00%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLE-STGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P D    H TGSAR++GYY I+  EK              +  + + P +A      R+ E     D +   R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP E++KIPCLCG+  CRG+LN
Sbjct:  948 PQDGPREHQTGSARSEGYYPISKKEK--------------DKYLDVCPVSA------RQLEGG---DTQGTNRV-LSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN 1173          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Setd1a (SET domain containing 1A [Source:MGI Symbol;Acc:MGI:2446244])

HSP 1 Score: 231.876 bits (590), Expect = 7.380e-61
Identity = 124/250 (49.60%), Postives = 160/250 (64.00%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLE-STGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P D    H TGSAR++GYY I+  EK              +  + + P +A      R+ E     D +   R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP E++KIPCLCG+  CRG+LN
Sbjct: 1491 PQDGPREHQTGSARSEGYYPISKKEK--------------DKYLDVCPVSA------RQLEGG---DTQGTNRV-LSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN 1716          

HSP 2 Score: 112.464 bits (280), Expect = 3.525e-24
Identity = 57/127 (44.88%), Postives = 86/127 (67.72%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            +DPR    + ++  +  L +P+F  D+  IG+ P KEVTF+ LNDN+ +  L+DMCR  G VEE++IL HP+T +HLGLA+V+F S+R AK  V+  H TS MGNI+  ++D+ G+ R + +  +VN
Sbjct:   61 QDPR--CHVRSKARDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVN 185          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Setd1a (SET domain containing 1A [Source:MGI Symbol;Acc:MGI:2446244])

HSP 1 Score: 231.876 bits (590), Expect = 7.380e-61
Identity = 124/250 (49.60%), Postives = 160/250 (64.00%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLE-STGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P D    H TGSAR++GYY I+  EK              +  + + P +A      R+ E     D +   R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP E++KIPCLCG+  CRG+LN
Sbjct: 1491 PQDGPREHQTGSARSEGYYPISKKEK--------------DKYLDVCPVSA------RQLEGG---DTQGTNRV-LSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN 1716          

HSP 2 Score: 112.464 bits (280), Expect = 3.525e-24
Identity = 57/127 (44.88%), Postives = 86/127 (67.72%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            +DPR    + ++  +  L +P+F  D+  IG+ P KEVTF+ LNDN+ +  L+DMCR  G VEE++IL HP+T +HLGLA+V+F S+R AK  V+  H TS MGNI+  ++D+ G+ R + +  +VN
Sbjct:   61 QDPR--CHVRSKARDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVN 185          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Setd1b (SET domain containing 1B [Source:MGI Symbol;Acc:MGI:2652820])

HSP 1 Score: 229.565 bits (584), Expect = 4.366e-60
Identity = 130/250 (52.00%), Postives = 163/250 (65.20%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K         L+S+R        A+  +  +D +      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1715 DGIREHVTGCARSEGFYTIDKKDK------LRYLNSSR--------ASTDEPPMDTQG-----MSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1944          

HSP 2 Score: 122.865 bits (307), Expect = 2.416e-27
Identity = 59/126 (46.83%), Postives = 85/126 (67.46%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDN+ +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV 
Sbjct:   69 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNVRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVT 193          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Match: Setd1b (SET domain containing 1B [Source:MGI Symbol;Acc:MGI:2652820])

HSP 1 Score: 229.565 bits (584), Expect = 4.428e-60
Identity = 130/250 (52.00%), Postives = 163/250 (65.20%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++G+Y I   +K         L+S+R        A+  +  +D +      M +     +  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCGS  CRGTLN
Sbjct: 1756 DGIREHVTGCARSEGFYTIDKKDK------LRYLNSSR--------ASTDEPPMDTQG-----MSIPAQPHASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN 1985          

HSP 2 Score: 122.865 bits (307), Expect = 2.415e-27
Identity = 59/126 (46.83%), Postives = 85/126 (67.46%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            DPR  + I T+  E++L +P+F  D+  +G  P K+VTF+ LNDN+ +  L DMC+  G VEE++ILY+PKT +HLG+AKVVF + R AK  V+  H+TS MGNI+ V++D  G+ R   +  LV 
Sbjct:   69 DPRV-VGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNVRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVT 193          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q5LJZ2|SET1_DROME (Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster OX=7227 GN=Set1 PE=1 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 2.345e-66
Identity = 134/255 (52.55%), Postives = 168/255 (65.88%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQI--------REARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG ART+G+Y++   EK  A H      +N          T   +  DR   +D P  + ++  +++        REARS QRRL T F ++    ELL+ N L  RKK + FAKS IH WGL A+E IA DEMVIEYVGQ++R  +A+ RE KYE  GIGSSYLFRID + +IDAT  G+ ARFINHSC PNC A+VIT++ +KKIVIYSK+ I I EEITYDYKFP E++KIPCLCG+ GCRGTLN
Sbjct: 1403 DELIRHKTGCARTEGFYKLDVREK--AKHKYHYAKAN----------TEDSFNEDR---SDEPTALTNHHHNKLISKMQGISREARSNQRRLLTAFGSM-GESELLKFNQLKFRKKQLKFAKSAIHDWGLFAMEPIAADEMVIEYVGQMIRPVVADLRETKYEAIGIGSSYLFRIDMETIIDATKCGNLARFINHSCNPNCYAKVITIESEKKIVIYSKQPIGINEEITYDYKFPLEDEKIPCLCGAQGCRGTLN 1641          

HSP 2 Score: 115.546 bits (288), Expect = 2.755e-24
Identity = 60/148 (40.54%), Postives = 89/148 (60.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRK--DEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGY 597
            RDPR  +  +  +  + + L+IP+FV D + +G+PP  EVT  NLNDNI+K+ L  M   CG  +EI I +HP TN+HLG+A++VF S++ A+  VEKY+  S MG I+DV  D  G    +   +L N V  +     +V + QW +
Sbjct:   64 RDPRNPLIRIRARAVEPLMLLIPRFVIDSDYVGQPPAVEVTIVNLNDNIDKQFLASMLDKCGTSDEINIYHHPITNKHLGIARIVFDSTKGARQFVEKYNQKSVMGKILDVFCDPFGATLKKSLESLTNSVAGKQLIGPKV-TPQWTF 210          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q1LY77|SE1BA_DANRE (Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio OX=7955 GN=setd1ba PE=1 SV=2)

HSP 1 Score: 244.588 bits (623), Expect = 7.193e-64
Identity = 127/247 (51.42%), Postives = 164/247 (66.40%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D I  H TG AR++GYY+I   +K    + + L S   ++       T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1617 DGIRDHVTGCARSEGYYKIDKKDKMKYLNSSRLQSEEPDV------DTQGKSI---------PAQPQVSTRAG-SERRSEQRRLLSSFS---CDSDLLKFNQLKFRKKKIRFCRSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1844          

HSP 2 Score: 120.168 bits (300), Expect = 9.279e-26
Identity = 59/127 (46.46%), Postives = 83/127 (65.35%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  +G  P KEVTF+ LNDN+ +  L DMC+  G +EE++ILY+PK  +HLG+AKVVF + + AK  V+  H TS MGNI+ V++D  G+ R   F  L+N
Sbjct:  104 RDPRIG-RLWTKYKETDLPVPKFKIDECYVGRVPPKEVTFAKLNDNVREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFETVKAAKDAVQNLHNTSVMGNIIHVELDPKGENRQRYFQRLIN 229          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q08D57|SET1B_XENTR (Histone-lysine N-methyltransferase SETD1B OS=Xenopus tropicalis OX=8364 GN=setd1b PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 1.334e-63
Identity = 129/247 (52.23%), Postives = 163/247 (65.99%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K         L +NR++   L   T  K +         P   + + R+   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E I  DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCG+  CRGTLN
Sbjct: 1727 DGLREHVTGCARSEGYYKIDKKDK------LKYLINNRSLTEELPIDTQGKSI---------PAQPQASTRAG-SERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN 1956          

HSP 2 Score: 119.783 bits (299), Expect = 1.276e-25
Identity = 59/127 (46.46%), Postives = 84/127 (66.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    I T+  E+DL +P+   D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PK  +HLG+AKV+F S + A+  V+  H TS MGNI+ V++D  G+ R   ++ LVN
Sbjct:   87 RDPRIGR-IWTKTKELDLPVPKLKIDEFYVGPVPPKQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFASVKGARDAVKHLHNTSVMGNIIHVELDTKGETRMRFYDLLVN 212          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|Q66J90|SET1B_XENLA (Histone-lysine N-methyltransferase SETD1B OS=Xenopus laevis OX=8355 GN=setd1b PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 1.152e-62
Identity = 126/256 (49.22%), Postives = 161/256 (62.89%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSP------MDVKDNQRSQIR---EARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K                          KY+++ +S  D P        +    ++  R   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E I  DEMVIEYVGQ +R+ +A+ REK+YED+GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+V+TV+ +KKIVIYSK+ IN+ EEITYDYKFP E+ KIPCLCG+  CRGTLN
Sbjct: 1709 DGLREHVTGCARSEGYYKIDKKDK-------------------------LKYLINNRSLADEPPIDTQGKSIPAQPQASTRAGSERRSEQRRLLSSFTG-SCDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFAMEPIVADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVVTVESQKKIVIYSKQYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN 1938          

HSP 2 Score: 116.701 bits (291), Expect = 1.069e-24
Identity = 58/127 (45.67%), Postives = 82/127 (64.57%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    I T+  E+DL +P+   D+  +G  P K+VTF+ LNDNI +  L DMC+  G VEE++ILY+PK  +HLG+AKV+F + + AK  V+  H TS MGNI+  ++D  G+ R   +  LVN
Sbjct:   87 RDPRIG-RIWTKTKELDLPVPKLKIDEFYVGPVPPKQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAKDAVKHLHNTSVMGNIIHAELDTKGETRMRFYELLVN 212          
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Match: sp|E9PYH6|SET1A_MOUSE (Histone-lysine N-methyltransferase SETD1A OS=Mus musculus OX=10090 GN=Setd1a PE=1 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 5.162e-60
Identity = 124/250 (49.60%), Postives = 160/250 (64.00%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLE-STGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P D    H TGSAR++GYY I+  EK              +  + + P +A      R+ E     D +   R  + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP E++KIPCLCG+  CRG+LN
Sbjct: 1491 PQDGPREHQTGSARSEGYYPISKKEK--------------DKYLDVCPVSA------RQLEGG---DTQGTNRV-LSERRSEQRRLLSAIGTSAIMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN 1716          

HSP 2 Score: 112.464 bits (280), Expect = 2.466e-23
Identity = 57/127 (44.88%), Postives = 86/127 (67.72%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            +DPR    + ++  +  L +P+F  D+  IG+ P KEVTF+ LNDN+ +  L+DMCR  G VEE++IL HP+T +HLGLA+V+F S+R AK  V+  H TS MGNI+  ++D+ G+ R + +  +VN
Sbjct:   61 QDPR--CHVRSKARDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEVEEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYYELIVN 185          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A120H352 (SET1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 2384.76 bits (6179), Expect = 0.000e+0
Identity = 1321/1325 (99.70%), Postives = 1322/1325 (99.77%), Query Frame = 1
Query:  298 INKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYXXXXXXXXXXIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHXXXXXXYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTXXXXXXXXXXXXXXXSKIWNSSDDDTDKTETMAAKDNHNMKQXXXXXXXXXXXXXDTDSLMDYKADKTEKAASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVGKDKNRQKFISEKRXXXXXXXXXXXXXXXXXXXXXQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKXXXXXXXXXXXXXVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNXXXXXXXXXXXXXXXXELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDXXXXXXXXXXXXXWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDXXXXXXXXXXXEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            INKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSD+IAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPKEVKKLKPDVSKIWNSSDDDTDKTETMAAKDNHNMK LSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKV KDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKS FKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN
Sbjct:    3 INKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDSIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPKEVKKLKPDVSKIWNSSDDDTDKTETMAAKDNHNMKDLSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVDKDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSHFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 1327          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A2H1CMW7 (SET domain protein OS=Fasciola hepatica OX=6192 GN=D915_04602 PE=4 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 7.307e-86
Identity = 157/259 (60.62%), Postives = 188/259 (72.59%), Query Frame = 1
Query: 3544 THTTGSARTQGYYQITDTEK--RIAAHG-TMLLSSNRNIRMPLVPAT-----AAKYVL--------DRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
             H++G ARTQG+Y+I   E+  R  + G +M+    R   +PL+PAT         +L        +R +E  S  + K  Q +Q REARS QRRL    Q++E TG+LL+ N L  RKK + FAKS IHAWGL+ALE IA +EMVIEYVG VVRK +AE RE++YE KGIG SYLFRIDDD VIDATM G+NARFINHSCQPNC A++ITV+ KKKIVIYSKR IN+MEEITYDYKFPYEE+KIPCLCGS GCRGTLN
Sbjct:  211 VHSSGCARTQGFYRIPAEERFRRPWSVGRSMVGEDGRRRPIPLMPATIEAQLGGDAILQALGVSIEERLTEQAS--EAKKKQLTQFREARSVQRRLLAELQDIE-TGDLLKFNQLKFRKKQLIFAKSPIHAWGLIALEPIAAEEMVIEYVGHVVRKGVAELRERQYEAKGIGGSYLFRIDDDFVIDATMCGNNARFINHSCQPNCYAKIITVESKKKIVIYSKRDINVMEEITYDYKFPYEEEKIPCLCGSSGCRGTLN 466          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183KKJ4 (Histone-lysine N-methyltransferase OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS15556 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.268e-85
Identity = 155/256 (60.55%), Postives = 183/256 (71.48%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEK--RIAAHGTMLLSSN-RNIRMPLVPAT-----AAKYVLDRKSEN------DSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H++GSARTQGYY++   E+  R    G  L+  + R   +PL+PAT          L    EN      +   + K  Q +Q REARS QRRL   FQ++E TG+LL+ N L  RKK + FAKS IHAWGL+ALE IA +EMVIEYVG VVRK +AE RE++YE KGIG SYLFRIDD+ VIDATM G+NARFINHSCQPNC A++I V+ KKKIVIYSKR IN+MEEITYDYKFPYEEDKIPC CGS  CRGTLN
Sbjct:  214 HSSGSARTQGYYRMPTEERFRRPWCVGRSLIGEDGRRRPIPLMPATVQAQLGGDAALQAIGENIEERLTEQASEAKKKQLTQFREARSVQRRLLAEFQDIE-TGDLLKFNQLKFRKKQLIFAKSPIHAWGLIALEPIAAEEMVIEYVGHVVRKGVAELRERQYEAKGIGGSYLFRIDDEFVIDATMCGNNARFINHSCQPNCYAKIIMVESKKKIVIYSKRDINVMEEITYDYKFPYEEDKIPCQCGSSSCRGTLN 468          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A183NDT4 (Histone-lysine N-methyltransferase OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS270 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 5.241e-85
Identity = 155/256 (60.55%), Postives = 183/256 (71.48%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEK--RIAAHGTMLLSSN-RNIRMPLVPAT-----AAKYVLDRKSEN------DSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H++GSARTQGYY++   E+  R    G  L+  + R   +PL+PAT          L    EN      +   + K  Q +Q REARS QRRL   FQ++E TG+LL+ N L  RKK + FAKS IHAWGL+ALE IA +EMVIEYVG VVRK +AE RE++YE KGIG SYLFRIDD+ VIDATM G+NARFINHSCQPNC A++I V+ KKKIVIYSKR IN+MEEITYDYKFPYEEDKIPC CGS  CRGTLN
Sbjct:  240 HSSGSARTQGYYRMPTEERFRRPWCVGRSLIGEDGRRRPIPLMPATVQAQLGGDAALQAIGENIEERLTEQASEAKKKQLTQFREARSVQRRLLAEFQDIE-TGDLLKFNQLKFRKKQLIFAKSPIHAWGLIALEPIAAEEMVIEYVGHVVRKGVAELRERQYEAKGIGGSYLFRIDDEFVIDATMCGNNARFINHSCQPNCYAKIIMVESKKKIVIYSKRDINVMEEITYDYKFPYEEDKIPCQCGSSSCRGTLN 494          
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Match: A0A5K3EYJ7 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 4.762e-83
Identity = 152/254 (59.84%), Postives = 188/254 (74.02%), Query Frame = 1
Query: 3544 THTTGSARTQGYYQITDTEK--RIAAHGTMLLSSNRNIR--MPLVPAT-------AAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
             ++TG ARTQG++++  T++  R    G  ++S +   R  +PL PAT       AA  + D  +E  S    K  + +Q RE RS QRRL   FQ++E TG+LL+ NHL  R+K + FAKS IH WGL+ALE IA +EMVIEYVG VVRK +AE REK+YE +GIGSSYLFRIDD+ VIDATMYG+NARFINHSCQPNC A+VITV+G+KKIVIYSKR I +MEEITYDYKFPYE++KIPCLCG+  CRGTLN
Sbjct:  346 VNSTGCARTQGFFRLDPTQRFRRSWCVGRSMVSEDGTQRYPLPLTPATVELSAISAAHGLADELTEQASV--AKRKKVTQAREVRSVQRRLLAEFQDIE-TGDLLKFNHLEFRRKQLIFAKSPIHHWGLIALEPIAAEEMVIEYVGHVVRKGVAELREKQYEQRGIGSSYLFRIDDEFVIDATMYGNNARFINHSCQPNCYAKVITVEGRKKIVIYSKRDIQVMEEITYDYKFPYEDEKIPCLCGAPQCRGTLN 596          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase [Source:NCBI gene;Acc:103032383])

HSP 1 Score: 239.965 bits (611), Expect = 2.376e-63
Identity = 128/248 (51.61%), Postives = 164/248 (66.13%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDS-PMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K        L+SS      P           D+ ++  S P     + R+   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YE++GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1622 DGMRDHVTGCARSEGYYKIDKKDKL-----KYLISSRPQFDEP-----------DKDTQGKSIPAQPHASTRAG-SERRSEQRRLLSSFS---CDSDLLKFNQLKFRKKKIRFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1849          

HSP 2 Score: 117.857 bits (294), Expect = 5.150e-26
Identity = 61/127 (48.03%), Postives = 82/127 (64.57%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  +G  P KEVTF+ LNDNI +  L DMC+  G +EE++ILY+PK  +HLG+AKV+F S R AK  V+  H TS MGNI+ V++D  G+ R      LVN
Sbjct:   79 RDPRIG-RLWTKYKETDLPVPKFKIDECYVGRIPPKEVTFARLNDNIREGFLTDMCKKFGEIEEVEILYNPKNKKHLGIAKVMFGSVRAAKDAVQNLHNTSVMGNIIHVELDPKGENRLRYVERLVN 204          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: setd1a (histone-lysine N-methyltransferase SETD1A [Source:NCBI gene;Acc:103040137])

HSP 1 Score: 228.409 bits (581), Expect = 8.553e-60
Identity = 121/250 (48.40%), Postives = 159/250 (63.60%), Query Frame = 1
Query: 3526 PTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            P   +  H TG AR++GYY I+  EK              ++ + L    A +  +D ++   + +         + E RSEQRRL +          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 2041 PDGQLREHVTGCARSEGYYAISRKEK--------------DVYLDLDLPEAVQEAVDFETAGSNRL---------LSERRSEQRRLLSAIGTPAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADNREKRYAQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIGVNEEITYDYKFPIEENKIPCLCGTENCRGTLN 2267          

HSP 2 Score: 123.635 bits (309), Expect = 9.525e-28
Identity = 62/149 (41.61%), Postives = 93/149 (62.42%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPP 606
            RDPR +  I +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F S+R AK  V+  H TS MGNI+  ++D+ G+ R + ++ +V    +        K++   + PP
Sbjct:   57 RDPRPR-RIWSRHTELSLPVPKFKLDEYYVGPIPLKEVTFARLNDNIKEPFLLEMCNKFGEVEEMEILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGNIVHAQLDIKGQQRRKYYDLIVGGSYTPQTVPTGGKALTEKFQPP 204          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000042865.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:33356969:33359677:1 gene:ENSAMXG00000033747.1 transcript:ENSAMXT00000042865.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.252 bits (443), Expect = 1.038e-50
Identity = 81/115 (70.43%), Postives = 98/115 (85.22%), Query Frame = 1
Query: 3928 MVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            MVIEYVGQ +R+ +A+ RE++YE +GIGSSYLFR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ KKKIVIYS++QI I EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct:    1 MVIEYVGQSIRQEIADMRERRYEQEGIGSSYLFRVDQDTIIDATKCGNLARFINHSCNPNCYAKVITVEAKKKIVIYSRQQIGINEEITYDYKFPIEDEKIPCLCGAENCRGTLN 115          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000056389.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:23791729:23793332:-1 gene:ENSAMXG00000030713.1 transcript:ENSAMXT00000056389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 4.215e-39
Identity = 70/117 (59.83%), Postives = 89/117 (76.07%), Query Frame = 1
Query: 3928 MVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE--DKIPCLCGSVGCRGTLN 4272
            MVIEY G V+R  L + REK Y+ KGIG  Y+FRIDD  V+DATM+G+ ARFINHSC+PNC +RV+ +DG+K IVI++ R+I   EE+TYDYKFP EE  +K+PC CG+  CR  LN
Sbjct:    1 MVIEYSGNVIRSVLTDKREKYYDGKGIGC-YMFRIDDYEVVDATMHGNAARFINHSCEPNCYSRVVNIDGQKHIVIFAMRKIYRGEELTYDYKFPIEEPGNKLPCNCGAKKCRKFLN 116          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Match: kmt2bb (lysine (K)-specific methyltransferase 2Bb [Source:ZFIN;Acc:ZDB-GENE-080521-1])

HSP 1 Score: 154.066 bits (388), Expect = 6.002e-37
Identity = 80/153 (52.29%), Postives = 103/153 (67.32%), Query Frame = 1
Query: 3823 LRINHLG-ARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE--DKIPCLCGSVGCRGTLN 4272
            +R  HL    K+ +   +S IH  GL     I   EMVIEY G V+R  L + REK Y+ KGIG  Y+FRIDD  V+DATM+G+ ARFINHSC+PNC +RVI V+G+K IVI++ R+I   EE+TYDYKFP E+  +K+ C CG+  CR  LN
Sbjct: 3846 MRFRHLERTSKEAVGVYRSAIHGRGLFCKRNIEAGEMVIEYSGIVIRSVLTDKREKYYDGKGIGC-YMFRIDDFDVVDATMHGNAARFINHSCEPNCYSRVINVEGQKHIVIFALRKIYRGEELTYDYKFPIEDASNKLGCNCGARRCRRFLN 3997          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: setd1a (SET domain containing 1A, histone lysine methyltransferase [Source:ZFIN;Acc:ZDB-GENE-080521-4])

HSP 1 Score: 230.335 bits (586), Expect = 3.840e-61
Identity = 121/246 (49.19%), Postives = 160/246 (65.04%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKR-IAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST---GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H +G AR +G+Y+++  EKR + A G   +  N+ ++     ++AA+   +R                     R EQRRL     ++       ++ + N L  RKK + F KS IH WGL ALE IA +EMVIEYVGQ +R+ +A+ REK+YE +GIGSSYLFR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +K+IVIYSK+ IN+ EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 1632 HLSGCARCEGFYKLSHKEKREVFAQGANAM--NQQLQQQQGGSSAARAGSER---------------------RWEQRRLLASIGSIGGVLADSDVFKFNQLKFRKKKLRFTKSRIHEWGLFALEPIAAEEMVIEYVGQGIRQLVADMREKRYEVEGIGSSYLFRVDHDTIIDATKVGNLARFINHSCNPNCYAKVITVESQKRIVIYSKQAINVNEEITYDYKFPIEENKIPCLCGAEHCRGTLN 1854          

HSP 2 Score: 118.242 bits (295), Expect = 8.325e-27
Identity = 63/152 (41.45%), Postives = 95/152 (62.50%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIP 615
            RDPR K F   R  EIDL +P+F  D++ +G+ P KEVTF  LNDN+ +  L +MC+  G VEE++I+Y+PK  +HLGLAKVVF + R AK  V+  H TS MG+I+  ++D+ G+ R + ++ +V+   +        +  +   +PP IP
Sbjct:   60 RDPRHKRFW-ARTREIDLPVPKFKIDEHYVGQIPPKEVTFVKLNDNVKESFLVEMCKRFGDVEEVEIVYNPKNRKHLGLAKVVFTTVRGAKEAVKNLHNTSVMGSIIHAQLDIKGEQRKKYYDLIVSGQFTPQSVPTGSRP-RLEMFPPPIP 209          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010827.1 (pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 gene:ENSPMAG00000009809.1 transcript:ENSPMAT00000010827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.946 bits (315), Expect = 7.584e-34
Identity = 65/137 (47.45%), Postives = 87/137 (63.50%), Query Frame = 1
Query: 3871 KSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKK-KIVIYSKRQINIMEEITYDYKFPYEED--KIPCLCGSVGCRGTLN 4272
            +      GL A   I    MVIEY+G ++R  +A  RE  Y+ +  G  Y+FRID D VIDAT+ G  AR+INHSC PNC+A V+  D ++ KI+I S R++   EE+TYDYKF +E+D  KIPC CG+  CR  +N
Sbjct:    1 RCATQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRREALYKAQNRGV-YMFRIDGDHVIDATLTGGPARYINHSCSPNCVAEVVNFDKERSKIIIISSRRLQKGEELTYDYKFDFEDDQHKIPCHCGAPNCRKWMN 136          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002322.1 (pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 gene:ENSPMAG00000002099.1 transcript:ENSPMAT00000002322.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.191 bits (339), Expect = 8.222e-32
Identity = 67/138 (48.55%), Postives = 90/138 (65.22%), Query Frame = 1
Query: 3865 FAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEED--KIPCLCGSVGCRGTLN 4272
             A+S I   GL A   I    MVIEY+G+++R  +A   EK YE    G  Y+FR+D + VIDAT+ G  AR+INHSC PNC+A ++T D + KI+I S R+I   EE+TYDY F +E+D  KIPC CG++ CR  +N
Sbjct: 3786 LARSRIQGLGLYASRDIEKHTMVIEYIGEIIRNEVANRHEKLYESTNRGV-YMFRLDSEHVIDATITGGPARYINHSCAPNCVAELVTFDRENKIIISSCRRIQKGEELTYDYLFDFEDDQNKIPCHCGAINCRKWMN 3922          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006880.1 (pep scaffold:Pmarinus_7.0:GL484109:1327:14161:1 gene:ENSPMAG00000006202.1 transcript:ENSPMAT00000006880.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 4.879e-27
Identity = 57/126 (45.24%), Postives = 85/126 (67.46%), Query Frame = 1
Query:  163 DPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            DPR      TR  E +L +P+F  D+  +G  P KEVTF+ LNDNI +  L DMC+  G ++ ++IL+HPKT +H+GLAKV+F + + AK  VEK H TS MGN+M V +D  G++R ++++ L++
Sbjct:    7 DPRASRRW-TRIVEAELPLPKFKIDEYYVGPIPPKEVTFAKLNDNIKEHFLTDMCKKFGDIDAMEILHHPKTRKHMGLAKVIFTTVKAAKEAVEKLHNTSVMGNLMHVLLDNGGEMRGKLYDLLLS 131          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004922.1 (pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 gene:ENSPMAG00000004401.1 transcript:ENSPMAT00000004922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 6.917e-20
Identity = 46/120 (38.33%), Postives = 74/120 (61.67%), Query Frame = 1
Query: 3850 KKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKF 4209
            KK +  A S +  WG+     +  +E + EY G+++ +  A+ R K Y DK +  S+LF +++D V+DAT  G+  RF NHS  PNC A+V+ V+G  +I I++KR I   EE+ +DY++
Sbjct:  648 KKHLLLAPSDVAGWGIFIKVPVQKNEFISEYCGEIISQDEADRRGKVY-DKYM-CSFLFNLNNDFVVDATRKGNKIRFANHSVSPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRY 765          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET1 (Histone methyltransferase, subunit of the COMPASS (Set1C) complex; COMPASS methylates histone H3K4; Set1p-dependent H3K4 trimethylation recruits Nrd1p, allowing efficient termination of snoRNAs and cryptic unstable transcripts (CUTs) by Nrd1p-Nab3p-Sen1p pathway; modulates histone acetylation levels in promoter proximal regions to ensure efficient Nrd1p-dependent termination; required in transcriptional silencing near telomeres and at silent mating type loci; has a SET domain [Source:SGD;Acc:S000001161])

HSP 1 Score: 203.756 bits (517), Expect = 1.282e-53
Identity = 99/198 (50.00%), Postives = 132/198 (66.67%), Query Frame = 1
Query: 3700 KSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST----GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYE---EDKIPCLCGSVGCRGTLN 4272
            +S N  P D    + S  R+ R+  RR Q   +  ++      ELL +N L  RKK + FA+S IH WGL AL++IA  EM+IEYVG+ +R+ +AE REK+Y   GIGSSYLFR+D++ VIDAT  G  ARFINH C PNC A++I V G+++IVIY+ R I   EE+TYDYKF  E   E+++PCLCG+  C+G LN
Sbjct:  883 ESSNKEPSDSVPQEVSSSRDNRASNRRFQQDIEAQKAAIGTESELLSLNQLNKRKKPVMFARSAIHNWGLYALDSIAAKEMIIEYVGERIRQPVAEMREKRYLKNGIGSSYLFRVDENTVIDATKKGGIARFINHCCDPNCTAKIIKVGGRRRIVIYALRDIAASEELTYDYKFEREKDDEERLPCLCGAPNCKGFLN 1080          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Match: SET2 (Histone methyltransferase with a role in transcriptional elongation; methylates H3 lysine 36 (H3K36), which suppresses incorporation of acetylated histones and signals for the deacetylation of these histones within transcribed genes; associates with the C-terminal domain(CTD) of Rpo21p; H3K36me3 (trimethylation) requires Spt6p, proline 38 on H3, CTD of Rpo21p, Ctk1p, and C-terminal SRI domain of Ste2p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000003704])

HSP 1 Score: 73.559 bits (179), Expect = 1.406e-13
Identity = 44/136 (32.35%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 3871 KSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREK--KYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFP-YEEDKIPCLCGSVGCRGTL 4269
            K+    +G+ A + I  ++ + EY G+V+ +   E+R++   Y+ +     Y   + +   IDAT+ GS ARF NHSC PN       V  K ++ I+++R+I   EEIT+DY    Y      C C    C G L
Sbjct:  126 KTKHKGYGVRAEQDIEANQFIYEYKGEVIEEM--EFRDRLIDYDQRHFKHFYFMMLQNGEFIDATIKGSLARFCNHSCSPNAYVNKWVVKDKLRMGIFAQRKILKGEEITFDYNVDRYGAQAQKCYCEEPNCIGFL 259          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO44546 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVC2])

HSP 1 Score: 242.662 bits (618), Expect = 2.999e-73
Identity = 128/238 (53.78%), Postives = 158/238 (66.39%), Query Frame = 1
Query: 3559 SARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            SART+GYY+I   EK   A          NIR              R+ + D  +D     + Q RE R+ QRRLQ    N E  G++L+ N L  RKK + FAKS IH WGL ALE IA DEMVIEYVG+V+R+ +A+YRE+ YE++GIGSSY+FR+D+  +IDAT  G+ ARFINH C PNC A+VI V+  KKIVIYSKR I + EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct:    1 SARTEGYYKIDMKEKAKYAE---------NIR--------------RQVQRDEKLDASKG-KQQSRENRAMQRRLQLAVCN-EDFGDILKFNKLRVRKKQLKFAKSSIHDWGLFALEPIAADEMVIEYVGEVIRQAIADYRERCYEERGIGSSYMFRLDETTIIDATTMGNFARFINHCCDPNCYAKVIAVENMKKIVIYSKRDIQVDEEITYDYKFPIEDEKIPCLCGAPQCRGTLN 213          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK5])

HSP 1 Score: 158.303 bits (399), Expect = 6.024e-43
Identity = 79/153 (51.63%), Postives = 101/153 (66.01%), Query Frame = 1
Query: 3823 LRINHL---GARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            +R  HL      K  +   +SGIH  GL     IA  EMVIEY G ++R  L + RE  YE KGIG  Y+FRID   V+DAT  G+ ARFINHSC+PNC +RV+T+DG KKI+I++ + I+  EE+TYDYKFP E++K+PC C S  CR  LN
Sbjct:  137 MRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGC-YMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 288          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO30858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZK6])

HSP 1 Score: 158.688 bits (400), Expect = 1.082e-42
Identity = 79/153 (51.63%), Postives = 101/153 (66.01%), Query Frame = 1
Query: 3823 LRINHL---GARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            +R  HL      K  +   +SGIH  GL     IA  EMVIEY G ++R  L + RE  YE KGIG  Y+FRID   V+DAT  G+ ARFINHSC+PNC +RV+T+DG KKI+I++ + I+  EE+TYDYKFP E++K+PC C S  CR  LN
Sbjct:  163 MRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGC-YMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 314          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO31259 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYF5])

HSP 1 Score: 158.303 bits (399), Expect = 1.223e-42
Identity = 79/153 (51.63%), Postives = 101/153 (66.01%), Query Frame = 1
Query: 3823 LRINHL---GARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            +R  HL      K  +   +SGIH  GL     IA  EMVIEY G ++R  L + RE  YE KGIG  Y+FRID   V+DAT  G+ ARFINHSC+PNC +RV+T+DG KKI+I++ + I+  EE+TYDYKFP E++K+PC C S  CR  LN
Sbjct:  160 MRYRHLKQNNYNKGTIAVFRSGIHGRGLYCTRHIAAGEMVIEYSGMLIRSTLTDKREAYYESKGIGC-YMFRIDGTYVVDATTSGNAARFINHSCEPNCYSRVVTIDGNKKILIFASKSISRGEELTYDYKFPLEDEKLPCHCKSKRCRKYLN 311          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Match: EDO37589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFA7])

HSP 1 Score: 121.709 bits (304), Expect = 6.712e-29
Identity = 68/138 (49.28%), Postives = 91/138 (65.94%), Query Frame = 1
Query: 3865 FAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEED--KIPCLCGSVGCRGTLN 4272
              +S I   GL A   + P  MVIEY+G ++R  +A  +E  YE +  G  Y+FRID D VIDAT+ G  AR+INHSC PNC+A V+T + ++KI+I S R+I   EE+TYDYKF +E+D  KI CLCG+  CR  +N
Sbjct:  327 LGRSNIQGLGLFANRDMEPGCMVIEYIGSIIRNEVANKKESIYESQNRGI-YMFRIDSDSVIDATIAGGPARYINHSCMPNCVAEVVTFEKEQKIIIISSRKIEKGEELTYDYKFDFEDDEHKISCLCGAPNCRKWMN 463          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: setd1ba (SET domain containing 1B, histone lysine methyltransferase [Source:NCBI gene;Acc:101162384])

HSP 1 Score: 235.728 bits (600), Expect = 3.840e-62
Identity = 127/247 (51.42%), Postives = 163/247 (65.99%), Query Frame = 1
Query: 3532 DVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            D +  H TG AR++GYY+I   +K      + LLS    +       T    +         P  V+ + R+   E RSEQRRL + F       +LL+ N L  RKK + F KS IH WGL A+E IA DEMVIEYVGQ +R+ +A+ REK+YE++GIGSSY+FR+D D +IDAT  G+ ARFINHSC PNC A+VITV+ +KKIVIYS++ IN+ EEITYDYKFP E++KIPCLCG+  CRGTLN
Sbjct: 1518 DGMRDHATGCARSEGYYKIDKKDKIKYLQSSRLLSEEPPV------DTQGMSI---------PAQVQASSRAG-SERRSEQRRLLSSFA---CDSDLLKFNQLKFRKKKIRFCKSNIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEEEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSRQPINVNEEITYDYKFPIEDEKIPCLCGAENCRGTLN 1745          

HSP 2 Score: 117.857 bits (294), Expect = 6.021e-26
Identity = 61/127 (48.03%), Postives = 84/127 (66.14%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR    + T+  E DL +P+F  D+  IG  P KEVTF+ LNDNI +  L DMC+  G +EE++ILY+PK  +HLG+AKVVF + ++AK  V+  H TS MGNI+ V++D  G+ R   F  L+N
Sbjct:   82 RDPRIG-RLWTKYKETDLPVPKFKIDECYIGPVPPKEVTFARLNDNIREGFLTDMCKKFGDIEEVEILYNPKNKKHLGIAKVVFENVKSAKVAVQSLHNTSVMGNIIHVELDPKGENRLRYFQLLMN 207          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: setd1a (histone-lysine N-methyltransferase SETD1A [Source:NCBI gene;Acc:101168786])

HSP 1 Score: 232.261 bits (591), Expect = 5.604e-61
Identity = 125/243 (51.44%), Postives = 160/243 (65.84%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK +            ++ +P       + V+ R+ EN   +D     R  + E RSEQRRL T          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A++REK Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 1966 HLTGCARSEGYYAISRKEKDVYL----------DLDLP-------EQVI-REVEN---VDTSGANRV-LSERRSEQRRLLTVMGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADHREKIYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN 2186          

HSP 2 Score: 123.635 bits (309), Expect = 1.195e-27
Identity = 59/127 (46.46%), Postives = 87/127 (68.50%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR +  + +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F S+R AK  V+  H TS MG I+ V++D+ G+ R + ++ +VN
Sbjct:   57 RDPRPR-RLWSRYTELSLPVPKFKLDEFFVGPIPLKEVTFARLNDNIKEPFLAEMCSKFGEVEEMEILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGTIIHVQLDIKGQQRQKYYDLIVN 182          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: setd1a (histone-lysine N-methyltransferase SETD1A [Source:NCBI gene;Acc:101168786])

HSP 1 Score: 232.261 bits (591), Expect = 5.604e-61
Identity = 125/243 (51.44%), Postives = 160/243 (65.84%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK +            ++ +P       + V+ R+ EN   +D     R  + E RSEQRRL T          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A++REK Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 1966 HLTGCARSEGYYAISRKEKDVYL----------DLDLP-------EQVI-REVEN---VDTSGANRV-LSERRSEQRRLLTVMGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADHREKIYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN 2186          

HSP 2 Score: 123.635 bits (309), Expect = 1.195e-27
Identity = 59/127 (46.46%), Postives = 87/127 (68.50%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR +  + +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F S+R AK  V+  H TS MG I+ V++D+ G+ R + ++ +VN
Sbjct:   57 RDPRPR-RLWSRYTELSLPVPKFKLDEFFVGPIPLKEVTFARLNDNIKEPFLAEMCSKFGEVEEMEILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGTIIHVQLDIKGQQRQKYYDLIVN 182          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: setd1a (histone-lysine N-methyltransferase SETD1A [Source:NCBI gene;Acc:101168786])

HSP 1 Score: 232.261 bits (591), Expect = 5.604e-61
Identity = 125/243 (51.44%), Postives = 160/243 (65.84%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK +            ++ +P       + V+ R+ EN   +D     R  + E RSEQRRL T          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A++REK Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 1966 HLTGCARSEGYYAISRKEKDVYL----------DLDLP-------EQVI-REVEN---VDTSGANRV-LSERRSEQRRLLTVMGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADHREKIYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN 2186          

HSP 2 Score: 123.635 bits (309), Expect = 1.195e-27
Identity = 59/127 (46.46%), Postives = 87/127 (68.50%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR +  + +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F S+R AK  V+  H TS MG I+ V++D+ G+ R + ++ +VN
Sbjct:   57 RDPRPR-RLWSRYTELSLPVPKFKLDEFFVGPIPLKEVTFARLNDNIKEPFLAEMCSKFGEVEEMEILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGTIIHVQLDIKGQQRQKYYDLIVN 182          
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Match: setd1a (histone-lysine N-methyltransferase SETD1A [Source:NCBI gene;Acc:101168786])

HSP 1 Score: 232.261 bits (591), Expect = 5.604e-61
Identity = 125/243 (51.44%), Postives = 160/243 (65.84%), Query Frame = 1
Query: 3547 HTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLEST-GELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            H TG AR++GYY I+  EK +            ++ +P       + V+ R+ EN   +D     R  + E RSEQRRL T          +LL++N L  RKK + F +S IH WGL A+E IA DEMVIEYVGQ +R+ +A++REK Y  +GIGSSYLFR+D D +IDAT  G+ ARFINH C PNC A+VIT++ +KKIVIYSK+ I + EEITYDYKFP EE+KIPCLCG+  CRGTLN
Sbjct: 1966 HLTGCARSEGYYAISRKEKDVYL----------DLDLP-------EQVI-REVEN---VDTSGANRV-LSERRSEQRRLLTVMGTTAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADHREKIYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITIESQKKIVIYSKQPIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN 2186          

HSP 2 Score: 123.635 bits (309), Expect = 1.195e-27
Identity = 59/127 (46.46%), Postives = 87/127 (68.50%), Query Frame = 1
Query:  160 RDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVN 540
            RDPR +  + +R  E+ L +P+F  D+  +G  P KEVTF+ LNDNI +  L +MC   G VEE++IL+HPKT +HLGLA+V+F S+R AK  V+  H TS MG I+ V++D+ G+ R + ++ +VN
Sbjct:   57 RDPRPR-RLWSRYTELSLPVPKFKLDEFFVGPIPLKEVTFARLNDNIKEPFLAEMCSKFGEVEEMEILFHPKTRKHLGLARVLFTSTRGAKDTVKHLHNTSVMGTIIHVQLDIKGQQRQKYYDLIVN 182          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 2533.44 bits (6565), Expect = 0.000e+0
Identity = 1409/1413 (99.72%), Postives = 1411/1413 (99.86%), Query Frame = 1
Query:   34 MDINGTKTIDALKLATERDLLDKKEYQFETXXXXXXXXXXXXRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYXXXXXXXXXXIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHXXXXXXYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTXXXXXXXXXXXXXXXSKIWNSSDDDTDKTETMAAKDNHNMKQXXXXXXXXXXXXXDTDSLMDYKADKTEKAASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVGKDKNRQKFISEKRXXXXXXXXXXXXXXXXXXXXXQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKXXXXXXXXXXXXXVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNXXXXXXXXXXXXXXXXELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDXXXXXXXXXXXXXWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDXXXXXXXXXXXEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            MDINGTKTIDALKLATERDLLDKKEYQ+ETKPIKKEKIENKPRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPK ITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPKEVKKLKPDVSKIWNSSDDDTDKTETMAAKDNHNMKQLSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQ+EIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKV KDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN
Sbjct:    1 MDINGTKTIDALKLATERDLLDKKEYQYETKPIKKEKIENKPRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKLITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPKEVKKLKPDVSKIWNSSDDDTDKTETMAAKDNHNMKQLSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQIEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVDKDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 1413          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000062296.1 (SMESG000062296.1)

HSP 1 Score: 2487.99 bits (6447), Expect = 0.000e+0
Identity = 1382/1413 (97.81%), Postives = 1386/1413 (98.09%), Query Frame = 1
Query:   34 MDINGTKTIDALKLATERDLLDKKEYQFETXXXXXXXXXXXXRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYXXXXXXXXXXIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHXXXXXXYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTXXXXXXXXXXXXXXXSKIWNSSDDDTDKTETMAAKDNHNMKQXXXXXXXXXXXXXDTDSLMDYKADKTEKAASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVGKDKNRQKFISEKRXXXXXXXXXXXXXXXXXXXXXQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKXXXXXXXXXXXXXVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNXXXXXXXXXXXXXXXXELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDXXXXXXXXXXXXXWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDXXXXXXXXXXXEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            MDINGTKTIDALKLATERDLLDKKEYQ+ETKPIKKEKIENKPRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPK ITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPK                  +  K +    KDNHNMKQLSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQ+EIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKV KDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN
Sbjct:    1 MDINGTKTIDALKLATERDLLDKKEYQYETKPIKKEKIENKPRDPRKKIFIVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRICGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMDVKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVISSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLSNSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKLITDNNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHKQEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQFIDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEIGASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSPLDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYYRRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDSDLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPK------------------EVKKLKPDVTKDNHNMKQLSSNLKRRSNNLSDTDSLMDYKADKTEKAASAKKQIEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVDKDKNRQKFISEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKPIRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKFGAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQSSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAADTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVSKSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTNGIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDYPCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITKKRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLLSSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 1395          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000027630.1 (SMESG000027630.1)

HSP 1 Score: 159.458 bits (402), Expect = 1.145e-38
Identity = 76/166 (45.78%), Postives = 106/166 (63.86%), Query Frame = 1
Query: 3775 RRLQTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIPCLCGSVGCRGTLN 4272
            R L   F+NL         N + AR K +    S IH  GL A       E++IEYVG+V+R  L++ RE +Y+  G+   Y+FR+D DL++DAT  G+ ARFINHSC PNC A+V+  +G+K I+I ++R+I   EE+TYDY+FP E+DK+PC CGS  C+  LN
Sbjct: 2518 RTLADQFRNLR--------NGMDARAKTVRVCVSNIHGRGLFARRQFDAHEIIIEYVGEVIRSILSDVRETEYQRTGV-DCYMFRLDQDLIVDATFKGNAARFINHSCHPNCYAKVVRFEGEKHIIIIAQRKIYKGEELTYDYRFPIEDDKLPCTCGSFSCKKYLN 2674          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000071222.1 (SMESG000071222.1)

HSP 1 Score: 136.732 bits (343), Expect = 6.460e-32
Identity = 62/141 (43.97%), Postives = 95/141 (67.38%), Query Frame = 1
Query: 3859 MTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEE---DKIPCLCGSVGCRGTLN 4272
            +  ++S I   GL A +      M+IEY+G+++R  +   REK Y+ +   S Y+FR+++DL+IDAT+ G  AR+INHSC PNC+A  +++D   +I+I +++ I   EE+TYDYKF +E+   DKIPCLCGS+ CR  +N
Sbjct: 1195 VILSRSKIQGLGLFAAKDFEKSTMIIEYLGEIIRNEVGNSREKLYQARN-NSIYMFRLNEDLIIDATVNGGLARYINHSCNPNCVAETLSLDCGSRIIITTRQLIERGEELTYDYKFDFEDNKADKIPCLCGSINCRKWMN 1334          
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Match: SMESG000064115.1 (SMESG000064115.1)

HSP 1 Score: 128.642 bits (322), Expect = 1.964e-29
Identity = 64/141 (45.39%), Postives = 88/141 (62.41%), Query Frame = 1
Query: 3859 MTFAKSGIHAWGLVALETIAPDEMVIEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARFINHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYE---EDKIPCLCGSVGCRGTLN 4272
            +   +S I  +GL A + +    M+IEYVG+++R  +A  REK+YE K  G  Y+FR+D   VIDAT  G  AR+INH C PNC   ++  + +  IVI S R+I   EE+TYDYKF  +   +DKIPCLCG+  CR  +N
Sbjct: 1325 VVLKRSKIQGFGLYAAKDLEKGTMIIEYVGELIRNEVANIREKQYESKKQGI-YMFRLDPSTVIDATRAGDLARYINHCCDPNCFTELLDFEKESHIVIISNRKIEKGEELTYDYKFDLDDGKDDKIPCLCGARNCRRWMN 1464          
The following BLAST results are available for this feature:
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SETD1A3.788e-6049.60SET domain containing 1A, histone lysine methyltra... [more]
SETD1B3.683e-5950.00SET domain containing 1B, histone lysine methyltra... [more]
SETD1B3.977e-5950.00SET domain containing 1B, histone lysine methyltra... [more]
SETD1B5.308e-5950.00SET domain containing 1B, histone lysine methyltra... [more]
SETD1B5.308e-5950.00SET domain containing 1B, histone lysine methyltra... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
set-22.411e-5959.54Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-21.239e-5759.54Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-21.276e-5759.54Histone-lysine N-methyltransferase set-2 [Source:... [more]
set-164.495e-2744.06Histone-lysine N-methyltransferase [Source:UniPro... [more]
set-121.748e-2238.97Histone-lysine N-methyltransferase [Source:UniPro... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Set12.339e-6752.55gene:FBgn0040022 transcript:FBtr0302246[more]
Set12.339e-6752.55gene:FBgn0040022 transcript:FBtr0302248[more]
Set12.339e-6752.55gene:FBgn0040022 transcript:FBtr0302243[more]
Set12.339e-6752.55gene:FBgn0040022 transcript:FBtr0113869[more]
Set12.339e-6752.55gene:FBgn0040022 transcript:FBtr0113870[more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1ba8.522e-6551.42SET domain containing 1B, histone lysine methyltra... [more]
setd1ba8.522e-6551.42SET domain containing 1B, histone lysine methyltra... [more]
setd1ba8.993e-6551.42SET domain containing 1B, histone lysine methyltra... [more]
AL928885.18.003e-6149.79SET domain containing 1A, histone lysine methyltra... [more]
setd1a8.749e-6149.79SET domain containing 1A, histone lysine methyltra... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1b2.898e-6452.23SET domain containing 1B [Source:NCBI gene;Acc:780... [more]
setd1b3.158e-6452.23SET domain containing 1B [Source:NCBI gene;Acc:780... [more]
ckap41.320e-6149.60cytoskeleton-associated protein 4 [Source:Xenbase;... [more]
ralgapa22.313e-3852.29Ral GTPase activating protein, alpha subunit 2 (ca... [more]
kmt2b1.701e-3752.94lysine methyltransferase 2B [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm493882.138e-6149.60predicted gene, 49388 [Source:MGI Symbol;Acc:MGI:6... [more]
Setd1a7.380e-6149.60SET domain containing 1A [Source:MGI Symbol;Acc:MG... [more]
Setd1a7.380e-6149.60SET domain containing 1A [Source:MGI Symbol;Acc:MG... [more]
Setd1b4.366e-6052.00SET domain containing 1B [Source:MGI Symbol;Acc:MG... [more]
Setd1b4.428e-6052.00SET domain containing 1B [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5LJZ2|SET1_DROME2.345e-6652.55Histone-lysine N-methyltransferase SETD1 OS=Drosop... [more]
sp|Q1LY77|SE1BA_DANRE7.193e-6451.42Histone-lysine N-methyltransferase SETD1B-A OS=Dan... [more]
sp|Q08D57|SET1B_XENTR1.334e-6352.23Histone-lysine N-methyltransferase SETD1B OS=Xenop... [more]
sp|Q66J90|SET1B_XENLA1.152e-6249.22Histone-lysine N-methyltransferase SETD1B OS=Xenop... [more]
sp|E9PYH6|SET1A_MOUSE5.162e-6049.60Histone-lysine N-methyltransferase SETD1A OS=Mus m... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A120H3520.000e+099.70SET1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A2H1CMW77.307e-8660.62SET domain protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A183KKJ42.268e-8560.55Histone-lysine N-methyltransferase OS=Schistosoma ... [more]
A0A183NDT45.241e-8560.55Histone-lysine N-methyltransferase OS=Schistosoma ... [more]
A0A5K3EYJ74.762e-8359.84Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1ba2.376e-6351.61SET domain containing 1B, histone lysine methyltra... [more]
setd1a8.553e-6048.40histone-lysine N-methyltransferase SETD1A [Source:... [more]
ENSAMXT00000042865.11.038e-5070.43pep primary_assembly:Astyanax_mexicanus-2.0:6:3335... [more]
ENSAMXT00000056389.14.215e-3959.83pep primary_assembly:Astyanax_mexicanus-2.0:2:2379... [more]
kmt2bb6.002e-3752.29lysine (K)-specific methyltransferase 2Bb [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1a3.840e-6149.19SET domain containing 1A, histone lysine methyltra... [more]
ENSPMAT00000010827.17.584e-3447.45pep scaffold:Pmarinus_7.0:GL487806:1944:5585:-1 ge... [more]
ENSPMAT00000002322.18.222e-3248.55pep scaffold:Pmarinus_7.0:GL477101:2485:64197:1 ge... [more]
ENSPMAT00000006880.14.879e-2745.24pep scaffold:Pmarinus_7.0:GL484109:1327:14161:1 ge... [more]
ENSPMAT00000004922.16.917e-2038.33pep scaffold:Pmarinus_7.0:GL479351:23010:32607:-1 ... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SET11.282e-5350.00Histone methyltransferase, subunit of the COMPASS ... [more]
SET21.406e-1332.35Histone methyltransferase with a role in transcrip... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO445462.999e-7353.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308576.024e-4351.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308581.082e-4251.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312591.223e-4251.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375896.712e-2949.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd1ba3.840e-6251.42SET domain containing 1B, histone lysine methyltra... [more]
setd1a5.604e-6151.44histone-lysine N-methyltransferase SETD1A [Source:... [more]
setd1a5.604e-6151.44histone-lysine N-methyltransferase SETD1A [Source:... [more]
setd1a5.604e-6151.44histone-lysine N-methyltransferase SETD1A [Source:... [more]
setd1a5.604e-6151.44histone-lysine N-methyltransferase SETD1A [Source:... [more]
back to top
BLAST of Histone-lysine N-methyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062296.10.000e+099.72SMESG000062296.1[more]
SMESG000062296.10.000e+097.81SMESG000062296.1[more]
SMESG000027630.11.145e-3845.78SMESG000027630.1[more]
SMESG000071222.16.460e-3243.97SMESG000071222.1[more]
SMESG000064115.11.964e-2945.39SMESG000064115.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033482 ID=SMED30033482|Name=Histone-lysine N-methyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=4432bp
TATATAAATCTTATATGTTTTTGACCAAACTAAATGGATATAAATGGAAC
CAAGACTATTGATGCTTTGAAATTAGCAACTGAAAGAGATTTATTAGACA
AAAAAGAATATCAATTTGAAACCAAGCCAATCAAAAAAGAAAAAATTGAA
AATAAACCTAGAGATCCTAGAAAGAAGATATTTATAGTTACCAGAAAAGA
TGAAATAGATTTAGTTATACCTCAATTTGTGTTCGATAAAAATTCTATAG
GAGAACCTCCGGAAAAAGAAGTCACTTTTTCCAATTTAAATGATAATATA
AATAAAAAAAATTTGGAAGACATGTGCCGAATTTGTGGACCTGTAGAAGA
AATAAAAATTTTATATCACCCTAAAACAAACAGACACCTTGGTTTGGCTA
AAGTTGTGTTTAGGAGTTCTCGTAACGCTAAAAGTTGTGTTGAGAAATAT
CACACTACTTCAAAAATGGGAAATATAATGGATGTAAAAATAGATGTACT
AGGAAAAATTCGAAACGAAATGTTCAATAATTTAGTAAATCCTGTTTTAA
GTCAAGCTGATACTGAAGCAGAGGTTAAATCTGTTCAGTGGGGATATTAT
CCTCCAGATATTCCTACGAATAATTACGTAATATCGTCTGAAGAAAATAA
ACCAATTTTACAAAGTCAGTCGGCGAGTAAAATCGAAACGATTTCAGATG
TTACAACTCAACCCAATAATGATGTTGATAGTGGTTCTGAGTATTGCAGT
GATGACAGCCACGGACAAAAATATTTACTTAGTAATAGTGTTGTATCATC
ATCTATTGATCCAAGTAGAATGGTTGCCAGTTCATTAACCAATGAACCAC
TGGAGCCTTTAGAAATCAGAATTCAAAAATTATTGACTGGTACTAGTCTT
TGCTCTGAATCTAAACCTAAACCCATTACTGACAATAATGACATTTCTTC
TTCGACTGAACCCTTTATTTATGAGGAGCTATGCAATCAACCAGGTTATA
ATCCACCGAATAGTAGTATCAAACTAGAACTTAAAAAGTATACCGATGAA
AAATTAAACATAGATAATATTAATAATCATAAACAAGAAGAATTTACCAA
TAGTAGAATCAGACATTCTAGCAAAAGCAGTTCCTATCATCCCAACCAAA
GAATTTTGGTGTTAAAAACCCCTCCGAAAAAGTTAACCGACCATGAAGTT
GAAGACATTTTAGAAAAGTTAAAAAATCAGTTTATTGACGATTTAAAGGA
AACCCTACATCGAGATATCTGTAAGAAAATGATTGAAACAACTGCATACG
GTTCATTTCATAATTGGTGGGATTTCAAGGAGCATGAGAATAAGAGTTCC
ATTGGGGACAAGCCTGATTCTATTACTGAAATCGGAGCATCAAATATTCA
ACACAAATCATATTTTGGTTCTTCAGATAACATAGCTCCAAGGCACGGAG
ATAAAACAAATGTATTCCAAGCACAATTGACTAACTACACTGGATTACCA
AAAATAAAAAGATTAGCAAGAAAATCATCACCATTGGATGAAAATAATTA
TCATCGGTCGCGCGTTTCTCCAAATTCAGATAAGAAAAGTAATCATTGGT
CTCATAGGGATTCATATTCCAAGCACCGCGGTGATCGTCAAATTGACAAT
CATTATTTTAGGTCCAATAAAGATAGCTATTATCGTCGCTATGACAAGCA
CAGAGACCATTACCATCATGATCGTGATGATCATTATCGCGATGAAAGTA
GACGTGAAGATAAACACGAAGCTAGAGTTACAAAGAAAAGATATGAAAAG
ACAGATGGATTTGTGTCGGAAACCGATGATTCCGACCTTGGAGGGAATTT
AAGAGATCCTGAACCTACAGTGAAGAACATTGATACCGTTCATGACAATA
TCGCTGAAAACAATTTTACAACGGATAAGCCATTACCAAAAGAAGTCAAA
AAGCTAAAACCAGATGTGAGTAAGATTTGGAATTCAAGTGATGACGATAC
TGATAAAACTGAAACTATGGCAGCCAAGGATAATCATAACATGAAACAAT
TGTCATCGAATTTAAAACGAAGATCAAACAACTTATCTGATACGGATAGT
TTAATGGATTACAAAGCTGATAAAACGGAAAAAGCAGCTAGTGCTAAAAA
GCAGTTAGAAATTAAGAATGAGAAGAAAGATGTAAATGAAAAACCTGAAG
TTAGAATCATAAAACGAGGTCGTCCACCAAAGCAATCACTAATTGAAAAA
GTCGGTAAGGATAAAAATAGACAAAAATTCATCAGTGAGAAACGAGACTT
ATCATCAAGTGGAAGTATAAGTGATGACGAGGAAGATGATGATTCAGGTG
ACAAATCACAATTATCATCTTTAAGCATTTATTCAAATGACAAGACTTTT
AAACATTTGCAAAGAAAACCAGAGCGTAAACCAATTCGTCGACCAACTAA
AATAAGTGACGACGATGAAGAATCTAGTGCAGATCGTACGTGTATAAAAC
CTAAAAAACGGCAGTTGAATGAAGACACGTGGGATAATTCTAGTAATACT
ATAAAGCAATTCAAAACTCATGAAATTAAATTTGGAGCACACTTGGATAC
GTTGACGTATGAATCTGAGCTATATTTCCAAGATCTTTCATTCTGGGATA
AATTAGAGGACAATTCTGATAAACAATATTCCAGCTTGGGATATAATTTA
TTAACAAATCAACATAAAATCTTCAGCATTCAGTCTTCAAACAAAATTTC
TTCCTCTGTGCCTAATCGAAGAAAACAAAATCTAATTCCTTACGGAAAAG
AAAATTCAGTTTCAAATCAATCAAAACCTTCCTCACGTTTGATTACAAAC
TCGCGTTCACATTCAAATAGTGTTGAAGCTGCTGATACTACTGATAGTGC
AGATGCTGAATCAGTTGAATTAGAAAATTTTATTGATGATATCTATAAGT
GGGATCAAATCATTATTCACGATCATAATTATTTCCAAGAACCTACTGTT
GGAACAAGTATAAAATATAAAACCAAAGTTAGCAAATCTCAATTTAAATT
GCATAAAGTACATAATATTGACCAACAGGATGTTAAATACTCTTTCGCTG
AAAAAAGTATAATATCAACCAATGAAATTACTTCAGAAGCCTTAACTCCA
CAAACTAGAGTTCTCAGTCAAATTTTTACAAACGGGATTGACGCTGAAGA
TAAGTTATTCTTTCAATTTGCTTATAAAAGAATGGTATCGAGTTTGAATG
ATCGAGAAAGATTATCACATTCTGAAAATGATTCGCTCAATAATAACATT
TCATTAATCTCTTCCATAAATTGGGACGATTATCCATGTACGAAAGTTCC
CCCTCCGTCAGAATTGAAATATATATGTAATTCCGGTGATATCAGATTAG
AAATTACAGATCGGCCTCTTTCACGGAAACGATTCTATGATAATTGCATT
ACTGATATAGTAAATGATAAAAAAATTACCAAAAAACGCCGGAAATTAAA
AGAAGGTATTAGTTGCAATGACGATCCAACAGATGTAATAACAACTCACA
CAACTGGGTCGGCCAGAACTCAGGGATACTATCAAATAACAGACACAGAA
AAAAGAATAGCAGCTCATGGGACAATGCTATTATCGAGCAATAGAAATAT
CAGAATGCCATTGGTTCCCGCAACTGCTGCAAAATATGTATTGGATCGAA
AATCAGAAAACGATTCTCCTATGGATGTAAAAGACAATCAAAGATCTCAA
ATAAGAGAAGCGCGCTCAGAACAAAGACGACTGCAAACTGGATTCCAGAA
CCTTGAAAGCACAGGGGAGTTGTTAAGGATAAATCATCTAGGAGCCAGAA
AAAAATTGATGACATTTGCAAAATCAGGAATTCACGCGTGGGGTCTTGTT
GCCTTAGAAACAATTGCGCCTGACGAAATGGTTATTGAATATGTTGGTCA
AGTAGTAAGGAAATTTCTTGCTGAATATAGAGAAAAAAAGTATGAAGACA
AGGGAATCGGAAGTTCGTACTTGTTTCGTATAGACGACGATTTAGTTATT
GATGCTACAATGTACGGAAGTAATGCCAGATTTATTAATCATAGTTGCCA
ACCAAATTGTATAGCCAGAGTCATTACAGTTGATGGGAAAAAGAAAATTG
TTATCTACTCCAAACGTCAAATAAACATTATGGAAGAAATCACATACGAC
TACAAATTTCCCTATGAAGAAGATAAGATACCTTGTTTATGTGGAAGTGT
GGGCTGTCGTGGTACACTCAACTGAACGTATTTTTTCGCAAAATCAGCAT
TTTTGACTAAAAAGATAAATATCGATCTGACACTGTATATATATTTGTAA
AAAGCTACTGTCATTTTACAATGTTTCAATAAGATTCTATTTGTATTTCA
TTTTATTTTGCTGTTAATAAAAATTGGGTGCA
back to top

protein sequence of SMED30033482-orf-1

>SMED30033482-orf-1 ID=SMED30033482-orf-1|Name=SMED30033482-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1414bp
MDINGTKTIDALKLATERDLLDKKEYQFETKPIKKEKIENKPRDPRKKIF
IVTRKDEIDLVIPQFVFDKNSIGEPPEKEVTFSNLNDNINKKNLEDMCRI
CGPVEEIKILYHPKTNRHLGLAKVVFRSSRNAKSCVEKYHTTSKMGNIMD
VKIDVLGKIRNEMFNNLVNPVLSQADTEAEVKSVQWGYYPPDIPTNNYVI
SSEENKPILQSQSASKIETISDVTTQPNNDVDSGSEYCSDDSHGQKYLLS
NSVVSSSIDPSRMVASSLTNEPLEPLEIRIQKLLTGTSLCSESKPKPITD
NNDISSSTEPFIYEELCNQPGYNPPNSSIKLELKKYTDEKLNIDNINNHK
QEEFTNSRIRHSSKSSSYHPNQRILVLKTPPKKLTDHEVEDILEKLKNQF
IDDLKETLHRDICKKMIETTAYGSFHNWWDFKEHENKSSIGDKPDSITEI
GASNIQHKSYFGSSDNIAPRHGDKTNVFQAQLTNYTGLPKIKRLARKSSP
LDENNYHRSRVSPNSDKKSNHWSHRDSYSKHRGDRQIDNHYFRSNKDSYY
RRYDKHRDHYHHDRDDHYRDESRREDKHEARVTKKRYEKTDGFVSETDDS
DLGGNLRDPEPTVKNIDTVHDNIAENNFTTDKPLPKEVKKLKPDVSKIWN
SSDDDTDKTETMAAKDNHNMKQLSSNLKRRSNNLSDTDSLMDYKADKTEK
AASAKKQLEIKNEKKDVNEKPEVRIIKRGRPPKQSLIEKVGKDKNRQKFI
SEKRDLSSSGSISDDEEDDDSGDKSQLSSLSIYSNDKTFKHLQRKPERKP
IRRPTKISDDDEESSADRTCIKPKKRQLNEDTWDNSSNTIKQFKTHEIKF
GAHLDTLTYESELYFQDLSFWDKLEDNSDKQYSSLGYNLLTNQHKIFSIQ
SSNKISSSVPNRRKQNLIPYGKENSVSNQSKPSSRLITNSRSHSNSVEAA
DTTDSADAESVELENFIDDIYKWDQIIIHDHNYFQEPTVGTSIKYKTKVS
KSQFKLHKVHNIDQQDVKYSFAEKSIISTNEITSEALTPQTRVLSQIFTN
GIDAEDKLFFQFAYKRMVSSLNDRERLSHSENDSLNNNISLISSINWDDY
PCTKVPPPSELKYICNSGDIRLEITDRPLSRKRFYDNCITDIVNDKKITK
KRRKLKEGISCNDDPTDVITTHTTGSARTQGYYQITDTEKRIAAHGTMLL
SSNRNIRMPLVPATAAKYVLDRKSENDSPMDVKDNQRSQIREARSEQRRL
QTGFQNLESTGELLRINHLGARKKLMTFAKSGIHAWGLVALETIAPDEMV
IEYVGQVVRKFLAEYREKKYEDKGIGSSYLFRIDDDLVIDATMYGSNARF
INHSCQPNCIARVITVDGKKKIVIYSKRQINIMEEITYDYKFPYEEDKIP
CLCGSVGCRGTLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR035979RBD_domain_sf
IPR024657COMPASS_Set1_N-SET
IPR003616Post-SET_dom
IPR001214SET_dom
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 694..714
NoneNo IPR availableGENE3DG3DSA:2.170.270.10coord: 1216..1413
e-value: 3.7E-52
score: 179.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 495..543
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 489..543
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 918..956
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 802..829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 690..761
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 667..689
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 918..953
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1222..1248
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 667..829
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 561..583
NoneNo IPR availablePANTHERPTHR45814FAMILY NOT NAMEDcoord: 20..1413
NoneNo IPR availableCDDcd12304RRM_Set1coord: 76..168
e-value: 2.79755E-44
score: 153.222
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 1273..1410
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 79..152
e-value: 2.7E-9
score: 46.9
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 83..146
e-value: 2.3E-9
score: 37.0
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 78..152
score: 8.859
IPR024657COMPASS complex Set1 subunit, N-SET domainSMARTSM01291N_SET_2coord: 1036..1264
e-value: 2.8E-5
score: 32.3
IPR024657COMPASS complex Set1 subunit, N-SET domainPFAMPF11764N-SETcoord: 1147..1267
e-value: 1.9E-7
score: 31.4
IPR001214SET domainSMARTSM00317set_7coord: 1274..1397
e-value: 1.1E-36
score: 137.9
IPR001214SET domainPFAMPF00856SETcoord: 1286..1390
e-value: 4.6E-17
score: 62.9
IPR001214SET domainPROSITEPS50280SETcoord: 1274..1391
score: 16.124
IPR003616Post-SET domainSMARTSM00508PostSET_3coord: 1397..1413
e-value: 9.2E-5
score: 31.8
IPR003616Post-SET domainPROSITEPS50868POST_SETcoord: 1397..1413
score: 9.986
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 72..177
e-value: 3.7E-20
score: 74.2
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 71..158