Dis3 exonuclease 1

Overview
NameDis3 exonuclease 1
Smed IDSMED30033478
Length (bp)3370
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dis3 exonuclease 1 (SMED30033478) t-SNE clustered cells

Violin plots show distribution of expression levels for Dis3 exonuclease 1 (SMED30033478) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dis3 exonuclease 1 (SMED30033478) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dis3 exonuclease 1 (SMED30033478) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Match: DIS3L (DIS3 like exosome 3'-5' exoribonuclease [Source:HGNC Symbol;Acc:HGNC:28698])

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 426/1015 (41.97%), Postives = 611/1015 (60.20%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQN-IPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLK-----SAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+  +PC    C        DG  +S DV++YVI D + + ++ E+LE  +  G I   +  + +Q+   RR Y KL+ L +D     ILF NEF Q C++ ++  E    + TR  + A+ +Y  H   +  +V +T + + A+ QY       G +T   V ++T K YL N+  D  +  EL DS+  +    +    N  QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L +G S+K    L S++LI G   RNR+I GD VV+ +LP+++W  + + +  ++          ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT E+PWK++PEE  KR+DLR+  L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYAVS++WEL     E+  V Y R++IRS+YKL YE AQ++ D  +   + +  IPE       FKD  E+ +Q K      A+  L +++  ++++R   G LELEG+EV V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D  D   N++LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        + +L +N  L + C  +NN+++ AQ  Q+ S ELFQ M+F++K      R  ++GVI  +R+NG ++ IPR+GIKG+ +L+ +D  +  +   P+  S        +W   +         Q+  N+IT      ++  T+ LFD V +RI    S  H  +++LE +
Sbjct:   15 QGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVIPDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEE-AIQQY-------GSETE-GVFVITFKNYLDNFWPDLKAAHELCDSILQS----RRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-QGASSKDS-DLVSDILIHGMKARNRSIHGDVVVVELLPKNEWKGRTVALCENDCD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNL---SVVDDIPE-------FKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQLDD--KKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLV--ISCGPDSCS--------EWKPGS--------LQRFQNKITSTTTDGES-VTFHLFDHVTVRISIQASRCHSDTIRLEII 972          
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Match: DIS3L (DIS3 like exosome 3'-5' exoribonuclease [Source:HGNC Symbol;Acc:HGNC:28698])

HSP 1 Score: 696.812 bits (1797), Expect = 0.000e+0
Identity = 401/934 (42.93%), Postives = 569/934 (60.92%), Query Frame = 3
Query:  354 NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLK-----SAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
             RR Y KL+ L +D     ILF NEF Q C++ ++  E    + TR  + A+ +Y  H   +  +V +T + + A+ QY       G +T   V ++T K YL N+  D  +  EL DS+  +    +    N  QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L +G S+K    L S++LI G   RNR+I GD VV+ +LP+++W  + + +  ++          ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT E+PWK++PEE  KR+DLR+  L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYAVS++WEL     E+  V Y R++IRS+YKL YE AQ++ D  +   + +  IPE       FKD  E+ +Q K      A+  L +++  ++++R   G LELEG+EV V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D  D   N++LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        + +L +N  L + C  +NN+++ AQ  Q+ S ELFQ M+F++K      R  ++GVI  +R+NG ++ IPR+GIKG+ +L+ +D  +  +   P+  S        +W   +         Q+  N+IT      ++  T+ LFD V +RI    S  H  +++LE +
Sbjct:   13 GRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEE-AIQQY-------GSETE-GVFVITFKNYLDNFWPDLKAAHELCDSILQS----RRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-QGASSKDS-DLVSDILIHGMKARNRSIHGDVVVVELLPKNEWKGRTVALCENDCD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNL---SVVDDIPE-------FKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQLDD--KKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLV--ISCGPDSCS--------EWKPGS--------LQRFQNKITSTTTDGES-VTFHLFDHVTVRISIQASRCHSDTIRLEII 889          
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Match: DIS3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:HGNC Symbol;Acc:HGNC:20604])

HSP 1 Score: 503.442 bits (1295), Expect = 7.671e-161
Identity = 323/933 (34.62%), Postives = 489/933 (52.41%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSPDVSN----------YVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAEN--ETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K ++A G +KIV   YL++ I C       C    +G  + P   +          Y++ DT  L++  +VLE       I+  + ++ ++N +  +Y +++ +  +  K    F NE H+E ++ Q++ E+  +   R   +A+++Y  HL        ++ +  + ++  +N  R         +   T +EY+    K   +  EL+D L     C+      I  E       E+L    L + + SG +L+G  R ++ ++  EATV +   N   +      E+++QG  + NRA+  D V + +LP+SQW+     +   E   E  +   E+ E   +T  S     PTGRVVGI +RNWR Y     KSD+   +  L TP D+RIP IRI    A  L   R IV IDGWP +SRYPNGHFV ++G +G+ ETET  LL+E+++ ++PF+ + L+ LP    + PW +  +++  R DLR L I S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD E+ +R T++Y+ ++R DM+P +LS +LCSL  DVDR A S +WE+  + E++   + +SVI S   L Y  AQ   DS                        A     + +++  L  ++ ILK RRIE G L L   EV+    D E     DL  KE  E +  + E M+ AN  VAKK  E +   + LR HP+P   ++  L+  A ++   I   +   LA+SLD A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYAD++VHR+L  +I      PE  L     LAD C  +N +H+ AQ  QRAS+     +FF++K         E  I+ +R N  VV IP+YG++G+VF  ++DK
Sbjct:    8 LKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSVCPQPHYLLPDTNVLLHQIDVLEDPAIRNVIVLQTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENANDRNDRAIRVAAKWYNEHLKK------MSADNQLQVIFITNDRRNKEKAIEEGIPAFTCEEYV----KSLTANPELIDRLA----CLSEEGNEI--ESGKIIFSEHLPLSKLQQGIKSGTYLQGTFRASR-ENYLEATVWIHGDNEENK------EIILQGLKHLNRAVHEDIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKMLKPTGRVVGIIKRNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASTLEGRRIIVAIDGWPRNSRYPNGHFVRNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWSITEKDMKNREDLRHLCICSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDS------------------------ANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHM-DSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPE--LTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKG----IVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDK 880          
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Match: DIS3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:HGNC Symbol;Acc:HGNC:20604])

HSP 1 Score: 473.011 bits (1216), Expect = 1.534e-149
Identity = 315/926 (34.02%), Postives = 470/926 (50.76%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSP---DVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAEN--ETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K ++A G +KIV   YL++ I C       C    +G  + P   D ++ V     YL+  + VL               + +  +    +  +      P             E ++ Q++ E+  +   R   +A+++Y  HL        ++ +  + ++  +N  R         +   T +EY+    K   +  EL+D L     C+      I  E       E+L    L + + SG +L+G  R ++ ++  EATV +   N   +      E+++QG  + NRA+  D V + +LP+SQW+     +   E   E  +   E+ E   +T  S     PTGRVVGI +RNWR Y     KSD+   +  L TP D+RIP IRI    A  L   R IV IDGWP +SRYPNGHFV ++G +G+ ETET  LL+E+++ ++PF+ + L+ LP    + PW +  +++  R DLR L I S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD E+ +R T++Y+ ++R DM+P +LS +LCSL  DVDR A S +WE+  + E++   + +SVI S   L Y  AQ   DS                        A     + +++  L  ++ ILK RRIE G L L   EV+    D E     DL  KE  E +  + E M+ AN  VAKK  E +   + LR HP+P   ++  L+  A ++   I   +   LA+SLD A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYAD++VHR+L  +I      PE  L     LAD C  +N +H+ AQ  QRAS+     +FF++K         E  I+ +R N  VV IP+YG++G+VF  ++DK
Sbjct:    8 LKKTRAGGVMKIVREHYLRDDIGCGAPGCAACGGAHEGPALEPQPQDPASSVCPQPHYLLPDTNVL-------------LHQIVSAWRPGTWASVASSLRLPGS----------LETYVEQEQGENANDRNDRAIRVAAKWYNEHLKK------MSADNQLQVIFITNDRRNKEKAIEEGIPAFTCEEYV----KSLTANPELIDRLA----CLSEEGNEI--ESGKIIFSEHLPLSKLQQGIKSGTYLQGTFRASR-ENYLEATVWIHGDNEENK------EIILQGLKHLNRAVHEDIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKMLKPTGRVVGIIKRNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASTLEGRRIIVAIDGWPRNSRYPNGHFVRNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWSITEKDMKNREDLRHLCICSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDS------------------------ANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHM-DSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPE--LTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKG----IVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDK 850          
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Match: DIS3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:HGNC Symbol;Acc:HGNC:20604])

HSP 1 Score: 468.003 bits (1203), Expect = 2.844e-149
Identity = 274/695 (39.42%), Postives = 389/695 (55.97%), Query Frame = 3
Query:  786 EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAEN--ETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            E+L    L + + SG +L+G  R ++ ++  EATV +   N   +      E+++QG  + NRA+  D V + +LP+SQW+     +   E   E  +   E+ E   +T  S     PTGRVVGI +RNWR Y     KSD+   +  L TP D+RIP IRI    A  L   R IV IDGWP +SRYPNGHFV ++G +G+ ETET  LL+E+++ ++PF+ + L+ LP    + PW +  +++  R DLR L I S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD E+ +R T++Y+ ++R DM+P +LS +LCSL  DVDR A S +WE+  + E++   + +SVI S   L Y  AQ   DS                        A     + +++  L  ++ ILK RRIE G L L   EV+    D E     DL  KE  E +  + E M+ AN  VAKK  E +   + LR HP+P   ++  L+  A ++   I   +   LA+SLD A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYAD++VHR+L  +I      PE  L     LAD C  +N +H+ AQ  QRAS+     +FF++K         E  I+ +R N  VV IP+YG++G+VF  ++DK
Sbjct:   68 EHLPLSKLQQGIKSGTYLQGTFRASR-ENYLEATVWIHGDNEENK------EIILQGLKHLNRAVHEDIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKMLKPTGRVVGIIKRNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASTLEGRRIIVAIDGWPRNSRYPNGHFVRNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWSITEKDMKNREDLRHLCICSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLKCDVDRLAFSCIWEMNHNAEILKTKFTKSVINSKASLTYAEAQLRIDS------------------------ANMNDDITTSLRGLNKLAKILKKRRIEKGALTLSSPEVRFHM-DSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYEILVKAARSRNLEIKTDTAKSLAESLDQAESPTFPYLNTLLRILATRCMMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADVIVHRLLAVAIGADCTYPE--LTDKHKLADICKNLNFRHKMAQYAQRASVAFHTQLFFKSKG----IVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDK 718          
BLAST of Dis3 exonuclease 1 vs. Ensembl Celegans
Match: dis-3 (Probable exosome complex exonuclease RRP44 [Source:UniProtKB/Swiss-Prot;Acc:Q17632])

HSP 1 Score: 445.277 bits (1144), Expect = 3.415e-139
Identity = 311/938 (33.16%), Postives = 471/938 (50.21%), Query Frame = 3
Query:  150 RYLQN-IPCKVNCTYDCNKDFDG---LKVSPDVSNY------VIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKL-FEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHL---NYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWI--NKKLEISGSEASAELA---------------LPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIY-DSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQ-CNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKS 2858
            RYL+N + C +     C KDF     LK+   V N       +IVD+  L+ F ++ +  LL ++  I+T +    ++      Y K+  L +ED      +F NEFH E F    + ED L+    L    + +  +H    N  P V+    ++   +  +  +             +M +KEY+ N   ++     L+D + AA++   N +             EYLS + +   + SG   +G   V++   R EATV++ +     Q+ +      I G  N NRA++GD V + +LPE QW    KK+ +   E   + A                P A++++  T+        T +VVGI +RNWR+Y      S +   +  L  P +R IP IRI    A+ L   R +V ID WP  S+YP GH+V SIG +G  ETE   LL+E+++ + PF+ S L  LP    E     N   +  R DLR+L I S+DP+GC D+DD L  +++     E+GVHIADVTHFV+P + +D EA  R T++Y+ DRR DMLP +LS +LCSL  + +RYA S +W +T   ++ SV Y +S+I+S   L YE AQ+I  D K   + +LGL                           L+ +S +L +RR   G L L   EV+       RT  + + +K+ L+ H  + E M+ AN  VA+K LE YP  + LR HP P  + +  L+  A  +GF I   S   LA SL+  VD ++   N++LR L T  M+ A YFS G +    Y H+GLA   YTHFTSPIRRYAD++VHR+L  +I     +S L N +   + C  +N +H+QAQ   RAS++L    +F+ K +       EG ++ +R+NG  V +P+YG++  + L+    S
Sbjct:   34 RYLRNDLSCGLAQCGTC-KDFGTNPLLKIENPVRNAKVGRHALIVDSTSLIRFYDLFDSSLLRDL--IVTQTVWEGVKAKAVPAYKKMNSLCYEDAKDRFHVFMNEFHCETFSESSKFED-LSRGEELLLSTALYLKTHWQKHNVAPVVLVFDEDSKKRMENHYQH-------------VMYLKEYIQNL--EDPGKQALLDQM-AAYESSGNGNEK-------QIFDEYLSHDRIMEGIASGTIKRGNFSVSRENYR-EATVIIDD-----QLTSW----FITGN-NCNRAVNGDTVAVQLLPEDQWTAPEKKIRLRDVEEYVKTADDMGNEDEENDDENDEPKAKKSKKMTVS-------TAKVVGIIKRNWREYCGMLLPSTVKGARRHLFCPAERLIPRIRIETEQAETLSQQRIVVAIDHWPRDSKYPLGHYVRSIGEMGSRETENEVLLLEHDIPHAPFSESVLDCLPREEWEPDLTENRGPLP-RVDLRDLTICSVDPLGCTDIDDALHCKQIGEDLFEVGVHIADVTHFVRPGTAIDDEAALRGTTVYLCDRRIDMLPCLLSSNLCSLRGEEERYAFSCIWTMTSSADIQSVKYHKSLIKSKAALTYEKAQEIIDDPKEQNDVALGL-------------------------RGLMKLSKVLNARRTGNGALTLASSEVRFDMDWESRTP-KKVMEKQHLDTHSMVEEFMLLANISVAEKILEEYPDCALLRRHPVPLKESYKPLVEAARHRGFEIIVESGKGLADSLNRCVDKKNPMLNRLLRMLTTRCMTQAVYFSAGTVPVPQYQHFGLACAIYTHFTSPIRRYADVIVHRLLAAAIGADDIQSGLLNQARCTKICTNINYRHKQAQYAGRASVQLNVVRYFKGKVET-----CEGFVMGVRNNGIQVFVPKYGLESIIVLQTSAAS 894          
BLAST of Dis3 exonuclease 1 vs. Ensembl Celegans
Match: dis-3 (Probable exosome complex exonuclease RRP44 [Source:UniProtKB/Swiss-Prot;Acc:Q17632])

HSP 1 Score: 445.277 bits (1144), Expect = 3.415e-139
Identity = 311/938 (33.16%), Postives = 471/938 (50.21%), Query Frame = 3
Query:  150 RYLQN-IPCKVNCTYDCNKDFDG---LKVSPDVSNY------VIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKL-FEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHL---NYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWI--NKKLEISGSEASAELA---------------LPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIY-DSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQ-CNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKS 2858
            RYL+N + C +     C KDF     LK+   V N       +IVD+  L+ F ++ +  LL ++  I+T +    ++      Y K+  L +ED      +F NEFH E F    + ED L+    L    + +  +H    N  P V+    ++   +  +  +             +M +KEY+ N   ++     L+D + AA++   N +             EYLS + +   + SG   +G   V++   R EATV++ +     Q+ +      I G  N NRA++GD V + +LPE QW    KK+ +   E   + A                P A++++  T+        T +VVGI +RNWR+Y      S +   +  L  P +R IP IRI    A+ L   R +V ID WP  S+YP GH+V SIG +G  ETE   LL+E+++ + PF+ S L  LP    E     N   +  R DLR+L I S+DP+GC D+DD L  +++     E+GVHIADVTHFV+P + +D EA  R T++Y+ DRR DMLP +LS +LCSL  + +RYA S +W +T   ++ SV Y +S+I+S   L YE AQ+I  D K   + +LGL                           L+ +S +L +RR   G L L   EV+       RT  + + +K+ L+ H  + E M+ AN  VA+K LE YP  + LR HP P  + +  L+  A  +GF I   S   LA SL+  VD ++   N++LR L T  M+ A YFS G +    Y H+GLA   YTHFTSPIRRYAD++VHR+L  +I     +S L N +   + C  +N +H+QAQ   RAS++L    +F+ K +       EG ++ +R+NG  V +P+YG++  + L+    S
Sbjct:   34 RYLRNDLSCGLAQCGTC-KDFGTNPLLKIENPVRNAKVGRHALIVDSTSLIRFYDLFDSSLLRDL--IVTQTVWEGVKAKAVPAYKKMNSLCYEDAKDRFHVFMNEFHCETFSESSKFED-LSRGEELLLSTALYLKTHWQKHNVAPVVLVFDEDSKKRMENHYQH-------------VMYLKEYIQNL--EDPGKQALLDQM-AAYESSGNGNEK-------QIFDEYLSHDRIMEGIASGTIKRGNFSVSRENYR-EATVIIDD-----QLTSW----FITGN-NCNRAVNGDTVAVQLLPEDQWTAPEKKIRLRDVEEYVKTADDMGNEDEENDDENDEPKAKKSKKMTVS-------TAKVVGIIKRNWREYCGMLLPSTVKGARRHLFCPAERLIPRIRIETEQAETLSQQRIVVAIDHWPRDSKYPLGHYVRSIGEMGSRETENEVLLLEHDIPHAPFSESVLDCLPREEWEPDLTENRGPLP-RVDLRDLTICSVDPLGCTDIDDALHCKQIGEDLFEVGVHIADVTHFVRPGTAIDDEAALRGTTVYLCDRRIDMLPCLLSSNLCSLRGEEERYAFSCIWTMTSSADIQSVKYHKSLIKSKAALTYEKAQEIIDDPKEQNDVALGL-------------------------RGLMKLSKVLNARRTGNGALTLASSEVRFDMDWESRTP-KKVMEKQHLDTHSMVEEFMLLANISVAEKILEEYPDCALLRRHPVPLKESYKPLVEAARHRGFEIIVESGKGLADSLNRCVDKKNPMLNRLLRMLTTRCMTQAVYFSAGTVPVPQYQHFGLACAIYTHFTSPIRRYADVIVHRLLAAAIGADDIQSGLLNQARCTKICTNINYRHKQAQYAGRASVQLNVVRYFKGKVET-----CEGFVMGVRNNGIQVFVPKYGLESIIVLQTSAAS 894          
BLAST of Dis3 exonuclease 1 vs. Ensembl Celegans
Match: disl-2 (DIS3-like exonuclease 2 [Source:UniProtKB/Swiss-Prot;Acc:Q09568])

HSP 1 Score: 282.337 bits (721), Expect = 1.547e-80
Identity = 227/795 (28.55%), Postives = 374/795 (47.04%), Query Frame = 3
Query:  786 EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEI--------SGSEASAELALPVAEQAE-----NETIDS--SSTKTP------TGRVVGI-SRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHR--------FIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKL------ANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQD-IYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLD--LAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK---------SIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYK 3026
            EY+S E     +  G   KG++R+N  K+  E  +   +G +       H +VL+ GQ +RNRA+ GD V + I P+  W+   +E          G   S +       + E     NE  D+  +S + P       G +V I  ++++R      +    ++   VL    D R+P I I  +  DK    R        +  +I  W   S Y +G  V+ +G+ G+++TET  ++ E+ + +R F+   L  LPI T EN WK+   E   RRD R  ++F+IDP   +D+DD L  + +          LE+GVHIADVT F+K  + LD  A +R  S Y++     MLP +L   LCSL   VDR + S V++++ + E+  V + RSVIRS  KL YE AQD I + + DF  +   +P+++  +  F        ++K    ML  ++ +L+ +R ++G L +E    ++KF+  E  K + +   E  + ++ + E M+ AN  VAKK  EN+P  + LR+HP P+     ++       GF ++  ++  L+ SL         DM   +++ SL    M  A+YF T  +    Y+H+ L +  YTHFTSPIRRY D++VHR L  ++ G  E S      + + C   N+    ++     S  L+  +F             + V++ +    F V I  YG+   V++ K  +         +I W  + P   S   E + +     N + +    Y+ +    T+VR + + R   K
Sbjct:   67 EYISKEETDAGIEDGSMFKGVLRINP-KNYQECFLDHPKGTN-------HPDVLVLGQ-DRNRAMQGDVVAVKIKPKEDWLVNYVEYVKWWAEHKKGDRNSGKTDNNSPNKTEKRCLRNEIQDNGVTSDEVPDSCLITIGAIVHILEKKHFRVAAGKLQLMPNSANPNVLFVATDSRVPRILIPKSDVDKEFFSRPKDFERFLYTAKITDWRAESVYADGRLVKLLGMSGEIDTETERIVYEHQIDHREFSDECLESLPITTAEN-WKVPDAEFEYRRDFRSDIVFTIDPKTARDLDDALHAKHIDDCDGKGTPGLEIGVHIADVTFFLKEGTELDKWASERGNSTYLSQTVIPMLPRILCEQLCSLNPGVDRLSFSTVFKMSYEAELYDVWFGRSVIRSRVKLAYEHAQDFIENPEKDF--TCDELPDISDGNTPF--------EIKEKTLMLHRIAQVLRQKREDSGALRIE--LPRLKFALDEDKKPQGVSIYEIKDSNKLVEEFMLLANMEVAKKIAENFPEHALLRNHPPPKEKMIKDVAEQCARIGFPLDGRTSGLLSTSLRKYQGKSRLDMCIRQVISSLTIKPMQQAKYFCTFEMPLSFYHHFALNVDHYTHFTSPIRRYPDVIVHRQLAAAL-GYNERSERVPEEIQEICTRCNDTKLASKEASDESAMLYFGVFIHQTG----PMKCQAVVLGVMDLSFDVLIVEYGVVKRVYVDKMKRDFNKSTEKLTIYW-PADPNAESGNREEFSSSIQMCNVVYVILVPYKSIEVSATIVRPSLEQRNILK 833          
BLAST of Dis3 exonuclease 1 vs. Ensembl Fly
Match: Dis3 (gene:FBgn0039183 transcript:FBtr0334599)

HSP 1 Score: 480.715 bits (1236), Expect = 2.714e-152
Identity = 301/890 (33.82%), Postives = 479/890 (53.82%), Query Frame = 3
Query:  240 NYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNY-QPTVVF-LTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARS---VNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAEL-ALPVAEQA--ENETIDS------SSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG-VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +Y+++DT  +++  +VLE  +L N+  ++  + +  +++ +  +Y +  ++  D  ++  +F NE H+E +  ++ DE   +   R   +A+++Y  HL   Q +  F  +G     ++  ++         +  + + T  EY+ +   ++F    L+D L    FD  KN     P  L +  + E L    L +     +  ++L+G + V KF+                        +LIQG+ + NRA+DGD V + +LPE++W +   EI   E +     +P  E+A  ENE ++       S+ +TPTGR+VGI RR WR Y    + S +      +  P DR+IP IRI    A  L N R IV ID WP +SRYP+GHFV S+G +GD+ TE   +L+E+++ +  F+   L+ LP    + PW +  E+ SKR DLR+L I S+DP GC D+DD L  ++L NGNLE+GVHIADV+HF++P + LD+EA  R T++Y+  +R DM+P +LS +LCSL   V+R+A S VWE+  +  V+S  + +SVI+S   + YE AQ+I D                         A +  ++  ++  L  ++ ILK RR++ G L L   E++ +        LE +  K+  E +  + E M+ AN  VA+     +   + LR HP P   +F  L+  A  +GF ++ +S LEL+ SLD  V   +   N ++R L T  M  A YF +G L+ E+++HYGLA P YTHFTSPIRRY+DI+VHR+L  SI        LL   S  + C+ +N +H+ AQ   RAS+ L   +FFR K +D+     EG ++ +R N   V IP+YG++G+++L K DK
Sbjct:   62 HYLVLDTNVVLDQIDVLEEDVLRNV--VVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFYVFVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVLLTDDAANRAKAEAEGILVTTAAEYVKSL--EDFPL--LMDKLSHKTFDSEKNGLPQYPPHLSMKELLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEK----------------------GILIQGRESLNRAVDGDLVAVELLPEAEW-SAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRRKWRQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRYPHGHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLP----KMPWTITDEDYSKRVDLRDLYICSVDPPGCTDIDDALHCKELPNGNLEVGVHIADVSHFIRPGNALDMEAAARGTTVYLVGKRIDMVPELLSSNLCSLVGGVERFAFSCVWEVDNEANVLSKRFHKSVIKSKRAMTYEEAQNIIDD------------------------ATQQNEIAKSLRNLNRLAKILKKRRMDNGALVLASPEIRFQVDSETHEPLE-VEVKQMRETNSMVEEFMLLANITVAEHIATEFSECAVLRRHPRPPPTNFDPLVKSARYQGFQVDINSGLELSHSLDKCVKADNPYFNTMIRILTTRCMMQAVYFISGSLQKEEFFHYGLAAPIYTHFTSPIRRYSDIMVHRLLAASIGADSTYAQLLDRKSNEELCHNLNYRHKMAQYAGRASVALNTHLFFRGKEEDE-----EGYVLFVRKNALQVLIPKYGLEGTLYL-KSDK 887          
BLAST of Dis3 exonuclease 1 vs. Ensembl Fly
Match: Dis3 (gene:FBgn0039183 transcript:FBtr0084605)

HSP 1 Score: 480.715 bits (1236), Expect = 2.714e-152
Identity = 301/890 (33.82%), Postives = 479/890 (53.82%), Query Frame = 3
Query:  240 NYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNY-QPTVVF-LTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARS---VNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAEL-ALPVAEQA--ENETIDS------SSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG-VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +Y+++DT  +++  +VLE  +L N+  ++  + +  +++ +  +Y +  ++  D  ++  +F NE H+E +  ++ DE   +   R   +A+++Y  HL   Q +  F  +G     ++  ++         +  + + T  EY+ +   ++F    L+D L    FD  KN     P  L +  + E L    L +     +  ++L+G + V KF+                        +LIQG+ + NRA+DGD V + +LPE++W +   EI   E +     +P  E+A  ENE ++       S+ +TPTGR+VGI RR WR Y    + S +      +  P DR+IP IRI    A  L N R IV ID WP +SRYP+GHFV S+G +GD+ TE   +L+E+++ +  F+   L+ LP    + PW +  E+ SKR DLR+L I S+DP GC D+DD L  ++L NGNLE+GVHIADV+HF++P + LD+EA  R T++Y+  +R DM+P +LS +LCSL   V+R+A S VWE+  +  V+S  + +SVI+S   + YE AQ+I D                         A +  ++  ++  L  ++ ILK RR++ G L L   E++ +        LE +  K+  E +  + E M+ AN  VA+     +   + LR HP P   +F  L+  A  +GF ++ +S LEL+ SLD  V   +   N ++R L T  M  A YF +G L+ E+++HYGLA P YTHFTSPIRRY+DI+VHR+L  SI        LL   S  + C+ +N +H+ AQ   RAS+ L   +FFR K +D+     EG ++ +R N   V IP+YG++G+++L K DK
Sbjct:   62 HYLVLDTNVVLDQIDVLEEDVLRNV--VVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFYVFVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVLLTDDAANRAKAEAEGILVTTAAEYVKSL--EDFPL--LMDKLSHKTFDSEKNGLPQYPPHLSMKELLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEK----------------------GILIQGRESLNRAVDGDLVAVELLPEAEW-SAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRRKWRQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRYPHGHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLP----KMPWTITDEDYSKRVDLRDLYICSVDPPGCTDIDDALHCKELPNGNLEVGVHIADVSHFIRPGNALDMEAAARGTTVYLVGKRIDMVPELLSSNLCSLVGGVERFAFSCVWEVDNEANVLSKRFHKSVIKSKRAMTYEEAQNIIDD------------------------ATQQNEIAKSLRNLNRLAKILKKRRMDNGALVLASPEIRFQVDSETHEPLE-VEVKQMRETNSMVEEFMLLANITVAEHIATEFSECAVLRRHPRPPPTNFDPLVKSARYQGFQVDINSGLELSHSLDKCVKADNPYFNTMIRILTTRCMMQAVYFISGSLQKEEFFHYGLAAPIYTHFTSPIRRYSDIMVHRLLAASIGADSTYAQLLDRKSNEELCHNLNYRHKMAQYAGRASVALNTHLFFRGKEEDE-----EGYVLFVRKNALQVLIPKYGLEGTLYL-KSDK 887          
BLAST of Dis3 exonuclease 1 vs. Ensembl Fly
Match: Dis3l2 (gene:FBgn0035111 transcript:FBtr0072487)

HSP 1 Score: 221.476 bits (563), Expect = 6.786e-59
Identity = 180/631 (28.53%), Postives = 308/631 (48.81%), Query Frame = 3
Query:  828 GDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMIL-PESQWINKKLEISGSEASA---ELALPVAEQAENET------------IDSSSTKTPTGRVVGISRRN-WRDYVCSFEKSD----LNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRY----PNGH----FVESIGVIGDLETETRTLLIEYNLYN-RPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVV--SVDYFRSVIRSSYKLHYELAQDIYD------SKIDFETSL-GLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDN--QDMETNKILRSLATMAMSNAQYF-STGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE 2594
            G  ++  IRVN+  +R +A +++S         AL  + ++     R  A DGD V   +L P +Q  +K  E S  E S     L+L   E+  ++T            +  SS   P   V+ I++R   R  V +   ++     +   +    PYD R+PM+ +   +    I ++  + + G    +       NGH     ++ +G +G+L+ E + +L    L + +PF   +  ++     + P  ++ E++ +R+DLR++ IF+IDP+  +D+DD +SI KL +   E+GVHI+DV+HF+   + LD   ++RSTSIY+A+    MLP  L    CSL    D++A SV W +     ++    ++ R+VI S  +  YE AQ I D      ++ DF T L G  P+                 +++ V  L +++S ++  R++ G L +   +++    DP   +      ++  E +  I E M+ AN  VA+   +++P  + LR+HP P +     L       GF +++SS+  L +S+    +     +  N  L  L    M+ A YF S G  +  D +HY L++P YTHFTSPIRRY DILVHR+L  +++
Sbjct:  296 GRIVEEEIRVNRKNNR-QAFIIMSTDRE-----ALERDGIVLLPVARRYAFDGDKVRAFVLNPGAQGSSKTAEPSSGEISGGKPSLSLADGEELSDDTESQGSESDTDNVVVISSDNCPKAFVIAITKRTELRQIVGTISFTNPTKLCDDQLFYKFRPYDLRVPMVYVPKDACAAHIGNKQQIDVSGLLYLAHILETDCNGHCIAELIQPVGRVGNLDDELKAILFHNGLRDIKPFE-QRFIDI---YSQPPPPISQEDLRQRKDLRKMCIFTIDPMTARDLDDAVSIEKLGDNEYEIGVHISDVSHFLIEDNELDNIVKERSTSIYLANEVIHMLPQSLCMR-CSLLPGQDKFAFSVFWRMNGKGVMLQKKPEFCRTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPD----------------DIRNRVLWLHDIASSIRKTRLDNGALTINNAKLRF-LLDPITGEPLSFEVEKQREANRLIEEFMLLANQAVARFIHDSFPDIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNEAPNPVAMNACLSQLLMKPMARATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDILVHRLLAAALK 898          
BLAST of Dis3 exonuclease 1 vs. Ensembl Fly
Match: Dis3l2 (gene:FBgn0035111 transcript:FBtr0072486)

HSP 1 Score: 221.476 bits (563), Expect = 7.740e-59
Identity = 180/631 (28.53%), Postives = 308/631 (48.81%), Query Frame = 3
Query:  828 GDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMIL-PESQWINKKLEISGSEASA---ELALPVAEQAENET------------IDSSSTKTPTGRVVGISRRN-WRDYVCSFEKSD----LNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRY----PNGH----FVESIGVIGDLETETRTLLIEYNLYN-RPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVV--SVDYFRSVIRSSYKLHYELAQDIYD------SKIDFETSL-GLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDN--QDMETNKILRSLATMAMSNAQYF-STGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE 2594
            G  ++  IRVN+  +R +A +++S         AL  + ++     R  A DGD V   +L P +Q  +K  E S  E S     L+L   E+  ++T            +  SS   P   V+ I++R   R  V +   ++     +   +    PYD R+PM+ +   +    I ++  + + G    +       NGH     ++ +G +G+L+ E + +L    L + +PF   +  ++     + P  ++ E++ +R+DLR++ IF+IDP+  +D+DD +SI KL +   E+GVHI+DV+HF+   + LD   ++RSTSIY+A+    MLP  L    CSL    D++A SV W +     ++    ++ R+VI S  +  YE AQ I D      ++ DF T L G  P+                 +++ V  L +++S ++  R++ G L +   +++    DP   +      ++  E +  I E M+ AN  VA+   +++P  + LR+HP P +     L       GF +++SS+  L +S+    +     +  N  L  L    M+ A YF S G  +  D +HY L++P YTHFTSPIRRY DILVHR+L  +++
Sbjct:  308 GRIVEEEIRVNRKNNR-QAFIIMSTDRE-----ALERDGIVLLPVARRYAFDGDKVRAFVLNPGAQGSSKTAEPSSGEISGGKPSLSLADGEELSDDTESQGSESDTDNVVVISSDNCPKAFVIAITKRTELRQIVGTISFTNPTKLCDDQLFYKFRPYDLRVPMVYVPKDACAAHIGNKQQIDVSGLLYLAHILETDCNGHCIAELIQPVGRVGNLDDELKAILFHNGLRDIKPFE-QRFIDI---YSQPPPPISQEDLRQRKDLRKMCIFTIDPMTARDLDDAVSIEKLGDNEYEIGVHISDVSHFLIEDNELDNIVKERSTSIYLANEVIHMLPQSLCMR-CSLLPGQDKFAFSVFWRMNGKGVMLQKKPEFCRTVINSCSQFAYEHAQKIIDNPNERFTENDFPTILNGFNPD----------------DIRNRVLWLHDIASSIRKTRLDNGALTINNAKLRFLL-DPITGEPLSFEVEKQREANRLIEEFMLLANQAVARFIHDSFPDIAVLRNHPPPLIKSLKALREKLLALGFELDYSSSKALQESMVRLCNEAPNPVAMNACLSQLLMKPMARATYFCSEGKSEPADLWHYALSIPIYTHFTSPIRRYPDILVHRLLAAALK 910          
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:560362])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 417/1012 (41.21%), Postives = 612/1012 (60.47%), Query Frame = 3
Query:  132 KLKIVSRYL--QNIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQ----EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCS---FE--KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGN-LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE----GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            K+++V  +   + +PC  + C  DC     G  +S DV++YV+ D   + +F E+LE  +  G ++T +  + +Q+   RR Y +L+ L +DP    +LF NEF Q  +  +++ E    + TR  + A+ +Y +HL     VV +T + D A+ ++S         ++  V +++ +EYL+ +  D          L+AA D + +S A   QE   D  +    E+L  EVL   + SG +++GI+ VNK +++ EA  V  EG+++K    L+S+VLI G  +RNRA+ GD VV+ +LP ++W  + +           AL   +  E    D+ S   PTGRVVGI +RNWRDYV +   FE  +S   + Q +LV P+D RIP IRI    A+ L + R IVR+D W  +S YPNGHFV  +G  G+LETE +T+L+E  ++  PF+ +QL E+P+NT+ENPW+M+  EVS RRDLR+  L+FSIDP GC+DVDDTLS+R L  G  LELGVHIADVTHFV+  SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL  + +EV SV + R++IRSSY+LHYELAQ + + + + E     +PEL     + +D  ++  +L  A+  L  V+  L+++R + G LELEG+EV+ +    E   +  L  K+PLEVHET+AECMI+ANHWVA+K  E++P  + LRHHP P+ + F  LI  A   GF+I+  SN  LA SL+ AVD +D   N++LR +AT AMSNA YFSTG    E YYHYGLAL  YTHFTSPIRRYAD++VHR+L+ +++      P ++L  N  L +    +NN++R AQ  Q+ SIELFQ M+FR+K +  D     + VI  +R+NGF+  +P+YG+KG+V+L+ ++  +  +                    D +   +    Q+  ++I  + + +    T+ LF+ V +RI    S  H  SL LE +
Sbjct:   17 KVRVVREHYMREQVPCGSSLCQADCQNV--GKVLSRDVTHYVVPDVGVVRDFLEILEFRELQGIVLTQTAYQTVQHTRGRRHYNRLRSLLKDPRHDCVLFANEFQQYSYCPREKGESQDKWHTRNVYNAAVWYYNHLAGLQPVVMITEDRD-AISEFSA--------SNSGVFVISTQEYLLGFWPD----------LQAAHD-LYHSIAQTLQERENDGAEKVYTEHLPAEVLEAGIKSGRYIQGILSVNKHRAQHEA-FVRYEGSASKNT-ELNSDVLINGAKHRNRAVHGDVVVIELLPRNEWKGRTM-----------ALTEGQGEERPLEDTQSQPMPTGRVVGILQRNWRDYVVTLPPFEEMQSQSRNSQKILVVPWDYRIPKIRISTQQAEALQDQRVIVRLDSWESTSVYPNGHFVRVLGKSGELETEIQTILVENCIHVPPFSEAQLREMPVNTEENPWQMDSNEVSSRRDLRDSHLVFSIDPKGCEDVDDTLSVRTLPGGKRLELGVHIADVTHFVREGSLTDLEARSRATTYYLADRRYDMLPAVLSADLCSLLGGVDRYAMSVLWELDAETLEVCSVWFGRTLIRSSYQLHYELAQSLLNGE-EVE-----VPELNPLKGSQRD--QKMSELLQALETLTRVARHLRAQRDKGGALELEGVEVRAQLD--EEKNITALVPKQPLEVHETVAECMIYANHWVARKIQESFPHHALLRHHPPPKQEFFNHLIDSAKAHGFSIDTRSNRALADSLERAVDPRDPLVNRLLRMMATQAMSNALYFSTGSCPEEQYYHYGLALARYTHFTSPIRRYADVIVHRLLMAAVQLEKDESPSKALACNKELEELAQHINNKNRAAQHSQKQSIELFQCMYFRDKDSHTDERCVADAVIYAVRANGFLAFVPQYGLKGAVYLKDREGQVISVD------------------GDGKCEWKPGTLQKYSDKI--ITSTSTGTHTFYLFNHVTVRISVEPSRCHADSLNLELI 963          
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:560362])

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 415/1012 (41.01%), Postives = 610/1012 (60.28%), Query Frame = 3
Query:  132 KLKIVSRYL--QNIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQ----EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCS---FE--KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGN-LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE----GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            K+++V  +   + +PC  + C  DC     G  +S DV++YV+ D   + +F E+LE  +  G ++T +  + +Q+   RR Y +L+ L +DP    +LF NEF Q  +  +++ E    + TR  + A+ +Y +HL     VV +T + D A+ ++S         ++  V +++ +EYL+ +  D          L+AA D + +S A   QE   D  +    E+L  EVL   + SG +++GI+ VNK +++ EA  V  EG+++K    L+S+VLI G  +RNRA+ GD VV+ + P ++W  + +           AL   +  E    D+ S   PTGRVVGI +RNWRDYV +   FE  +S   + Q +LV P+D RIP IRI    A+ L + R IVR+D W  +S YPNGHFV  +G  G+LETE +T+L+E  ++  PF+ +QL E+P+NT+ENPW+M+  EVS RRDLR+  L+FSIDP GC+DVDDTLS+R    G  LELGVHIADVTHFV+  SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL  + +EV SV + R++IRSSY+LHYELAQ + + + + E     +PEL     + +D  ++  +L  A+  L  V+  L+++R + G LELEG+EV+ +    E   +  L  K+PLEVHET+AECMI+ANHWVA+K  E++P  + LRHHP P+ + F  LI  A   GF+I+  SN  LA SL+ AVD +D   N++LR +AT AMSNA YFSTG    E YYHYGLAL  YTHFTSPIRRYAD++VHR+L+ +++      P ++L  N  L +    +NN++R AQ  Q+ SIELFQ M+FR+K +  D     + VI  +R+NGF+  +P+YG+KG+V+L+ ++  +  +                    D +   +    Q+  ++I  + + +    T+ LF+ V +RI    S  H  SL LE +
Sbjct:   17 KVRVVREHYMREQVPCGSSLCQADCQNV--GKVLSRDVTHYVVPDVGVVRDFLEILEFRELQGIVLTQTAYQTVQHTRGRRHYNRLRSLLKDPRHDCVLFANEFQQYSYCPREKGESQDKWHTRNVYNAAVWYYNHLAGLQPVVMITEDRD-AISEFSA--------SNSGVFVISTQEYLLGFWPD----------LQAAHD-LYHSIAQTLQERENDGAEKVYTEHLPAEVLEAGIKSGMYIQGILSVNKHRAQHEA-FVRYEGSASKNT-ELNSDVLINGAKHRNRAVHGDVVVIELFPRNEWKGRTM-----------ALTEGQGEERPLEDTQSQPMPTGRVVGILQRNWRDYVVTLPPFEEMQSQSRNSQKILVVPWDYRIPKIRISTQQAEALQDQRVIVRLDSWESTSVYPNGHFVRVLGKSGELETEIQTILVENCIHVPPFSEAQLREMPVNTEENPWQMDSNEVSSRRDLRDSHLVFSIDPKGCEDVDDTLSVRTQPGGKRLELGVHIADVTHFVREGSLTDLEARSRATTYYLADRRYDMLPAVLSADLCSLLGGVDRYAMSVLWELDAETLEVCSVWFGRTLIRSSYQLHYELAQSLLNGE-EVE-----VPELNPLKGSQRD--QKMSELLQALETLTRVARHLRAQRDKGGALELEGVEVRAQLD--EEKNITALVPKQPLEVHETVAECMIYANHWVARKIQESFPHHALLRHHPPPKQEFFNHLIDSAKAHGFSIDTRSNRALADSLERAVDPRDPLVNRLLRMMATQAMSNALYFSTGSCPEEQYYHYGLALARYTHFTSPIRRYADVIVHRLLMAAVQLEKDESPSKTLACNKELEELAQHINNKNRAAQHSQKQSIELFQCMYFRDKDSHTDERCVADAVIYAVRANGFLAFVPQYGLKGAVYLKDREGQVISVD------------------GDGKCEWKPGTLQKYSDKI--ITSTSTGTHTFYLFNHVTVRISVEPSRCHADSLNLELI 963          
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Match: dis3 (DIS3 exosome endoribonuclease and 3'-5' exoribonuclease [Source:ZFIN;Acc:ZDB-GENE-080213-3])

HSP 1 Score: 479.945 bits (1234), Expect = 3.389e-152
Identity = 316/935 (33.80%), Postives = 487/935 (52.09%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSPDV-------SNYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDC---IKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWIN-KKLEISGSEASAELALPVAEQAENETIDS-SSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K +++ G LKIV   YL++ I C      +C  +   L+    +        +Y+I DT  +++  ++LE  L+ N+  II  + ++ +++ +  +Y ++K    +  K    F NE H+E FI +++ E   +   R   +A+++Y  HL          G   V LL      ++      L V     +EY+    K      ELVD L    D    I  S    P+ L +  +Q           + +G F++G    N+    +    V  EG          +E+L+QG  N NRA++ D V + + P+ +W+    + +     + E        ++ +++ S SS   PTGRVVGI +RNWR +     +S +      L TP DRRIP IRI    A  LI  R +V IDGWP +SRYPNGHFV+++G  GD ETET  LL+E+++ ++PF+ + L+ LP    + PW +  E++  R DLR L + S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD EA  R T++Y+  +R DM+P +LS +LCSL S+V+R A S +WE+    E++   + +SVI S   L Y  AQ     +ID +T++                      +  ++  L  ++ ILK++RI+ G L L   EV+    D E     DL  KE +E +  + E M+ AN  VA+K  + +   + LR HP+P   ++  LI  A ++   I+  S   LA SL+ A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYADI+VHR+L  +I      P+  L+     +  CN +N +H+ AQ  QRAS+     +FF+NK   +     EG I+ +R N  ++ IP++G++G+VF   +DK
Sbjct:    8 VKKTRSGGVLKIVREHYLRDDIWCGSEVCKECKDEAPVLQEETCIESNLCPYPHYLIPDTNVVLHQIDILEDPLIRNV--IILQTVLQEVRHRSAPVYKRIKDAIHEKEKHFYTFTNEHHRETFIEREQGESANDRNDRAIRVAAKWYTDHLAKATD----GGTLKVVLLTNDRANKEKAEQFGLTV--YRCEEYI----KSLVGNPELVDRLAMTSDDQNEITGSKLLFPEHLPLSRIQT---------GIKNGVFIQGTFHANRDNYLEGTVFVNREGEDI-------NEILLQGLQNLNRAVNQDVVAVELFPKDRWVAPSSVVLQDDNLNDEDTEEDENDSKLKSVASESSVLKPTGRVVGIIKRNWRPFCGMLAQSQIKEATRHLFTPADRRIPRIRIETRQAATLIGQRIMVAIDGWPKNSRYPNGHFVKNLGTAGDKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWGITEEDLKVRADLRHLCVCSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQEAANRGTTVYLCGKRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHKAEIIKTHFTKSVINSKASLTYAEAQ----MRID-DTTMN-------------------DDITKSLRGLNKLAKILKAQRIDKGALTLSSPEVRFHI-DSETHDPIDLQTKELMETNSMVEEFMLLANISVAQKIYDEFSECALLRKHPAPPPSNYDILIKAAKSRDLEIHTDSAKALADSLNNATIENFAYFNTLLRILATRCMMQAVYFCSGM--DSDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAINADSTYPD--LMDKHKQSALCNNINYRHKMAQYAQRASVAFHTQLFFKNKGIIN----EEGFILFVRKNAIIILIPKFGLEGTVFFENKDK 877          
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Match: dis3 (DIS3 exosome endoribonuclease and 3'-5' exoribonuclease [Source:ZFIN;Acc:ZDB-GENE-080213-3])

HSP 1 Score: 479.945 bits (1234), Expect = 3.389e-152
Identity = 316/935 (33.80%), Postives = 487/935 (52.09%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSPDV-------SNYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDC---IKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWIN-KKLEISGSEASAELALPVAEQAENETIDS-SSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K +++ G LKIV   YL++ I C      +C  +   L+    +        +Y+I DT  +++  ++LE  L+ N+  II  + ++ +++ +  +Y ++K    +  K    F NE H+E FI +++ E   +   R   +A+++Y  HL          G   V LL      ++      L V     +EY+    K      ELVD L    D    I  S    P+ L +  +Q           + +G F++G    N+    +    V  EG          +E+L+QG  N NRA++ D V + + P+ +W+    + +     + E        ++ +++ S SS   PTGRVVGI +RNWR +     +S +      L TP DRRIP IRI    A  LI  R +V IDGWP +SRYPNGHFV+++G  GD ETET  LL+E+++ ++PF+ + L+ LP    + PW +  E++  R DLR L + S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD EA  R T++Y+  +R DM+P +LS +LCSL S+V+R A S +WE+    E++   + +SVI S   L Y  AQ     +ID +T++                      +  ++  L  ++ ILK++RI+ G L L   EV+    D E     DL  KE +E +  + E M+ AN  VA+K  + +   + LR HP+P   ++  LI  A ++   I+  S   LA SL+ A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYADI+VHR+L  +I      P+  L+     +  CN +N +H+ AQ  QRAS+     +FF+NK   +     EG I+ +R N  ++ IP++G++G+VF   +DK
Sbjct:    8 VKKTRSGGVLKIVREHYLRDDIWCGSEVCKECKDEAPVLQEETCIESNLCPYPHYLIPDTNVVLHQIDILEDPLIRNV--IILQTVLQEVRHRSAPVYKRIKDAIHEKEKHFYTFTNEHHRETFIEREQGESANDRNDRAIRVAAKWYTDHLAKATD----GGTLKVVLLTNDRANKEKAEQFGLTV--YRCEEYI----KSLVGNPELVDRLAMTSDDQNEITGSKLLFPEHLPLSRIQT---------GIKNGVFIQGTFHANRDNYLEGTVFVNREGEDI-------NEILLQGLQNLNRAVNQDVVAVELFPKDRWVAPSSVVLQDDNLNDEDTEEDENDSKLKSVASESSVLKPTGRVVGIIKRNWRPFCGMLAQSQIKEATRHLFTPADRRIPRIRIETRQAATLIGQRIMVAIDGWPKNSRYPNGHFVKNLGTAGDKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWGITEEDLKVRADLRHLCVCSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDQEAANRGTTVYLCGKRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHKAEIIKTHFTKSVINSKASLTYAEAQ----MRID-DTTMN-------------------DDITKSLRGLNKLAKILKAQRIDKGALTLSSPEVRFHI-DSETHDPIDLQTKELMETNSMVEEFMLLANISVAQKIYDEFSECALLRKHPAPPPSNYDILIKAAKSRDLEIHTDSAKALADSLNNATIENFAYFNTLLRILATRCMMQAVYFCSGM--DSDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAINADSTYPD--LMDKHKQSALCNNINYRHKMAQYAQRASVAFHTQLFFKNKGIIN----EEGFILFVRKNAIIILIPKFGLEGTVFFENKDK 877          
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Match: dis3l2 (DIS3 like 3'-5' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-070705-171])

HSP 1 Score: 328.176 bits (840), Expect = 1.476e-95
Identity = 217/719 (30.18%), Postives = 370/719 (51.46%), Query Frame = 3
Query:  780 MQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILP--------------------ESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKT--PTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHR--------FIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSL--DLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYY-HYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVF 2837
             ++Y+S E ++  +  G+ ++G++R+N  K + EA +   +G++         ++ + G   RNRA++GD VV+ +LP                    + + ++K  ++S ++ +      V     + T  SSS +T    G+VV I  +     V  F K  L + ++ + +P D R+P + + +         R        FI RI  WP  S +  G   +++G  G++E ET  +L EY +    FT   L  LP   ++ PW +   E+S RRDLR+  IF+IDP   +D+DD LS ++L++GN E+GVHIADV++FVK  + LD  A +R+TS+Y+  +   MLP +L  +LCSL    DR   SV+W+L+P+ +++S  + R+VI S  KL Y+ AQ + D+  D   S   +P  +  H           +++ AV  L N++  L+++R E G L L+ +++     D E +  +  +  +  + ++ + E M+ AN  V  +   +YP  + LR HP P+     ++       G  I+FSS+  L +SL  +L  D       +++  + +  M  A YF  G LK E  + HY L +P YTHFTSPIRRYAD++VHR+L  S+   P  S ++   +  Q +  N++   ++ VQ  S ELF A+F +     D    +E +++ +    F V + RYG++  ++
Sbjct:  237 FEQYMSVEDVSAGLKRGELIQGVLRINPKKYK-EAYIPSPDGSA---------DIFLDGISARNRALNGDVVVVKVLPLEQSQATKTPDVIVEAHYNGDDEMVSKMEKVSLNDKALLTTQSVEHATTSNTPASSSERTTQKNGKVVFIVEKKHSRAVSGFLKF-LPNKRFAMFSPVDHRVPRVNVPLADCPADFTSRPGDYENTLFICRITQWPADSNFAEGRLAKTLGQAGEIEPETEGILTEYGVDFSEFTEEVLNCLP---QDLPWSIPAHELSTRRDLRKECIFTIDPATARDLDDALSCKQLSDGNFEVGVHIADVSYFVKEGNALDELAGQRATSVYLVQKVIPMLPRLLCEELCSLNPLTDRLTFSVIWKLSPEGKILSEWFGRTVICSCIKLSYDHAQSMIDAP-DKHFSPEELPACSPNHSII--------EIQEAVLNLHNIAKQLRAQRFEGGALRLDQLKLSFTL-DKESSMPQGCYVYQYRDSNKLVEEFMLLANMAVGHQIYRSYPELALLRRHPPPQTKMVDDMQEFFDQMGLDIDFSSSGALHRSLNENLGDDEYTAARKEVITHMCSRPMQMAVYFCAGALKDEKLFRHYALNVPLYTHFTSPIRRYADVIVHRLLGASLNCGPRLS-VSGEEVHQQASHCNDRKTASKRVQELSSELFFAVFVKECGPLD----SEAMVMGVLDQSFDVLVLRYGVQKRIY 926          
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Match: kcna6 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:Xenbase;Acc:XB-GENE-1010669])

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 412/1028 (40.08%), Postives = 594/1028 (57.78%), Query Frame = 3
Query:  159 QNIPCKVNCTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-----EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSF-EKSDLNS----GQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKID-FETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNV 3197
            +++ C       C +D  G  +S D+++YV+ D + L ++ EVLE  +  G II  +  + +Q+   RR Y +L  L  D     ILF NEF    ++ ++  E  L + TR  + +  +Y  H   +  VV +T +  V        +R+   +T   V +++ + YL  +  +    +EL  SL     E   +  + +    P         E+L  E+L   + SG + +G++ VNK +++ E  V L +G   K+   + S++LI G   RNRAI GD V + +L  S+W  +   +  +E             + + +D+ +   PTGRVVGI +RNWRDYV +F  K D+ +     Q VLV P+D RIP IRI    A+ L ++R +VRID W  +S YPNGHFV  +G  G+LE E  T+L+E ++   PF+ +QLAE+P NT E+PW++ PEE   R DLR+  L+FSIDP GC+DVDD LSIRKL +G+LELGVHIADVTHFV P++  D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WE+ +   E+  V Y R++IRSSYKL YE+AQ + D  ++   T + L P         K    R +QL  AV  L  V+   + RR  +G LELEG+EV+V+    E+  ++DL  K+PL++HETIAECMI ANHWVAKK  E YP  + LR HP  R + F EL  CA  +GF+I+  SN  LA SLD A D  D   N++LR +AT AMSNA+YFSTG    +++YHYGLAL  YTHFTSPIRRYADI+VHR+LL ++   P+++LL N  L + C  +N ++R AQ  Q+ S ELFQ MFF++K  D   R  ++ VI  +R+NG ++ +PRYGIKG+ +L+  D  +   K             +  W+  +         Q+L ++I VV        +Y LFD V +RI    S  H  S++LE +       Q A LP+  +   +L++ +L + V
Sbjct:   27 EDVRCGSALCQTCPRD--GKLLSEDLTHYVVPDCQILQDYLEVLEFPELRGIIIMQTACQSVQHQRGRRQYKRLCSLLRDTRHDCILFSNEFQNHAYLPREMGESALAWQTRCIYNSCVWYYQHCQKKIPVVMVTEDKSV--------IRQYNTETQ-EVYVVSFQIYLETFWPNLKGALELYKSLKETHRERELESREGNGKEYP---------EHLPLEILEAGIKSGRYQQGVLSVNKHRAQLEGFVRL-QGLGGKET-DIQSDILIYGTKPRNRAIHGDLVAVELLSRSEWKGRNGALCENET------------DEKAVDAQAEVMPTGRVVGILQRNWRDYVATFPAKEDIETQGKNAQRVLVMPWDYRIPKIRISTQQAEALQDYRVVVRIDSWESTSLYPNGHFVRVLGRTGNLEAEIATILVENSISVNPFSEAQLAEMPSNTPESPWQVKPEE-GDRLDLRKTHLVFSIDPKGCEDVDDALSIRKLPSGHLELGVHIADVTHFVPPNTYTDIEARSRATTYYLADRRYDMLPLILSADLCSLLGGVDRYAVSVIWEMDSSTYEIRRVWYGRTIIRSSYKLSYEVAQQLMDGDLEPLNTEMELHP--------LKQDPVRLEQLLWAVGKLTEVAHATRMRRDMSGALELEGVEVRVQLG--EKHSIDDLVPKQPLQMHETIAECMILANHWVAKKIWECYPQHALLRLHPPARQEFFQELKECAKARGFSIDTRSNKALADSLDQANDPSDPLVNQLLRMMATQAMSNARYFSTGSYTEDEFYHYGLALEKYTHFTSPIRRYADIVVHRLLLAAVNKGPKDNLLGNKDLEELCRHINVRNRAAQHCQKQSTELFQCMFFKDKDPDSDQRCISDAVIYGIRTNGVLLFLPRYGIKGAAYLKNIDGLVLACKDNG----------RCHWMPGS--------LQRLPDRI-VVTTQEAKSFSYCLFDHVTVRIHVLSSRFHPDSIRLEIIRNRPHSSQEA-LPSASN--PQLARSELVKEV 987          
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Match: kcna6 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:Xenbase;Acc:XB-GENE-1010669])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 412/1028 (40.08%), Postives = 594/1028 (57.78%), Query Frame = 3
Query:  159 QNIPCKVNCTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-----EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-KSDLNS----GQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKID-FETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNV 3197
            +++ C       C +D  G  +S D+++YV+ D + L ++ EVLE  +  G II  +  + +Q+   RR Y +L  L  D     ILF NEF    ++ ++  E  L + TR  + +  +Y  H   +  VV +T +  V        +R+   +T   V +++ + YL  +  +    +EL  SL     E   +  + +    P         E+L  E+L   + SG + +G++ VNK +++ E  V L +G   K+   + S++LI G   RNRAI GD V + +L  S+W  +   +  +E             + + +D+ +   PTGRVVGI +RNWRDYV +F  K D+ +     Q VLV P+D RIP IRI    A+ L ++R +VRID W  +S YPNGHFV  +G  G+LE E  T+L+E ++   PF+ +QLAE+P NT E+PW++ PEE   R DLR+  L+FSIDP GC+DVDD LSIRKL +G+LELGVHIADVTHFV P++  D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WE+ +   E+  V Y R++IRSSYKL YE+AQ + D  ++   T + L P         K    R +QL  AV  L  V+   + RR  +G LELEG+EV+V+    E+  ++DL  K+PL++HETIAECMI ANHWVAKK  E YP  + LR HP  R + F EL  CA  +GF+I+  SN  LA SLD A D  D   N++LR +AT AMSNA+YFSTG    +++YHYGLAL  YTHFTSPIRRYADI+VHR+LL ++   P+++LL N  L + C  +N ++R AQ  Q+ S ELFQ MFF++K  D   R  ++ VI  +R+NG ++ +PRYGIKG+ +L+  D  +   K             +  W+  +         Q+L ++I VV        +Y LFD V +RI    S  H  S++LE +       Q A LP+  +   +L++ +L + V
Sbjct:   28 EDVRCGSALCQTCPRD--GKLLSEDLTHYVVPDCQILQDYLEVLEFPELRGIIIMQTACQSVQHQRGRRQYKRLCSLLRDTRHDCILFSNEFQNHAYLPREMGESALAWQTRCIYNSCVWYYQHCQKKIPVVMVTEDKSV--------IRQYNTETQ-EVYVVSFQIYLETFWPNLKGALELYKSLKETHRERELESREGNGKEYP---------EHLPLEILEAGIKSGRYQQGVLSVNKHRAQLEGFVRL-QGLGGKET-DIQSDILIYGTKPRNRAIHGDLVAVELLSRSEWKGRNGALCENET------------DEKAVDAQAEVMPTGRVVGILQRNWRDYVATFPAKEDIETQGKNAQRVLVMPWDYRIPKIRISTQQAEALQDYRVVVRIDSWESTSLYPNGHFVRVLGRTGNLEAEIATILVENSISVNPFSEAQLAEMPSNTPESPWQVKPEE-GDRLDLRKTHLVFSIDPKGCEDVDDALSIRKLPSGHLELGVHIADVTHFVPPNTYTDIEARSRATTYYLADRRYDMLPLILSADLCSLLGGVDRYAVSVIWEMDSSTYEIRRVWYGRTIIRSSYKLSYEVAQQLMDGDLEPLNTEMELHP--------LKQDPVRLEQLLWAVGKLTEVAHATRMRRDMSGALELEGVEVRVQLG--EKHSIDDLVPKQPLQMHETIAECMILANHWVAKKIWECYPQHALLRLHPPARQEFFQELKECAKARGFSIDTRSNKALADSLDQANDPSDPLVNQLLRMMATQAMSNARYFSTGSYTEDEFYHYGLALEKYTHFTSPIRRYADIVVHRLLLAAVNKGPKDNLLGNKDLEELCRHINVRNRAAQHCQKQSTELFQCMFFKDKDPDSDQRCISDAVIYGIRTNGVLLFLPRYGIKGAAYLKNIDGLVLACKDNG----------RCHWMPGS--------LQRLPDRI-VVTTQEAKSFSYCLFDHVTVRIHVLSSRFHPDSIRLEIIRNRPHSSQEA-LPSASN--PQLARSELVKEV 988          
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Match: kcna6 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:Xenbase;Acc:XB-GENE-1010669])

HSP 1 Score: 692.96 bits (1787), Expect = 0.000e+0
Identity = 410/1011 (40.55%), Postives = 588/1011 (58.16%), Query Frame = 3
Query:  210 DGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-----EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-KSDLNS----GQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKID-FETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNV 3197
            DG  +S D+++YV+ D + L ++ EVLE  +  G II  +  + +Q+   RR Y +L  L  D     ILF NEF    ++ ++  E  L + TR  + +  +Y  H   +  VV +T +  V        +R+   +T   V +++ + YL  +  +    +EL  SL     E   +  + +    P         E+L  E+L   + SG + +G++ VNK +++ E  V L +G   K+   + S++LI G   RNRAI GD V + +L  S+W  +   +  +E             + + +D+ +   PTGRVVGI +RNWRDYV +F  K D+ +     Q VLV P+D RIP IRI    A+ L ++R +VRID W  +S YPNGHFV  +G  G+LE E  T+L+E ++   PF+ +QLAE+P NT E+PW++ PEE   R DLR+  L+FSIDP GC+DVDD LSIRKL +G+LELGVHIADVTHFV P++  D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WE+ +   E+  V Y R++IRSSYKL YE+AQ + D  ++   T + L P         K    R +QL  AV  L  V+   + RR  +G LELEG+EV+V+    E+  ++DL  K+PL++HETIAECMI ANHWVAKK  E YP  + LR HP  R + F EL  CA  +GF+I+  SN  LA SLD A D  D   N++LR +AT AMSNA+YFSTG    +++YHYGLAL  YTHFTSPIRRYADI+VHR+LL ++   P+++LL N  L + C  +N ++R AQ  Q+ S ELFQ MFF++K  D   R  ++ VI  +R+NG ++ +PRYGIKG+ +L+  D  +   K             +  W+  +         Q+L ++I VV        +Y LFD V +RI    S  H  S++LE +       Q A LP+  +   +L++ +L + V
Sbjct:   33 DGKLLSEDLTHYVVPDCQILQDYLEVLEFPELRGIIIMQTACQSVQHQRGRRQYKRLCSLLRDTRHDCILFSNEFQNHAYLPREMGESALAWQTRCIYNSCVWYYQHCQKKIPVVMVTEDKSV--------IRQYNTETQ-EVYVVSFQIYLETFWPNLKGALELYKSLKETHRERELESREGNGKEYP---------EHLPLEILEAGIKSGRYQQGVLSVNKHRAQLEGFVRL-QGLGGKET-DIQSDILIYGTKPRNRAIHGDLVAVELLSRSEWKGRNGALCENET------------DEKAVDAQAEVMPTGRVVGILQRNWRDYVATFPAKEDIETQGKNAQRVLVMPWDYRIPKIRISTQQAEALQDYRVVVRIDSWESTSLYPNGHFVRVLGRTGNLEAEIATILVENSISVNPFSEAQLAEMPSNTPESPWQVKPEE-GDRLDLRKTHLVFSIDPKGCEDVDDALSIRKLPSGHLELGVHIADVTHFVPPNTYTDIEARSRATTYYLADRRYDMLPLILSADLCSLLGGVDRYAVSVIWEMDSSTYEIRRVWYGRTIIRSSYKLSYEVAQQLMDGDLEPLNTEMELHP--------LKQDPVRLEQLLWAVGKLTEVAHATRMRRDMSGALELEGVEVRVQLG--EKHSIDDLVPKQPLQMHETIAECMILANHWVAKKIWECYPQHALLRLHPPARQEFFQELKECAKARGFSIDTRSNKALADSLDQANDPSDPLVNQLLRMMATQAMSNARYFSTGSYTEDEFYHYGLALEKYTHFTSPIRRYADIVVHRLLLAAVNKGPKDNLLGNKDLEELCRHINVRNRAAQHCQKQSTELFQCMFFKDKDPDSDQRCISDAVIYGIRTNGVLLFLPRYGIKGAAYLKNIDGLVLACKDNG----------RCHWMPGS--------LQRLPDRI-VVTTQEAKSFSYCLFDHVTVRIHVLSSRFHPDSIRLEIIRNRPHSSQEA-LPSASN--PQLARSELVKEV 978          
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Match: kcna6 (potassium channel, voltage gated shaker related subfamily A, member 6 [Source:Xenbase;Acc:XB-GENE-1010669])

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 408/1007 (40.52%), Postives = 586/1007 (58.19%), Query Frame = 3
Query:  222 VSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSL-----EAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSF-EKSDLNS----GQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKID-FETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNV 3197
            +S D+++YV+ D + L ++ EVLE  +  G II  +  + +Q+   RR Y +L  L  D     ILF NEF    ++ ++  E  L + TR  + +  +Y  H   +  VV +T +  V        +R+   +T   V +++ + YL  +  +    +EL  SL     E   +  + +    P         E+L  E+L   + SG + +G++ VNK +++ E  V L +G   K+   + S++LI G   RNRAI GD V + +L  S+W  +   +  +E             + + +D+ +   PTGRVVGI +RNWRDYV +F  K D+ +     Q VLV P+D RIP IRI    A+ L ++R +VRID W  +S YPNGHFV  +G  G+LE E  T+L+E ++   PF+ +QLAE+P NT E+PW++ PEE   R DLR+  L+FSIDP GC+DVDD LSIRKL +G+LELGVHIADVTHFV P++  D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WE+ +   E+  V Y R++IRSSYKL YE+AQ + D  ++   T + L P         K    R +QL  AV  L  V+   + RR  +G LELEG+EV+V+    E+  ++DL  K+PL++HETIAECMI ANHWVAKK  E YP  + LR HP  R + F EL  CA  +GF+I+  SN  LA SLD A D  D   N++LR +AT AMSNA+YFSTG    +++YHYGLAL  YTHFTSPIRRYADI+VHR+LL ++   P+++LL N  L + C  +N ++R AQ  Q+ S ELFQ MFF++K  D   R  ++ VI  +R+NG ++ +PRYGIKG+ +L+  D  +   K             +  W+  +         Q+L ++I VV        +Y LFD V +RI    S  H  S++LE +       Q A LP+  +   +L++ +L + V
Sbjct:   10 LSEDLTHYVVPDCQILQDYLEVLEFPELRGIIIMQTACQSVQHQRGRRQYKRLCSLLRDTRHDCILFSNEFQNHAYLPREMGESALAWQTRCIYNSCVWYYQHCQKKIPVVMVTEDKSV--------IRQYNTETQ-EVYVVSFQIYLETFWPNLKGALELYKSLKETHRERELESREGNGKEYP---------EHLPLEILEAGIKSGRYQQGVLSVNKHRAQLEGFVRL-QGLGGKET-DIQSDILIYGTKPRNRAIHGDLVAVELLSRSEWKGRNGALCENET------------DEKAVDAQAEVMPTGRVVGILQRNWRDYVATFPAKEDIETQGKNAQRVLVMPWDYRIPKIRISTQQAEALQDYRVVVRIDSWESTSLYPNGHFVRVLGRTGNLEAEIATILVENSISVNPFSEAQLAEMPSNTPESPWQVKPEE-GDRLDLRKTHLVFSIDPKGCEDVDDALSIRKLPSGHLELGVHIADVTHFVPPNTYTDIEARSRATTYYLADRRYDMLPLILSADLCSLLGGVDRYAVSVIWEMDSSTYEIRRVWYGRTIIRSSYKLSYEVAQQLMDGDLEPLNTEMELHP--------LKQDPVRLEQLLWAVGKLTEVAHATRMRRDMSGALELEGVEVRVQLG--EKHSIDDLVPKQPLQMHETIAECMILANHWVAKKIWECYPQHALLRLHPPARQEFFQELKECAKARGFSIDTRSNKALADSLDQANDPSDPLVNQLLRMMATQAMSNARYFSTGSYTEDEFYHYGLALEKYTHFTSPIRRYADIVVHRLLLAAVNKGPKDNLLGNKDLEELCRHINVRNRAAQHCQKQSTELFQCMFFKDKDPDSDQRCISDAVIYGIRTNGVLLFLPRYGIKGAAYLKNIDGLVLACKDNG----------RCHWMPGS--------LQRLPDRI-VVTTQEAKSFSYCLFDHVTVRIHVLSSRFHPDSIRLEIIRNRPHSSQEA-LPSASN--PQLARSELVKEV 951          
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Match: dis3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:NCBI gene;Acc:100145718])

HSP 1 Score: 514.612 bits (1324), Expect = 1.041e-165
Identity = 329/931 (35.34%), Postives = 502/931 (53.92%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSP-------DVSNYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRD---EATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNS-SLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K +++ G LKIV   YL++ I C      +C ++   L++ P         ++Y++ DT  L++  ++LE  +L N+  I+  + ++ +++ +  +Y ++K L  +P K    F NE H+E ++ Q++ E+  +   R    A+++Y  HL   P +       DV ++  +N  R         +   T +EY+    K   +  ELVD L     C+ N + N  +  R+    E+L    L + + SG +L+G  R     SRD   EATV +  G+S     A + E+++QG  N NRA+  D V + +L +  W+     +   E  ++    V E+ +      +S K P+G+VVGI +RNWR Y     KS +      L TP +RRIP IRI    A  L   R IV +DGWP +SRYPNGHFV+S+G  GD ETET  LL+E+++ ++PF+ + L+ LP    + PW + PE++  R DLR L + S+DP GC D+DD L  R+L NG LE+GVHIADV+HF++P + LD E+  R T++Y+ D+R DM+P +LS +LCSL S+VDR A S +WE+  +  +++  + +SVI S   L Y  AQ   DS           P +               ++  ++ +L  ++ ILK RRI+ G L L   EV+    D E     DL  KE  E +  + E M+ AN  VA+K  + +   + LR HPSP   ++  L+  A +K   I   S   LA SLD A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYADI+VHR+L  ++        LT+   +AD C  +N +H+ AQ  QRAS+     +FF+N+   +     EG I+ +R N  VV IP++G++G+VF  ++DK
Sbjct:    8 MKKTRSGGILKIVREHYLRDDITCGCKGCDECQQERAILELEPILESSLCTTAHYLLPDTNVLLHQIDILEDPILKNV--ILLQTVLQEVRSRSAPVYKRIKDLLHNPDKCFYAFTNEHHRETYLEQEQGENANDRNDRAIRTATKWYNKHLKKSPKMA------DVQVILITNDRRNKEKAVEEGIVAYTCEEYI----KSLTANPELVDRLA----CV-NDEKNEVESGRL-IFAEHLPLSKLQQGIKSGAYLQGTFRA----SRDNYLEATVWV-HGDS-----AENKEIIVQGLRNLNRAMHEDIVAVQLLDKENWVTMSSVVLQDEGDSDDIESVEEKEKMLKTAVNSVKKPSGQVVGIIKRNWRPYCGMLSKSQIKESTRHLFTPAERRIPRIRIETRQASTLEGQRIIVAVDGWPRNSRYPNGHFVKSLGTAGDKETETEVLLLEHDVPHQPFSQAVLSFLP----KMPWTITPEDMKNRIDLRHLYVCSVDPPGCTDIDDALHCRELENGTLEVGVHIADVSHFIRPGNALDQESSNRGTTVYLCDKRIDMVPELLSSNLCSLRSNVDRLAFSCIWEVDENANILNTKFTKSVINSKASLTYAEAQMRIDS-----------PNMND-------------EITQSLRLLNKLAKILKKRRIDNGALTLSSPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAQKIYDEFSEYALLRKHPSPPPANYDILVKAAKSKNLDIKTDSAKALADSLDKAESPGFPYMNTLLRILATRCMMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAVGADSTYPDLTDKHKIADICKNINFRHKMAQYSQRASVAFHTQLFFKNRGIVN----EEGFILFVRKNAIVVLIPKFGLEGTVFFEEKDK 875          
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Match: Dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:MGI Symbol;Acc:MGI:2143272])

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 421/1010 (41.68%), Postives = 611/1010 (60.50%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQ-NIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+ ++PC    C        DG  ++ +V++YVI D + + ++ EVLE  +  G I   +  + +Q+   RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + +         ++K G +T   V +++ K YL N+  D  +  +L DS+  +    +       QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L  G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W  +   +  +++         ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +R+DLR   L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPEL +  K  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D +D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H  +++LE V
Sbjct:   15 QGRTLRIVREHYLRPSVPCNSPLCPQPAACRNDGKLLAAEVTHYVIPDWKVVQDYLEVLEFPELKGVIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEEA--------IQKYGSETE-GVFVISFKNYLDNFWPDLKAAHDLCDSILQS----RRERETESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-HGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVEMLPKSEWKGRTAALGENDSD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWEATSVYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPKEEQERKDLRTTHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPELKALDKQSQQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIRDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPKDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDAETEERCIADGVIYSIRTNGVLVFIPRFGIKGAAYLKNKDSLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQASRCHSDTIRLEIV 972          
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Match: Dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:MGI Symbol;Acc:MGI:2143272])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 397/929 (42.73%), Postives = 566/929 (60.93%), Query Frame = 3
Query:  354 NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
             RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + +         ++K G +T   V +++ K YL N+  D  +  +L DS+  +    +       QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L  G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W  +             AL   +  +  + +S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +R+DLR   L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPEL +  K  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D +D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H  +++LE V
Sbjct:   13 GRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEEA--------IQKYGSETE-GVFVISFKNYLDNFWPDLKAAHDLCDSILQS----RRERETESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-HGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVEMLPKSEWKGRTA-----------ALGENDSDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWEATSVYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPKEEQERKDLRTTHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPELKALDKQSQQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIRDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPKDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDAETEERCIADGVIYSIRTNGVLVFIPRFGIKGAAYLKNKDSLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQASRCHSDTIRLEIV 889          
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Match: Dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:MGI Symbol;Acc:MGI:2143272])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 397/929 (42.73%), Postives = 566/929 (60.93%), Query Frame = 3
Query:  354 NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
             RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + +         ++K G +T   V +++ K YL N+  D  +  +L DS+  +    +       QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L  G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W  +             AL   +  +  + +S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +R+DLR   L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPEL +  K  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D +D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H  +++LE V
Sbjct:   13 GRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEEA--------IQKYGSETE-GVFVISFKNYLDNFWPDLKAAHDLCDSILQS----RRERETESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-HGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVEMLPKSEWKGRTA-----------ALGENDSDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWEATSVYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPKEEQERKDLRTTHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPELKALDKQSQQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIRDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPKDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDAETEERCIADGVIYSIRTNGVLVFIPRFGIKGAAYLKNKDSLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQASRCHSDTIRLEIV 889          
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Match: Dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:MGI Symbol;Acc:MGI:2143272])

HSP 1 Score: 706.827 bits (1823), Expect = 0.000e+0
Identity = 397/929 (42.73%), Postives = 566/929 (60.93%), Query Frame = 3
Query:  354 NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
             RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + +         ++K G +T   V +++ K YL N+  D  +  +L DS+  +    +       QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L  G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W  +             AL   +  +  + +S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +R+DLR   L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPEL +  K  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D +D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H  +++LE V
Sbjct:   13 GRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEEA--------IQKYGSETE-GVFVISFKNYLDNFWPDLKAAHDLCDSILQS----RRERETESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-HGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVEMLPKSEWKGRTA-----------ALGENDSDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWEATSVYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPKEEQERKDLRTTHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPELKALDKQSQQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIRDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPKDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDAETEERCIADGVIYSIRTNGVLVFIPRFGIKGAAYLKNKDSLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQASRCHSDTIRLEIV 889          
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Match: Dis3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:MGI Symbol;Acc:MGI:1919912])

HSP 1 Score: 505.368 bits (1300), Expect = 9.536e-162
Identity = 329/936 (35.15%), Postives = 493/936 (52.67%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDG--LKVSP--------DVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAEN--ETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKI---DFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K ++A G +KIV   YL++ I C       C     G  L++ P           +Y++ DT  L++  +VLE       I+  + M+ ++N +  +Y +++ +  +  K    F NE H+E +I Q++ E+  +   R   +A+++Y  HL        +  ++ + ++  +N  +         +   T +EY+    K   +  EL+D L    D     + N  +  ++    E+L    L + + SG +L+G  R ++ ++  EATV +  G+  ++      E+LIQG  + NRA+  D V + +LP SQW+     +   E   E  +   E+ E   +T  S     PTGRVVGI +RNWR Y     KSD+   +  L TP D+RIP IRI    A  L   R IV IDGWP +SRYPNGHFV+++G +G+ ETET  LL+E+++ ++PF+ + L+ LP      PW +  E++  R DLR L + S+DP GC D+DD L  R+L+NGNLE+GVHIADV+HF++P + LD E+ +R T++Y+ ++R DM+P +LS +LCSL S+VDR A S +WE+  + E++   + +SVI S   L Y  AQ   DS     D  TSL  + +LA                            ILK  RIE G L L   E++    D E     DL  KE  E +  + E M+ AN  VAKK  E +   + LR HP+P   ++  L+  A +K   I   +   LA SLD A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYADI+VHR+L  +I      PE  L     L+D C  +N +H+ AQ  QRAS+     +FF++K         E  I+ +R N  VV IP+YG++G+VF  ++DK
Sbjct:    8 LKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLCPWPHYLLPDTNVLLHQIDVLEHPAIRNVIVLQTVMQEVRNRSAPIYKRIRDVTNNQEKHFYTFTNEHHKETYIEQEQGENANDRNDRAIRVAAKWYNEHLKR------VAADSQLQVILITNDRKNKEKAVQEGIPAFTCEEYV----KSLTANPELIDRLAYLSD-----EMNEIESGKI-IFSEHLPLSKLQQGIKSGSYLQGTFRASR-ENYLEATVWI-HGDKEEE-----KEILIQGIKHLNRAVHEDIVAVELLPRSQWVAPSSVVLDDEGQNEDDVEKDEERELLLKTAVSEKMLRPTGRVVGIIKRNWRPYCGMLSKSDIKESRRHLFTPADKRIPRIRIETRQASALEGRRIIVAIDGWPRNSRYPNGHFVKNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFLP----RMPWSITEEDMKNREDLRHLCVCSVDPPGCTDIDDALHCRELSNGNLEVGVHIADVSHFIRPGNALDQESARRGTTVYLCEKRIDMVPELLSSNLCSLRSNVDRLAFSCIWEMNHNAEILKTRFTKSVINSKASLTYAEAQMRIDSAAMNDDITTSLRGLNQLA---------------------------KILKKGRIEKGALTLSSPEIRFHM-DSETHDPIDLQTKELRETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYDILVKAAKSKNLQIKTDTAKSLADSLDRAESPDFPYLNTLLRILATRCMMQAVYFCSGM--DNDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAIGADCTYPE--LTDKHKLSDICKNLNFRHKMAQYAQRASVAFHTQLFFKSKG----IVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDK 880          
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Match: sp|Q8C0S1|DI3L1_MOUSE (DIS3-like exonuclease 1 OS=Mus musculus OX=10090 GN=Dis3l PE=1 SV=2)

HSP 1 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 421/1010 (41.68%), Postives = 611/1010 (60.50%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQ-NIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+ ++PC    C        DG  ++ +V++YVI D + + ++ EVLE  +  G I   +  + +Q+   RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + +         ++K G +T   V +++ K YL N+  D  +  +L DS+  +    +       QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L  G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W  +   +  +++         ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +R+DLR   L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPEL +  K  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D +D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H  +++LE V
Sbjct:   15 QGRTLRIVREHYLRPSVPCNSPLCPQPAACRNDGKLLAAEVTHYVIPDWKVVQDYLEVLEFPELKGVIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEEA--------IQKYGSETE-GVFVISFKNYLDNFWPDLKAAHDLCDSILQS----RRERETESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-HGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVEMLPKSEWKGRTAALGENDSD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWEATSVYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSPKEEQERKDLRTTHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPELKALDKQSQQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIRDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPKDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDAETEERCIADGVIYSIRTNGVLVFIPRFGIKGAAYLKNKDSLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQASRCHSDTIRLEIV 972          
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Match: sp|Q5U2P0|DI3L1_RAT (DIS3-like exonuclease 1 OS=Rattus norvegicus OX=10116 GN=Dis3l PE=2 SV=2)

HSP 1 Score: 726.857 bits (1875), Expect = 0.000e+0
Identity = 424/1010 (41.98%), Postives = 609/1010 (60.30%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQ-NIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+ ++PC    C        DG  +S +V++YVI D + + ++ EVLE  +  G I   +  + +Q+   RR Y KL+ L +D     +LF NEF Q C++ +++ E    + TR  + ++ +Y  H   +  +V +T + + A+ QY       G +T   V +++ K YL N+  D  +  EL DS+  +    +    +  QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L +G S+K    L S++LI G   RNR+I GD VV+ +LP+S+W        G  A    AL   +  +  + +S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++P+E  +RRDLR   L+FSIDP GC+DVDD LS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP +LS DLCSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQ++ D        +  IPE  +  +  +    + ++L  A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D  D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N +L + C  +NN++R AQ  Q+ S ELFQ M+F+++  +   R   +G+I  +R+NG +V IPR+GIKG+ +L+ +D  +  +   PE  S        +W   +         Q+  N+I    A  Q+  T+ LFD V +RI    S  H   ++LE V
Sbjct:   15 QGRTLRIVREHYLRPSVPCNSPLCPQPATCRNDGKLLSAEVTHYVIPDWKVVQDYLEVLEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCVLFANEFQQHCYLPREKGEAMEKWQTRSIYNSAVWYYHHCEDRMPIVMVTEDEE-AIQQY-------GSETE-GVFVISFKNYLDNFWPDLKAAHELCDSIIQS----RRERESESQETHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-QGASSKDS-GLVSDILIHGSKARNRSIHGDVVVVELLPKSEW-------KGRTA----ALCENDSEDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWETTSVYPNGHFVRVLGRIGDLEGEIATILVENSINVVPFSEAQMCEMPVNTAENPWKVSPKEEQERRDLRSTHLVFSIDPKGCEDVDDALSVRTLNNGNLELGVHIADVTHFVAPNSYIDVEARTRATTYYLADRRYDMLPSILSADLCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNFSI---VDDIPEFKTLEEQNRQA--KLEELVWAIGKLTDIARHIRAKRDRCGALELEGVEVRVQLDD--KKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDSANDPSDPLVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKVEIKENLFSNKNLEELCRHINNRNRAAQRSQKQSTELFQCMYFKDRDPETEERCVVDGIIYSIRTNGVLVFIPRFGIKGAAYLKNKDGLV--ISCGPEGSS--------EWKPGS--------LQRSQNKIISTTAGGQS-VTFHLFDHVTVRISVQPSRCHSDMIRLEIV 972          
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Match: sp|A0JN80|DI3L1_BOVIN (DIS3-like exonuclease 1 OS=Bos taurus OX=9913 GN=DIS3L PE=2 SV=2)

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 420/1011 (41.54%), Postives = 606/1011 (59.94%), Query Frame = 3
Query:  135 LKIV-SRYLQ-NIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLK-----SAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            L+IV   YL+ ++PC    C        DG  +S DV++Y++ D + + ++ E+LE  +  G +   +  + +Q+   RR Y KL+ L +D     +LF NEF Q C++ ++  E    + +R  + A+ +Y  H   +  +V +T + + A+ QY       G +T   V +++ K YL N+  D  +  EL +S+  +    +    N  QE       E++  EVL   + SG +++G + VNK +++ EA V L +G S+K    L S+VLI G   RNR+I GD VV+ +LP+S+W  +   + G     + AL           +S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++ +E  +R DLR+  L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV PHS +D+EAR R+T+ Y+ADRR+DMLP +LS D+CSL   VDRYAVSV+WEL     E+  V Y R++IRS+YKL YE AQD+ D      + +  IPE       FKD  E+ +Q K      A+  L +++  ++++R   G LELEG+EV+++    E+  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D  D   NK+LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        +E+L +N  L + C  +NN++R AQ  Q+ S ELFQ M+F++K  +   R  ++GVI  +R+NG +V IPR+GIKG+ +LR +D  +  +   P+          ++W   +         Q+  N+IT      ++  T+ LFD V +RI    S  H  +++LE +
Sbjct:   19 LRIVREHYLRPSVPCNSPLCPQPATCHNDGKLLSSDVTHYMVPDWKVVQDYLEILEFPELKGIVFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCVLFANEFQQSCYLPRERGESMEKWQSRSIYNAAAWYYHHCQDRMPIVMVTEDEE-AIQQY-------GSETG-GVFVISFKNYLDNFWPDLKAAHELCESILQS----RRERENESQESHGKEYPEHVPLEVLEAGIKSGRYIQGTLNVNKHRAQIEAFVRL-QGASSKDS-DLVSDVLIHGMKARNRSIHGDVVVVELLPKSEWKGRTTAL-GENDGDDKALG----------ESPSEPMPTGRVVGILQKNWRDYVVTFPSIEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWESTSMYPNGHFVRVLGRIGDLEGEIATILVENSISVVPFSEAQMCEMPVNTPENPWKVSSQEEREREDLRKTHLVFSIDPSGCEDVDDTLSVRALDNGNLELGVHIADVTHFVAPHSYIDIEARTRATTYYLADRRYDMLPAILSADVCSLLGGVDRYAVSVMWELDKTSYEIKKVWYGRTIIRSAYKLFYEAAQDLLDGNF---SVVKDIPE-------FKDLDEKSRQAKLEELVWAIRKLTDIARHIRAKRDSCGALELEGVEVRIQLD--EKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRRHPPPHQEFFSELRECAKAKGFFIDTRSNKALADSLDNANDPNDPIVNKLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIIVHRLLMAAISKDKKMEIQENLFSNKDLEELCRHINNRNRAAQHSQKQSTELFQCMYFKDKDPETEERCISDGVIYSIRTNGVLVFIPRFGIKGAAYLRNKDGLV--VSCGPDG--------HSEWKPGS--------LQRFQNKITCTTTGGES-VTFHLFDHVTVRISVQTSRCHSDTIRLEII 972          
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Match: sp|Q5R5N8|DI3L1_PONAB (DIS3-like exonuclease 1 OS=Pongo abelii OX=9601 GN=DIS3L PE=2 SV=1)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 427/1015 (42.07%), Postives = 610/1015 (60.10%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQN-IPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLK-----SAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+  +PC    C        DG  +S DV++YVI D + + ++ E+LE  +  G I   +  + +Q+   RR Y KL+ L +D     ILF NEF Q C++ ++  E    + TR  + A+ +Y  H   +  +V +T + + A+ QY       G +T   V +++ K YL N+  D  +  EL DS+  +    +    N  QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L +G S+K    L S++LI G   RNR+I GD VV+ +LP+++W  + + +  ++          ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT ENPWK++PEE  KR+DLR+  L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYAVS++WEL     E+  V Y R++IRS+YKL YE AQ++ D  +   + +  IPE       FKD  E+ +Q K      A+  L +++  ++++R   G LELEG+EV+V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A    D   N++LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        + +L +N  L + C  +NN++R AQ  Q+ S ELFQ M+F++K      R  ++GVI  +R+NG +V IPR+GIKG+ +L+ +D  +  +   P+  S        +W   +         Q+  N+IT      ++  T+ LFD V +RI    S  H  + +LE +
Sbjct:   15 QGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSNDVTHYVIPDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEE-AIQQY-------GSETE-GVFVISFKNYLDNFWPDLKAAHELCDSILQS----RRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-QGASSKDS-DLVSDILIHGMKARNRSIHGDVVVVELLPKNEWKGRTVALCENDCD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNTPENPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNL---SVVDDIPE-------FKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVRVQLDD--KKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANGPHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNRAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRANGVLVFIPRFGIKGAAYLKNKDGLV--ISCGPDSCS--------EWKPGS--------LQRFQNKITSTTTDGES-VTFHLFDHVTVRISIQVSRCHSDTTRLEII 972          
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Match: sp|Q8TF46|DI3L1_HUMAN (DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2)

HSP 1 Score: 720.309 bits (1858), Expect = 0.000e+0
Identity = 426/1015 (41.97%), Postives = 611/1015 (60.20%), Query Frame = 3
Query:  126 QGK-LKIV-SRYLQN-IPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLK-----SAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP----EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIAR-YTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            QG+ L+IV   YL+  +PC    C        DG  +S DV++YVI D + + ++ E+LE  +  G I   +  + +Q+   RR Y KL+ L +D     ILF NEF Q C++ ++  E    + TR  + A+ +Y  H   +  +V +T + + A+ QY       G +T   V ++T K YL N+  D  +  EL DS+  +    +    N  QE       E+L  EVL   + SG +++GI+ VNK +++ EA V L +G S+K    L S++LI G   RNR+I GD VV+ +LP+++W  + + +  ++          ++A  E   S S   PTGRVVGI ++NWRDYV +F      +S   + Q +LVTP+D RIP IRI    A+ L + R +VRID W  +S YPNGHFV  +G IGDLE E  T+L+E ++   PF+ +Q+ E+P+NT E+PWK++PEE  KR+DLR+  L+FSIDP GC+DVDDTLS+R L NGNLELGVHIADVTHFV P+S +D+EAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYAVS++WEL     E+  V Y R++IRS+YKL YE AQ++ D  +   + +  IPE       FKD  E+ +Q K      A+  L +++  ++++R   G LELEG+EV V+  D  +  + DL  K+PLEVHET+AECMI ANHWVAKK  E++P ++ LR HP P  + F EL  CA  KGF I+  SN  LA SLD A D  D   N++LRS+AT AMSNA YFSTG    E+++HYGLAL  YTHFTSPIRRY+DI+VHR+L+ +I        + +L +N  L + C  +NN+++ AQ  Q+ S ELFQ M+F++K      R  ++GVI  +R+NG ++ IPR+GIKG+ +L+ +D  +  +   P+  S        +W   +         Q+  N+IT      ++  T+ LFD V +RI    S  H  +++LE +
Sbjct:   15 QGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVIPDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEE-AIQQY-------GSETE-GVFVITFKNYLDNFWPDLKAAHELCDSILQS----RRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRL-QGASSKDS-DLVSDILIHGMKARNRSIHGDVVVVELLPKNEWKGRTVALCENDCD--------DKASGE---SPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIPKIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNTPESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGNL---SVVDDIPE-------FKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQLDD--KKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGAAYLKNKDGLV--ISCGPDSCS--------EWKPGS--------LQRFQNKITSTTTDGES-VTFHLFDHVTVRISIQASRCHSDTIRLEII 972          
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Match: A0A267FA90 (RNB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033243g1 PE=3 SV=1)

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 474/1019 (46.52%), Postives = 642/1019 (63.00%), Query Frame = 3
Query:  153 YLQ-NIPCKVN-CTYDCNKDFDGLKVSPD-VSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYN-RRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQEL---RVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKS------DLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAER-FQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSI-EGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLI--------------NQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRS 3119
            YL+ ++PC    C   C    DG    P  +++YV+ D      + E+ EL +  G ++TL+++ +IQ    RRLY ++K    DP +S  LF NEF  EC+  ++  E    +   LN+ A+++Y  HL+Y   +V +T  T    ++      K G+D      ++++ +Y+  +H D     ++ +SL A+    + + +         R D   E+LS E L   V SG FL+G + V++   +D A V LS G    ++ A   E+LI GQ +RNRA+ GD V + +LP++ W                A PV  + E +T DS++   PTGRVVGI++RNWRDYVCS E +      D  + + +L  P+DRR+P IRI  + A  L + RF+VRID WP  S+YPNGHFV  +G +G LETET+ LLIE+ L  R F+  QLAELP  T++ PW+++P+EV+KRRDLR+  L+FSIDP+GC DVDDTLS+R+L NGN+ELGVHIADVTHFVK +SL D+EAR+R TSIY+ADRR+DMLP +LSG+LCSLWS VDRYAVSV+WELTPD EVVSV Y R+VIRS+YKL YE+AQ I+D +   ET++  IPELA   K  +D   R F QL+ AV++L+ V++ +K+RR+  GGLELEG+EVQ KF+DPERT+LEDL  K PL++HE IAECMIFANHWVA+K +  YP++SCLR HP PR + F  LI CA  +GFTI   SN +LA+SLD  VD  D E N+ILR+LAT AMSNA YFSTG L  + + HYGLAL  YTHFTSPIRRYADILVHR LL ++ +   E+SLL N  L  QC +MN +HR AQ  Q AS++LFQ +FFR +   D  R  E V+ ++R +   V +PRYGIKGSV L + D S+  L + P P  ++  V   Q            C  + I                + V     Q +Q Y LFD + +R+  +ESHSHG +LQL+ V +L S
Sbjct:   40 YLRSDVPCCSELCRRGCQAPADGCASLPAALTHYVLPDCAAARAYWELFELPEVEGVLLTLTSLHHIQGAGGRRLYNRVKSQLRDPRQSTALFDNEFQAECWRDRRPGESEDQHAAGLNWSAARWYAQHLDYAIPIVLVTDGT----VEPCQPEDKGGVD------VLSVADYVARFHGDKPQVTQIFESLRASLAAAEAASSAEGSAGESTRGD-YPEHLSAESLKAGVKSGQFLQGCLHVSRKSGQDTAVVSLSGGAQMLELKASRGEILIVGQRDRNRAVHGDIVCVQLLPKASW----------------AQPV--EGEQQTADSAAA--PTGRVVGIAQRNWRDYVCSVEPAADGSSKDSGASKRILAVPWDRRVPKIRIATSQAAALASQRFVVRIDAWPADSQYPNGHFVRPLGAVGHLETETQALLIEHGLAVREFSAKQLAELPAVTEDQPWQVDPQEVAKRRDLRQSHLVFSIDPVGCVDVDDTLSVRRLDNGNIELGVHIADVTHFVKANSLCDIEARQRCTSIYLADRRYDMLPLLLSGNLCSLWSQVDRYAVSVIWELTPDTEVVSVWYGRTVIRSAYKLFYEMAQRIHDGEA-METAVPDIPELAPLLKRDRDLLRRRFAQLREAVSLLVGVANTIKARRMACGGLELEGVEVQAKFADPERTQLEDLVPKAPLQMHEVIAECMIFANHWVARKIVAYYPSQSCLRRHPPPRQEFFDSLIRCAQARGFTIKADSNRQLAESLDSCVDPADPEVNRILRTLATQAMSNALYFSTGALPRDQFAHYGLALDLYTHFTSPIRRYADILVHRCLLAALGDSEAEDSLLPNQELEAQCCLMNERHRAAQHAQMASMQLFQCLFFRARPPTDPLRLVEAVVCQVRDSSIGVFVPRYGIKGSVRLARSDGSV--LDAGP-PARDLRSV---QAAPPPAEAAPDGCGPRWIPAGSGASVSRDPSGGSLRVSTGPEQKQQVYSLFDHLVVRVSVAESHSHGPALQLDLVARLVS 1020          
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Match: A0A267DPE8 (RNB domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033243g2 PE=3 SV=1)

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 473/1019 (46.42%), Postives = 642/1019 (63.00%), Query Frame = 3
Query:  153 YLQ-NIPCKVN-CTYDCNKDFDGLKVSPD-VSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYN-RRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQEL---RVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKS------DLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAER-FQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSI-EGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLI--------------NQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRS 3119
            YL+ ++PC    C   C    DG    P  +++YV+ D      + E+ EL +  G ++TL+++ +IQ    RRLY ++K    DP +S  LF NEF  EC+  ++  E    +   LN+ A+++Y  HL+Y   +V +T  T    ++      K G+D      ++++ +Y+  +H D     ++ +SL A+    + + +         R D   E+LS E L   V SG FL+G + V++   +D A V LS G    ++ A   E+LI GQ +RNRA+ GD V + +LP++ W                A PV  + E +T DS++   PTGRVVGI++RNWRDYVCS E +      D  + + +L  P+DRR+P IRI  + A  L + RF+VRID WP  S+YPNGHFV  +G +G LETET+ LLIE+ L  R F+  QLAELP  T++ PW+++P+EV+KRRDLR+  L+FSIDP+GC DVDDTLS+R+L NGN+ELGVHIADVTHFVK +SL D+EAR+R TSIY+ADRR+DMLP +LSG+LCSLWS VDRYAVSV+WELTPD EVVSV Y R+VIRS+YKL YE+AQ I+D +   ET++  IPELA   K  +D   R F QL+ AV++L+ V++ +K+RR+  GGLELEG+EVQ KF+DPERT+LEDL  K PL++HE IAECMIFANHWVA+K +  YP++SCLR HP PR + F  LI CA  +GFTI   SN +LA+SLD  VD  D E N+ILR+LAT AMSNA YFSTG L  + + HYGLAL  YTHFTSPIRRYADILVHR LL ++ +   E++LL N  L  QC +MN +HR AQ  Q AS++LFQ +FFR +   D  R  E V+ ++R +   V +PRYGIKGSV L + D S+  L + P P  ++  V   Q            C  + I                + V     Q +Q Y LFD + +R+  +ESHSHG +LQL+ V +L S
Sbjct:   40 YLRSDVPCCSELCRRGCQAPADGCASLPAALTHYVLPDCAAARAYWELFELPEVEGVLLTLTSLHHIQGAGGRRLYNRVKSQLRDPRQSTALFDNEFQAECWRDRRPGESEDQHAAGLNWSAARWYAQHLDYAIPIVLVTDGT----VEPCQPEDKGGVD------VLSVADYVARFHGDKPQVTQIFESLRASLAAAEAASSAEGSAGESTRGD-YPEHLSAESLKAGVKSGQFLQGCLHVSRKSGQDTAVVSLSGGAQMLELKASRGEILIVGQRDRNRAVHGDIVCVQLLPKASW----------------AQPV--EGEQQTADSAAA--PTGRVVGIAQRNWRDYVCSVEPAADGSSKDSGASKRILAVPWDRRVPKIRIATSQAAALASQRFVVRIDAWPADSQYPNGHFVRPLGAVGHLETETQALLIEHGLAVREFSAKQLAELPAVTEDQPWQVDPQEVAKRRDLRQSHLVFSIDPVGCVDVDDTLSVRRLDNGNIELGVHIADVTHFVKANSLCDIEARQRCTSIYLADRRYDMLPLLLSGNLCSLWSQVDRYAVSVIWELTPDTEVVSVWYGRTVIRSAYKLFYEMAQRIHDGEA-METAVPDIPELAPLLKRDRDLLRRRFAQLREAVSLLVGVANTIKARRMACGGLELEGVEVQAKFADPERTQLEDLVPKAPLQMHEVIAECMIFANHWVARKIVAYYPSQSCLRRHPPPRQEFFDSLIRCAQARGFTIKADSNRQLAESLDSCVDPADPEVNRILRTLATQAMSNALYFSTGALPRDQFAHYGLALDLYTHFTSPIRRYADILVHRCLLAALGDSEAEDALLPNQELEAQCCLMNERHRAAQHAQMASMQLFQCLFFRARPPTDPLRLVEAVVCQVRDSSIGVFVPRYGIKGSVRLARSDGSV--LDAGP-PARDLRSV---QAAPPLAEAAPDGCGPRWIPAGSGASVSRDPSGGSLRVSTGPEQKQQVYSLFDHLVVRVSVAESHSHGPALQLDLVARLVS 1020          
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Match: A0A0X3PEG3 (RNB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR123714 PE=3 SV=1)

HSP 1 Score: 834.713 bits (2155), Expect = 0.000e+0
Identity = 497/1226 (40.54%), Postives = 696/1226 (56.77%), Query Frame = 3
Query:   75 YSIFDVNSLRKIKTSQAQGKLKIVSR--YLQ-NIPCKVNCTYDCNKD--FDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY--NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIP-QELR--------------VDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQM-------MALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASA------ELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSF----EKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRE-----------LLIFSIDPIGCQDVDDTLSIRKL---ANGN--LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSK----------------IDFETSLG-LIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPE-RT-KLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGM--LKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPE----------------------ESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLR-SNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQT-QWLSDNELTI----------ETECYQQLINQITVVRA-ANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRL-----SKDDLFQNVREAND---------------------MXXXXXXXXXXXXIDESVLIASLHSNTSLCHLFRQFKIRKLG 3338
            ++I  V S + +     QGK   V+R  YL  ++PC+++    CN +    G  + P++ + +IVD  Y ++F EVLE  D  G ++TLS++ Y Q    +R +Y +++    DPA+  +LF NEFH++CF      E +LNY TRLN+IA+Q+Y  HL  +  V+ LT N  VAL + +   R A  D   +V +M +  YL  YH    +  +L +SL A+      +    P   LR               D    +L D  L   + SG FL+GIIRV++F+S  EA V L++ ++ K          A  SE+ I G   RNRAIDGD VV+ +LP  QW +    ++ +EA A       +   +A     E    S    P G VVGI  RNWRDYVC+F     +    S  +V+VTP+DR+IP IR+  T   +L   RFIVRID W  +S YP+GHFV+S+G IGDLETET+T+L+E+ L +RPFT +QL EL     +  WK++P+EV+ RRDLR             L+FSIDP GCQDVDD LS+R L   A G   ++LGVHIADVT+FVK    LD EAR+RSTS+Y+ADRR+DMLP +LSGD+CSLWS VDRYA+S +WEL PD +EV+ V + R+VIRSSYK+ YE AQ I D K                +  +  +G L+PELA+     K       +L +A+++L  ++S +++RR+E GGLELE +EV ++F++PE RT  L+D+  KEPLE+H T+AE MIFANHW+A+ CL+ +P  SCLR HP+PR + F EL  CA++KGF ++  SN  LA SL+   D  D E NKILR LAT AM+NA YFS+G   L  + + HYGLAL  YTHFTSPIRRYADI+VHR+L+ +++   +                        L  +  LA  C  MN +H  AQ  QRASIELFQA+FFR++  DD  R+ EGVI +LR +NGF V +PRYGI+G+VFLR+ D  +AW        S  E+   T  WL  +   I           T       +Q+ VVR+ AN  +Q Y++FD V + I  S S +HGLSL+L+   ++     +++ P     T  +     + +++ ++VR  N                      + ++     E+E   ++ LIA LHS +S  H FR+      G
Sbjct:    5 FTISRVKSEKVVTYVTPQGKEARVTREVYLSSDVPCRLSA---CNNEACHKGYVLPPEIRDILIVDGHYALSFWEVLEATDIKGIVVTLSSLNYAQQQASSRAVYNRIRACLNDPAQHCVLFDNEFHEKCFRQALPSESSLNYTTRLNWIAAQWYRQHLKGKVNVILLTENESVAL-EAAKKSRTAN-DLDDSVLVMNLATYLQTYHPKLTTVWQLYESLSASLKSTTTASEPAPVTSLRDDVALMSLPQVPSAGDVFPAHLPDAALLAGIRSGQFLRGIIRVSRFRSATEAVVALTDASALKHQAEVKDTEFASRSEIAINGIQYRNRAIDGDVVVVRLLPRQQWSSFSTNLAEAEAGAVETLATSMGTQMAAVGALEAGPPSKASMPCGFVVGIMSRNWRDYVCTFVQDESRPAPESAGWVVVTPWDRKIPRIRMFTTRPTQLAKERFIVRIDRWDTNSNYPHGHFVQSLGPIGDLETETQTILVEHGLLHRPFTDAQLQELKSYASDRKWKVDPKEVANRRDLRPPSVSGNKKSEGTLVFSIDPPGCQDVDDALSVRWLPANAEGRRRIQLGVHIADVTYFVKAGGNLDAEARRRSTSVYLADRRYDMLPGLLSGDICSLWSGVDRYAMSAIWELDPDSLEVLDVWFGRTVIRSSYKMTYEAAQKIADLKDVGTEETPKPDCILRQLGGKKGVGELVPELANVPD--KKLLSSLGELYTALSILARIASSIRARRLERGGLELESIEVSIQFANPETRTGSLQDIIPKEPLEMHSTVAELMIFANHWIARCCLDAFPECSCLRRHPAPRSEFFEELKRCASSKGFRMSVDSNRALAASLEACNDTNDPEVNKILRQLATRAMTNALYFSSGAEDLTRDQFGHYGLALNLYTHFTSPIRRYADIVVHRVLMAALKKSAQCVAVEATDGQVVASTAAAAAARTELYEHEELAAICRHMNERHWAAQQAQRASIELFQALFFRDRPADDACRFAEGVICQLRGTNGFSVIVPRYGIRGNVFLRQPDGRVAWATG-----SGTEKAGATITWLPADSCEILRTTFIPDAGNTTGGLLSCDQLEVVRSDANGGKQVYRIFDHVMVHITVSSSTAHGLSLRLDLHARVPITAADSRQPKDGTTTAAVDLKVRADEEMIESVRAVNSARKRKRVGDGGDSDAAVTAAKLAMEGEFATEDEIAQQNALIAELHSASSSYHRFRKILATSAG 1218          
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Match: A0A183TB91 (RNB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13739 PE=3 SV=1)

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 496/1249 (39.71%), Postives = 694/1249 (55.56%), Query Frame = 3
Query:   75 YSIFDVNSLRKIKTSQAQGKLKIVSR--YLQ-NIPCKVNCTYDCNKD--FDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY--NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVE-----------------------IMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIP-QELR--------------VDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQM-------MALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASA------ELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSF----EKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRE-----------LLIFSIDPIGCQDVDDTLSIRKL---ANGN--LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSK----------------IDFETSLG-LIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPE-RT-KLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGM--LKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPE----------------------ESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLR-SNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQT-QWLSDNELTI----------ETECYQQLINQITVVRA-ANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRL-----SKDDLFQNVREAND---------------------MXXXXXXXXXXXXIDESVLIASLHSNTSLCHLFRQFKIRKLG 3338
            ++I  V S + +     QGK   V+R  YL  ++PC+++    CN +    G  + P++ + +IVD  Y ++F EVLE  D  G ++TLS++ Y Q    +R +Y +++    DPA+  +LF NEFH++CF      E +LNY TRLN+IA+Q+Y  HL  +  V+ LT N  VAL           +D S+ V                        +M +  YL  YH    +  +L +SL A+      +    P   LR               D    +L D  L   + SG FL+GIIRV++F+S  EA V L++ ++ K          A  SE+ I G   RNRAIDGD VV+ +LP  QW +    ++ +EA A       +   +A     E    S    P G VVGI  RNWRDYVC+F     +    S  +V+VTP+DR+IP IR+  T   +L   RFIVRID W  +S YP+GHFV+S+G IGDLETET+T+L+E+ L +RPFT +QL EL     +  WK++P+EV+ RRDLR             L+FSIDP GCQDVDD LS+R L   A G   ++LGVHIADVT+FVK    LD EAR+RSTS+Y+ADRR+DMLP +LSGD+CSLWS VDRYA+S +WEL PD +EV+ V + R+VIRSSYK+ YE AQ I D K                +  +  +G L+PELA+     K       +L +A+++L  ++S +++RR+E GGLELE +EV ++F++PE RT  L+D+  KEPLE+H T+AE MIFANHW+A+ CL+ +P  SCLR HP+PR + F EL  CA++KGF ++  SN  LA SL+   D  D E NKILR LAT AM+NA YFS+G   L  + + HYGLAL  YTHFTSPIRRYADI+VHR+L+ +++   +                        L  +  LA  C  MN +H  AQ  QRASIELFQA+FFR++  DD  R+ EGVI +LR +NGF V +PRYGI+G+VFLR+ D  +AW        S  E+   T  WL  +   I           T       +Q+ VVR+ AN  +Q Y++FD V + I  S S +HGLSL+L+   ++     +++ P     T  +     + +++ ++VR  N                      + ++     E+E   ++ LIA LHS +S  H FR+      G
Sbjct:    5 FTISRVKSEKVVTYVTPQGKEARVTREVYLSSDVPCRLSA---CNNEACHKGYVLPPEIRDILIVDGHYALSFWEVLEATDIKGIVVTLSSLNYAQQQASSRAVYNRIRACLNDPAQHCVLFDNEFHEKCFRQALPSESSLNYTTRLNWIAAQWYRQHLKGKVNVILLTENESVALEAAKKSRTANDLDDSVLVSSMSRLFHSRLLNPSQFFYLALLLVMNLATYLQTYHPKLTTVWQLYESLSASLKSTTTASEPAPVTSLRDDVALMSLPQVPSAGDVFPAHLPDAALLAGIRSGQFLRGIIRVSRFRSATEAVVALTDASALKHQAEVKDTEFASRSEIAINGIQYRNRAIDGDVVVVRLLPRQQWSSFSTNLAEAEAGAVETLATSMGTQMAAVGALEAGPPSKASMPCGFVVGIMSRNWRDYVCTFVQDESRPAPESAGWVVVTPWDRKIPRIRMFTTRPTQLAKERFIVRIDRWDTNSNYPHGHFVQSLGPIGDLETETQTILVEHGLLHRPFTDAQLQELKSYASDRKWKVDPKEVANRRDLRPPSVSGNKKSEGTLVFSIDPPGCQDVDDALSVRWLPANAEGRRRIQLGVHIADVTYFVKAGGNLDAEARRRSTSVYLADRRYDMLPGLLSGDICSLWSGVDRYAMSAIWELDPDSLEVLDVWFGRTVIRSSYKMTYEAAQKIADLKDVGTEETPKPDCILRQLGGKKGVGELVPELANVPD--KKLLSSLGELYTALSILARIASSIRARRLERGGLELESIEVSIQFANPETRTGSLQDIIPKEPLEMHSTVAELMIFANHWIARCCLDAFPECSCLRRHPAPRSEFFEELKRCASSKGFRMSVDSNRALAASLEACNDTNDPEVNKILRQLATRAMTNALYFSSGAEDLTRDQFGHYGLALNLYTHFTSPIRRYADIVVHRVLMAALKKSAQCVAVEATDGQVVASTAAAAAARTELYEHEELAAICRHMNERHWAAQQAQRASIELFQALFFRDRPADDACRFAEGVICQLRGTNGFSVIVPRYGIRGNVFLRQPDGRVAWATG-----SGTEKAGATITWLPADSCEILRTTFIPDAGNTTGGLLSCDQLEVVRSDANGGKQVYRIFDHVMVHITVSSSTAHGLSLRLDLHARVPITAADSRQPKDGTTTAAVDLKVRADEEMIESVRAVNSARKRKRVGDGGDSDAAVPAAKLAMEGEFATEDEIAQQNALIAELHSASSSYHRFRKILATSAG 1243          
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Match: A0A1I8HG56 (RNB domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 818.15 bits (2112), Expect = 0.000e+0
Identity = 449/1019 (44.06%), Postives = 612/1019 (60.06%), Query Frame = 3
Query:  153 YLQ-NIPCKVN-CTYDCNKDFDGLKVSPD-VSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYN-RRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQEL---RVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKS------DLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELAS-KHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSI-EGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLI--------------NQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRS 3119
            YL+ ++PC    C   C    DG    P  +++YV+ D      + E+ EL +  G ++TL+++ +IQ    RRLY ++K    DP +S  LF NEF  EC+  ++  E    +   LN+ A+++Y  HL+Y   +V +T  T    ++      K G+D      ++++ +Y+  +H D     ++ +SL A+    + + +         R D   E+LS E L   V SG FL+G + V++   +D A V LS G    QM+ L +      +        G               ++  +  + A   L       +     D    + P GRVVGI++RNWRDYVCS E +      D  + + +L  P+DRR+P IRI  + A  L + RF+VRID WP  S+YPNGHFV  +G +G LETET+ LLIE+ L  R F+  QLAELP  T++ PW+++P+EV+KRRDLR+  L+FSIDP+GC DVDDTLS+R+L NGN+ELGVHIADVTHFVK +SL D+EAR+R TSIY+ADRR+DMLP +LSG+LCSLWS VDRYAVSV+WELTPD EVVSV Y R+VIRS+YKL YE+AQ I+D +   ET++  IPELA    +       RF QL+ AV++L+ V++ +K+RR+  GGLELEG+EVQ KF+DPERT+LEDL           IAECMIFANHWVA+K +  YP++SCLR HP PR + F  LI CA  +GFTI   SN +LA+SLD  VD  D E N+ILR+LAT AMSNA YFSTG L  + + HYGLAL  YTHFTSPIRRYADILVHR LL ++ +   E++LL N  L  QC +MN +HR AQ  Q AS++LFQ +FFR +   D  R  E V+ ++R +   V +PRYGIKGSV L + D S+  L + P P  ++  V   Q            C  + I                + V     Q +Q Y LFD + +R+  +ESHSHG +LQL+ V +L S
Sbjct:   40 YLRSDVPCCSELCRRGCQAPADGCASLPAALTHYVLPDCAAARAYWELFELPEVEGVLLTLTSLHHIQGAGGRRLYNRVKSQLRDPRQSTALFDNEFQAECWRDRRPGESEDQHAAGLNWSAARWYAQHLDYAIPIVLVTDGT----VEPCQPEDKGGVD------VLSVADYVARFHGDKPQVTQIFESLRASLAAAEAASSAEGSAGESTRGD-YPEHLSAESLKAGVKSGQFLQGCLHVSRKSGQDTAVVSLSGG---AQMLELKASRRDPDRRAARPEPGG--------------ARRHRVRPAAAQGLLG----PASRRRAADGGLGRRPHGRVVGIAQRNWRDYVCSVEPAADGSSKDSGASKRILAVPWDRRVPKIRIATSQAAALASQRFVVRIDAWPADSQYPNGHFVRPLGAVGHLETETQALLIEHGLAVREFSAKQLAELPAVTEDQPWQVDPQEVAKRRDLRQSHLVFSIDPVGCVDVDDTLSVRRLDNGNIELGVHIADVTHFVKANSLCDIEARQRCTSIYLADRRYDMLPLLLSGNLCSLWSQVDRYAVSVIWELTPDTEVVSVWYGRTVIRSAYKLFYEMAQRIHDGEA-METAVPDIPELAPLLKRDRDLLRRRFAQLREAVSLLVGVANTIKARRMACGGLELEGVEVQAKFADPERTQLEDL----------VIAECMIFANHWVARKIVAYYPSQSCLRRHPPPRQEFFDSLIRCAQARGFTIKADSNRQLAESLDSCVDPADPEVNRILRTLATQAMSNALYFSTGALPRDQFAHYGLALDLYTHFTSPIRRYADILVHRCLLAALGDSEAEDALLPNQELEAQCCLMNERHRAAQHAQMASMQLFQCLFFRARPPTDPLRLVEAVVCQVRDSSIGVFVPRYGIKGSVRLARSDGSV--LDAGP-PARDLRSV---QAAPPPAEAAPDGCGPRWIPAGSGASVSRDPSGGSLRVSTGPEQKQQVYSLFDHLVVRVSVAESHSHGPALQLDLVARLVS 1009          
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:103029381])

HSP 1 Score: 724.546 bits (1869), Expect = 0.000e+0
Identity = 425/1052 (40.40%), Postives = 620/1052 (58.94%), Query Frame = 3
Query:   81 IFDVNSLRKIKTSQAQGKLKIVSRYL--QNIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLN--VEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQ----EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETI-DSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGN-LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEE----SLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQ-----LRSGKQNAKLPTG 3149
            +F    +  +K+S+  GK+++V  +   + + C    C   C  D DG  +S DV++YV+ D   + +F EVLE  +  G + T +  +   +   RR Y +L+ L +DP    +LF NEF Q  +  +++ E    + TR  + A+ +Y +HL     VV +T + D A+ +YS          SLN  V +++ +EYL  +  D  +  EL  S+  A            QE   +A +    E+L  EVL   + SG +++G + VNK +++ EA V   EG+S+K    L+S++LI G   RNRAI GD V + +LP  +W  +   ++             EQ E +T  D+ S   P+GRVVGI +RNWRDYV +F      +S   + Q +L  P+D RIP IRI    A+ L +HR IVR+D W  +S YPNGH V  +G  G+LETE +T+LIE +++   F+ +QL E+P+N+ + PW+M+  EVS RRDLR+  L+FSIDP+GC+DVDDTLS++ L  G  LELGVHIADVTHFVK  SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL  + +EV  V Y R++IRSSY+LHYELAQ + + +         +PELA    +  +  ++  +L  A+  L  ++  L+++R + G LELEG+EV+ +    E   +  L  K+PLEVHET+AECMI+ANHWVA+K  E++P ++ LRHHP PR + F +LI CA T+GFTI+  SN  LA SLD AVD  D   N+++R +AT AMSNA YFSTG    E YYHYGLAL  YTHFTSPIRRYADI+VHR+L+ +I+   +E    +L +N  L +  + +NN++R AQ  Q+ S+ELFQ ++FR+K    D     + VI  +R+NG +V IPRYG+KG+V+L+ ++  +  ++                   D     +    Q+  ++I+   + ++   T+ LFD V +RI    S  H  ++ LE +       +RSG+     P G
Sbjct:    1 MFKTEKVLHLKSSRG-GKVRVVREHYVRERVSCGCAVCEAGC--DRDGKLLSGDVTHYVVPDAVVVRDFLEVLEFRELQGIVFTQTACQAAHHARGRRHYNRLRGLLKDPRHDCVLFANEFQQYSYCPREKGETQEKWHTRCVYHAAVWYYNHLAGLKPVVMITEDQD-AVKEYS----------SLNSGVYVISTREYLETFWPDLQAAQELYTSISQAL-----------QERESEATEKEYTEHLPAEVLEAGIKSGRYIQGTLSVNKHRAQHEAFVRF-EGSSSKNA-DLNSDILISGGKLRNRAIHGDLVAVELLPRGEWKGRTTALT------------EEQGEEKTGEDAQSQPMPSGRVVGILQRNWRDYVVTFPPREELQSQSRNSQKILAVPWDYRIPKIRISTQQAEALQDHRVIVRVDSWDSTSLYPNGHTVRVLGKAGELETEIQTILIENSIHVPAFSEAQLREMPVNSADQPWQMDGAEVSSRRDLRDTHLVFSIDPLGCEDVDDTLSVQTLPGGKRLELGVHIADVTHFVKEGSLTDLEARSRATTYYLADRRYDMLPTVLSADLCSLLGGVDRYAMSVLWELDAESLEVCKVWYGRTLIRSSYQLHYELAQSLLNGE------EAEVPELAQLESS--EQGQKLAELLQALETLTRMARHLRAQRDKGGALELEGVEVRAQLD--EDKNIAALVPKQPLEVHETVAECMIYANHWVARKIQESFPHQALLRHHPPPRQEFFNQLIDCAKTRGFTIDTRSNKTLADSLDHAVDPLDPLVNRLMRVMATQAMSNALYFSTGSCPEEQYYHYGLALDRYTHFTSPIRRYADIIVHRLLMAAIQSEKQEGLHKTLASNKELEELAHQINNKNRAAQHAQKQSVELFQCLYFRDKDPLTDERCVADAVIYTIRANGMLVFIPRYGLKGAVYLKNREGQVVSVR------------------DDGSCEWQVGTLQRYPDRIST--STSRGTHTFHLFDHVTVRISVEPSRCHSDAVHLELINNKPHQAVRSGEAQ---PAG 980          
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:103029381])

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 425/1052 (40.40%), Postives = 620/1052 (58.94%), Query Frame = 3
Query:   81 IFDVNSLRKIKTSQAQGKLKIVSRYL--QNIPCKVN-CTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLN--VEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQ----EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETI-DSSSTKTPTGRVVGISRRNWRDYVCSFE-----KSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGN-LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPD-IEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEE----SLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQ-----LRSGKQNAKLPTG 3149
            +F    +  +K+S+  GK+++V  +   + + C    C   C  D DG  +S DV++YV+ D   + +F EVLE  +  G + T +  +   +   RR Y +L+ L +DP    +LF NEF Q  +  +++ E    + TR  + A+ +Y +HL     VV +T + D A+ +YS          SLN  V +++ +EYL  +  D  +  EL  S+  A            QE   +A +    E+L  EVL   + SG +++G + VNK +++ EA V   EG+S+K    L+S++LI G   RNRAI GD V + +LP  +W  +   ++             EQ E +T  D+ S   P+GRVVGI +RNWRDYV +F      +S   + Q +L  P+D RIP IRI    A+ L +HR IVR+D W  +S YPNGH V  +G  G+LETE +T+LIE +++   F+ +QL E+P+N+ + PW+M+  EVS RRDLR+  L+FSIDP+GC+DVDDTLS++ L  G  LELGVHIADVTHFVK  SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL  + +EV  V Y R++IRSSY+LHYELAQ + + +         +PELA    +  +  ++  +L  A+  L  ++  L+++R + G LELEG+EV+ +    E   +  L  K+PLEVHET+AECMI+ANHWVA+K  E++P ++ LRHHP PR + F +LI CA T+GFTI+  SN  LA SLD AVD  D   N+++R +AT AMSNA YFSTG    E YYHYGLAL  YTHFTSPIRRYADI+VHR+L+ +I+   +E    +L +N  L +  + +NN++R AQ  Q+ S+ELFQ ++FR+K    D     + VI  +R+NG +V IPRYG+KG+V+L+ ++  +  ++                   D     +    Q+  ++I+   + ++   T+ LFD V +RI    S  H  ++ LE +       +RSG+     P G
Sbjct:    2 MFKTEKVLHLKSSRG-GKVRVVREHYVRERVSCGCAVCEAGC--DRDGKLLSGDVTHYVVPDAVVVRDFLEVLEFRELQGIVFTQTACQAAHHARGRRHYNRLRGLLKDPRHDCVLFANEFQQYSYCPREKGETQEKWHTRCVYHAAVWYYNHLAGLKPVVMITEDQD-AVKEYS----------SLNSGVYVISTREYLETFWPDLQAAQELYTSISQAL-----------QERESEATEKEYTEHLPAEVLEAGIKSGRYIQGTLSVNKHRAQHEAFVRF-EGSSSKNA-DLNSDILISGGKLRNRAIHGDLVAVELLPRGEWKGRTTALT------------EEQGEEKTGEDAQSQPMPSGRVVGILQRNWRDYVVTFPPREELQSQSRNSQKILAVPWDYRIPKIRISTQQAEALQDHRVIVRVDSWDSTSLYPNGHTVRVLGKAGELETEIQTILIENSIHVPAFSEAQLREMPVNSADQPWQMDGAEVSSRRDLRDTHLVFSIDPLGCEDVDDTLSVQTLPGGKRLELGVHIADVTHFVKEGSLTDLEARSRATTYYLADRRYDMLPTVLSADLCSLLGGVDRYAMSVLWELDAESLEVCKVWYGRTLIRSSYQLHYELAQSLLNGE------EAEVPELAQLESS--EQGQKLAELLQALETLTRMARHLRAQRDKGGALELEGVEVRAQLD--EDKNIAALVPKQPLEVHETVAECMIYANHWVARKIQESFPHQALLRHHPPPRQEFFNQLIDCAKTRGFTIDTRSNKTLADSLDHAVDPLDPLVNRLMRVMATQAMSNALYFSTGSCPEEQYYHYGLALDRYTHFTSPIRRYADIIVHRLLMAAIQSEKQEGLHKTLASNKELEELAHQINNKNRAAQHAQKQSVELFQCLYFRDKDPLTDERCVADAVIYTIRANGMLVFIPRYGLKGAVYLKNREGQVVSVR------------------DDGSCEWQVGTLQRYPDRIST--STSRGTHTFHLFDHVTVRISVEPSRCHSDAVHLELINNKPHQAVRSGEAQ---PAG 981          
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Match: dis3 (DIS3 exosome endoribonuclease and 3'-5' exoribonuclease [Source:ZFIN;Acc:ZDB-GENE-080213-3])

HSP 1 Score: 476.093 bits (1224), Expect = 1.307e-151
Identity = 321/940 (34.15%), Postives = 479/940 (50.96%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSPDVS-------NYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDC---IKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRD---EATVVL-SEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQ-DIYDSKI--DFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG---VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDK 2855
            +K +++ G LKIV   YL++ I C      +C      L   P +        +Y++ DT  +++  ++LE  L+ N+  II  + ++ +++ +  +Y ++K    D  K    F NE H+E FI +++ E   +   R                  VV LT +             +A  + +    ++  +     Y K      ELVD L  A D    I  S    P+ L +  +Q           + SG FL+G  R     SRD   EATV +  +G  +       +EVL+QG  N NRA+  D V + + P+ +W+     +   +   +      +  +  T+  +S   PTGRVVGI +RNWR +     +S +      L TP DRRIP IRI    A  L+  R IV IDGWP +SRYPNGHFV ++G  GD +TET  LL+E+++ ++PF+ + L+ LP    + PW +  E++  R DLR L + S+DP GC D+DD L  R L NGNLE+GVHIADV+HF++P + LD EA  R T++Y+  +R DM+P +LS +LCSL S+V+R A S +WE+  + E+++  + +S+I S   L Y  AQ  I D+ +  D  TSL  + +LA                            ILK++RIE G L L   EV+    D E     DL  KE  E +  + E M+ AN  VA+K  + +   + LR HPSP   ++  LI  A ++   I+  S   LA SL+ A        N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRY+DI+VHR+L  +I      P+  L+     A  CN +N +H+ AQ  QRAS+     +FF+N+         EG I+ +R N  ++ IP++G++G+VF   +DK
Sbjct:    8 VKKTRSGGVLKIVREHYLRDDIWCGSEVCVECGDGAPVLLRDPRIESDLCTYPHYLLPDTNVVLHQIDILEDPLIRNV--IILQTVLQEVRHRSAPVYKRIKDAIHDKEKHFYTFTNEHHRETFIEREQGESANDRNDRAIL--------------KVVLLTND-------------QANKEKAEQSGLLAYR--CEEYIKSLIGNPELVDRLALASDDQNDITGSKLLFPEHLPLSRIQA---------GIKSGTFLQGTFRA----SRDNYLEATVFIHGDGEDS-------TEVLLQGLQNLNRAVHQDLVAIELFPKERWVAPSSVVLQDDRPNDEDAEEEDAEKKSTVSDTSVLKPTGRVVGIIKRNWRPFCGMLNQSQIKEATRHLFTPADRRIPRIRIETRQASTLVGQRIIVAIDGWPRNSRYPNGHFVRNLGGAGDKDTETEVLLLEHDVPHQPFSQTVLSFLP----KMPWGITEEDLKVRTDLRHLCVCSVDPPGCTDIDDALHCRDLENGNLEVGVHIADVSHFIRPGNALDQEAANRGTTVYLCGKRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHNAEILNTRFCKSIINSKASLTYAEAQMRIDDAGMNDDITTSLRGLNKLA---------------------------KILKAQRIEKGALTLSSPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAQKIYDEFSECALLRKHPSPPPSNYDILIKAAKSRDLDIHTDSAKALADSLNEATLEDFPYFNTLLRILATRCMMQAVYFCSGM--DSDFHHYGLASPIYTHFTSPIRRYSDIIVHRLLAVAISADSTYPD--LMDKHKQASLCNNLNYRHKMAQYAQRASVAFHTQLFFKNRG----ILNEEGFILFVRKNAIIILIPKFGLEGTVFFENKDK 856          
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Match: dis3l2 (DIS3 like 3'-5' exoribonuclease 2 [Source:ZFIN;Acc:ZDB-GENE-070705-171])

HSP 1 Score: 284.263 bits (726), Expect = 2.906e-81
Identity = 207/725 (28.55%), Postives = 341/725 (47.03%), Query Frame = 3
Query:  780 MQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQW-INKKLEISGSEASAELALPVAEQ---AENETIDSSSTKTPTG----RVVGIS-----RRNWRDYVCSFEKSDLNSG--------QYVLVTPYDRRIPMIRIGITSADKLINHR--------FIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQ--DMETNKILRSLATMAMSNAQYFSTGMLKAEDYY-HYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNS--SLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQD 2852
             ++Y++   ++  +  G+ ++G +R+N  K   EA +   +G++         ++ + G   RNRA++GD VV+ +LP   W +    +   + A    A P       + +  +++  +   TG    +V  +S      RN   Y+   + S   SG         + + +P D R+P + + +T        R        FI RI  WP  + +  G  ++S+G  G++E ET  +L EY++    F  + LA LP N    PW + PEE++KRRDLR+  IF+IDP   +D+DD LS R+L++GN E+GVHIADV++FV+  + LD  A +R+TS+Y+  +   MLP +L  +LCSL    DR   SV+W L+P+ +++S  + RSVIRS  KL Y+ AQ +  S  D   S   +P  +  H          Q ++ +V  L +++  L+S+R + G L L+                                   +  N WV+K                           +  +      +    + + +SL+  V N    +   ++L  L +  M  A YF  G+L+ E  + HY L +P YTHFTSPIRRY DILVHR+L  S++  P  SL       LA  C   N++   ++ VQ  S ELF ++F R     D    +E +++ +    F V + +YG++  ++    D
Sbjct:  141 FEDYMNLRDVSAGLKRGELIQGPLRINP-KKYQEAFIPSPDGSA---------DIFLDGIVARNRALNGDVVVVKLLPPEFWKVGNGEDREQTPAGRAPAGPGGSGNPCSPDVMVEAHYSGDETGELIRKVQSVSLQDKGTRNSVVYIVEEKHSRAASGFIKFLPDKHFAMFSPVDHRVPRVNVPLTDCPADFPSRPADYANTLFICRITHWPYDNTFAEGRLMKSLGQAGEIEPETEAILTEYDVDFSEFEEAALACLPQNL---PWSIPPEELAKRRDLRKECIFTIDPATARDLDDALSCRQLSDGNFEVGVHIADVSYFVEEGTALDSVASRRATSVYLVQKVIPMLPRLLCEELCSLNPQTDRLTFSVIWTLSPEGKILSEWFGRSVIRSCIKLSYDHAQSMIQSP-DKHFSSEELPPCSPDHPV--------QLIQESVLHLHSLAQHLRSQRFQGGALRLD----------------------------------QVTQNTWVSK--------------------------FNAKSVSKLLTSIYVCVRVQRSLNETVGNDRYSLARKEVLTHLCSRPMQMAVYFCAGVLQDEKLFRHYALNVPLYTHFTSPIRRYPDILVHRLLAASLKCGPRLSLSDEEVHKLASHC---NDKKTASKRVQEMSAELFFSVFVRECGPLD----SEAMVMGMLDKSFDVLVLQYGVQKRIYCNAID 776          
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Match: ENSAMXT00000053188.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001127.1:243703:259194:-1 gene:ENSAMXG00000042551.1 transcript:ENSAMXT00000053188.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 1.011e-34
Identity = 96/288 (33.33%), Postives = 141/288 (48.96%), Query Frame = 3
Query: 1989 DGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQD 2852
            D A     +  ++  L  ++ ILK++RI+   L L   EV+    D E     DL  KE  E +  + E M+  N  V +K                   D F E    A ++   I   S   LA SL+ A        N +LR LAT  M  A YF +GM    D++HYGLA P +THFTSPIRRY+DI+VHR+L  +I          +S+  D  +  N +H+ AQ  QRAS+     +FF+N+   +     EG I+ +R N  ++ IP++G++G+VF   +D
Sbjct:   60 DDASMNDDITESLQGLNKLAKILKAQRIKKRALTLSSPEVRFHM-DSETHNPIDLQTKELKETNSMVEEFMLLVNISVTQKIY-----------------DEFSE---SAKSRDLDIRTDSAKALADSLNEATLEDFPYFNTLLRILATRCMMQAVYFCSGM--DSDFHHYGLASPIFTHFTSPIRRYSDIIVHRLLAVAINA--------DSTYPDLMDKHNYRHKMAQYAQRASVAFHTQLFFKNRGILN----EEGFILFVRKNATIILIPKFGLEGTVFFENKD 312          
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:560362])

HSP 1 Score: 733.021 bits (1891), Expect = 0.000e+0
Identity = 421/995 (42.31%), Postives = 592/995 (59.50%), Query Frame = 3
Query:  159 QNIPCKVN-CTYDCNKDFDGLKV-SPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQY-----VLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDI-EVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGA--ERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE--GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTE-GVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLE 3098
            Q++ C    C   C++   G K+   ++++Y++     +  F E+LEL +  G + T ++   +Q+   RR Y +L+ L +D  K  ++F NEF +  +  ++  E    + TR  + A+ +Y  HL  Q  +V LT + +         +R+ G  T   V +M   +YL N+  D     EL  S+       K+   +  +E       E+LS EVL   + S  ++KGI+ VNK +++ EA V     +S +    L S+VL+ G   RNRA+ GD VV+ +LP ++W  +   +SG + + E A         E     +   PTGRVVGI +RNWRDYV +F   D   GQ      VLV P+D R+P IRI    +  L ++R +VRID W  +S+YPNGHFV  +G  G+LETE   LL+E  +   PF+ +QL E+P+++ E PW+M+ EEV++R DLR   LIFS+DP GC+DVDD LS++ +A GNLELGVHIADVTHF++PHS  DLEAR R+T+ Y+ADRRFDMLP VLSG+LCSL   VDRYAVSV WEL  D  EV  V Y R+VIRSSYKL YE AQ + D     +     IPEL     AF DG   ER ++L  A+  L +V+  +++RR E GGLELE +EV+V+ S+  R  + DL  ++PLEVHET+AECMI ANHWVA++  +  P R+ LRHHP PR + F EL  CA   GF I+ SSN  LA+SLD AVD  D   NK+LRS+A  AMSNA YFSTG L A+ +YHYGLAL  YTHFTSPIRRYAD++VHR LL  +E  G PE + L N+ L + C  +N ++R AQ VQ+ SIELFQ++FFR+K  +   R  E G++  LR++G +VH+PRYG+KG+ +L+ +D  +  +                   +D+       C  +  N IT   +  ++  T +LFD + +RI      +H  +++LE
Sbjct:   29 QDVACSSALCLAQCDR---GPKLLGANLTHYLVPGCTVVQEFLEILELPELQGLVFTQTSCNALQHAKGRRHYNRLRSLLKDMRKECVMFANEFQRFAYCAREPGETPEAWKTRSVYQAAVWYYDHLVGQIPIVMLTEDPE--------DVRRYGAATP-GVFVMLFLDYLQNFWPDVQMAHELYASIHQMLQESKSQGLSSKREF-----PEHLSQEVLEAGIKSSRYIKGILSVNKHRAQLEAFVRCQVSDSKQ--AELQSDVLVPGVKARNRAVHGDMVVVELLPRAEWHGRATGLSGGDGTDERA--------EEEAAPKTEPMPTGRVVGILQRNWRDYVATFPSVDEMMGQSAKSQKVLVVPWDFRVPKIRISTNQSQALQDYRVVVRIDSWEATSQYPNGHFVRVLGRAGELETEVAALLVENAISVLPFSEAQLREMPVDSPETPWRMDGEEVARRCDLRSSHLIFSVDPPGCEDVDDALSVKTVAGGNLELGVHIADVTHFLRPHSHTDLEARVRATTYYLADRRFDMLPSVLSGNLCSLLGGVDRYAVSVRWELDGDTYEVKRVWYGRTVIRSSYKLSYETAQALLDGGAAAQGVT--IPEL----DAFDDGTRQERLRELVWALGRLTDVARAMRARRTEEGGLELESVEVRVQMSE-SRDSIADLVPQQPLEVHETVAECMIAANHWVARRVAQALPGRALLRHHPPPRHEFFEELKACAAAMGFHIDTSSNKALAESLDNAVDPNDPLINKMLRSMAVHAMSNALYFSTGSLPADQHYHYGLALDHYTHFTSPIRRYADVMVHRQLLAVLEAKGAPETTPL-NTELQELCEHINERNRAAQQVQKESIELFQSLFFRDKDPEQDDRCVEDGIVYSLRADGVLVHVPRYGLKGAAYLKNKDGLVVSVG------------------TDDVCEFVPGCITRGKNHITTQPSVGRS-LTVRLFDHLMVRIYVQSRRAHADTIRLE 969          
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003075.1 (pep scaffold:Pmarinus_7.0:GL481740:815:17708:1 gene:ENSPMAG00000002800.1 transcript:ENSPMAT00000003075.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 251.906 bits (642), Expect = 1.497e-72
Identity = 200/652 (30.67%), Postives = 305/652 (46.78%), Query Frame = 3
Query:  939 EVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGW---PLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPE-EVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLP--HVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRS---VIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLD-LAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQ----CNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQD 2852
            +VLIQG  + NRA+  D V + + PE + +     +   E    +A  VAE+ E + +  +ST  P GR   +        VC   ++ LN    +   P    +  +     S      H   V++  W   P+  R P+ H V      GD E ET  LL+E+N+ ++PF+ + LA LP  T    + +  E + + R DLR L I S+DP GC D+DD L  + L NGN E+GVHIADV++F++P + LD EA  R T++Y+ ++  +     H +   L +   + D   ++  W       +    +F     ++     L Y  AQ + D                         A R   + S++  L +++ ILK RRI+ G L L   EV+    D E     DL  KE  E +  + E M+ AN  VA++ +  +P  + LR HP+P   ++  L+    +K   I   S   LA+SLD  AV       N +LR LAT  M  A YF +GM    D +HYGLA   YTHFTSPIRRY   L++                +  S   +    CN +N +H+ AQ  Q +S+     +FF++K         EG ++ +R N  +V IP+YG++G+VF   +D
Sbjct:    2 QVLIQGLQHLNRAMHDDIVCVEMFPEERCVAPSSLVLHDEG---VAGDVAEENEEDVVSGAST-LPAGRTHPV--------VC---RTSLNRCVLLQFGPLPWTVNALNKSTDSTALKSRH---VQMTLWCHVPVVYRLPS-HNVSDTCDCGDKEMETEVLLLEHNVPHQPFSQAVLACLPPPT----FSITAEKDQAGREDLRALSICSVDPPGCTDIDDALHCKPLDNGNTEVGVHIADVSYFIRPGNALDEEASLRGTTVYLCEKNINCFTTRHFILSFLTTSRMNNDNLILAWAWIRRGHCVIARTPWFTRGVFIVSPQASLTYAEAQLMMDD------------------------AGRKDPVTSSLCGLNSLAKILKQRRIQNGALILASPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAERIVGEFPECALLRRHPAPPPSNYDILVKAVKSKNIEIQVDSAKALAESLDRAAVPGAPPYLNTLLRILATRCMMQAIYFCSGM--EPDTHHYGLATAIYTHFTSPIRRYIFFLLN---------------FSKRSYKQKQQQLCNNLNYRHKMAQYAQCSSVAFHTPLFFKSKG----VVSEEGFVLFVRKNAVLVLIPKYGLEGTVFFDSKD 584          
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010010.1 (pep scaffold:Pmarinus_7.0:GL476399:1754172:1773464:-1 gene:ENSPMAG00000009046.1 transcript:ENSPMAT00000010010.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 244.973 bits (624), Expect = 2.981e-69
Identity = 208/708 (29.38%), Postives = 323/708 (45.62%), Query Frame = 3
Query:  786 EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIP--MIRIGITSADKLINHRFIVRIDGWPLSSRYPNG---------HFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPE-EVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKL----HYELAQDIYDSKIDFETSLGLIPELA---SKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQD 2852
            E+L    L + V SG F++G    ++    +    V  +G+S K       EVLIQG  + NRA+  D V + + PE +W+     +   E  A        +   E + S ++  P  R++                         +  P D R+   +IR       + +   ++ R   WP + + P            +    G  GD ETET  LL+E+++ ++PF+ + LA LP  T    + +  E + + R DLR L I S+DP GC D+DD L  + L NGN E+GVHIADV++F++P + LD EA  R T++Y+ ++       V  G L +  S V          L P       D+  S +  ++      H  +A+  + ++  F  S    P+ +   ++ +   D A R   + S++  L +++ ILK RRI+ G L L   EV+    D E     DL  KE  E +  + E M+ AN  VA++ ++ +P  + LR HP+P   ++  L+  A +K   I   S   LA+SLD A    D         LAT  +  A YF +GM    D +HYGLA   YTHFTSPIRR+                 E  L         CN +N +H+ AQ  QR+S+     +FF++K         EG ++  R N  VV IP+YG++G+VF   +D
Sbjct:   34 EHLPLSQLQQGVRSGRFVQGTFLASRENYLEGTLRVRGDGDSDK-------EVLIQGLHHLNRAMHDDIVCVEMFPEERWVAPSSLVLHDEGVAW----DVVEENEEDVVSGASTLPNQRII-----------------------IKIKAPEDDRLSFNLIRTQEIRTRRFLGLSWVTR---WPQTLQTPRELCAVWVPMYRWNRDTGECGDKETETEVLLLEHDVPHQPFSQAVLACLPPPT----FSITAEKDQAGREDLRALSICSVDPPGCTDIDDALHCKPLDNGNTEVGVHIADVSYFIRPGNALDEEASLRGTTVYLCEK-------VRCGFLLATISSV----------LQP------ADFILSFLTLAWAWIRHGHCVIARTPWFTRGVFIVS----PQASLTYTEAQLMMDDAGRKDPVTSSLRGLNSLAKILKQRRIQNGALTLASPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAERIVDEFPECALLRRHPAPPPSNYDILVKAAKSKNIEIQVDSAKALAESLDRAAVPGDRSAC----ILATRCVMQAIYFCSGM--EPDTHHYGLATAIYTHFTSPIRRHTR---------------EIDLSFFYKQQQLCNNLNYRHKMAQYAQRSSVAFHTQLFFKSKG----VVSEEGFVLFARKNPVVVLIPKYGLEGTVFFDSKD 647          
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003587.1 (pep scaffold:Pmarinus_7.0:GL477460:238964:260573:-1 gene:ENSPMAG00000003271.1 transcript:ENSPMAT00000003587.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 243.432 bits (620), Expect = 1.081e-68
Identity = 215/693 (31.02%), Postives = 318/693 (45.89%), Query Frame = 3
Query:  786 EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSST-KTPTGRVVGISRRNWRDYVCSFEKSDLNSGQ-YVLVTPYDRRIPMIR-IGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGV-IGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPE-EVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRS-------SYKLHYELAQDIYDSKIDFETSLG-LIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLD-LAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGI 2822
            E+L    L + V SG F++G    ++    +    V  +G+S K       EVLIQG  + NRA+  D V + + PE  W+     +   E    +A  VAE+ E + +  +ST    TG  VGI RR  R    S       S + Y+   P  R     R  G      +++ R   R       S     H     G+  GD ETET  LL+E+++ ++PF+ + LA LP  T    + +  E + + R DLR L I S+DP GC D+DD L  + L NGN E+GVHIADV++F++P + LD EA  R T++Y+ ++       V  G L +  S   R A  +   LT     ++ D  + ++         SY + + +   +  S+I   T +   +  L  +      G +             N S    +RR     L L   EV+    D E     DL  KE  E +  + E M+ AN  VA++ ++ +P  + LR HP+P   ++  L+  A +K   I   S   LA+SLD  AV       N +LR LAT  M  A YF +GM    D +HYGLA   YTHFTSPIRR+                 E  LL+       CN +N +H+ AQ  QR+S+     +FF++K         EG ++ +R N  VV IP+YG+
Sbjct:   17 EHLPLSQLQQGVRSGRFVQGTFLASRENYLEGTLRVRGDGDSDK-------EVLIQGLHHLNRAMHDDIVCVEMFPEECWVAPSSLVLHDEG---VAWDVAEENEEDVVSGASTLPNQTGWNVGIRRRRQRCCCWSTTCHTSPSARPYLHACPLPRSASQQRSTGGAQLALILSQRHFER-------SALSGFHCTSGKGIPCGDKETETEVLLLEHDMPHQPFSQAVLACLPPPT----FSITAEKDQAGREDLRALSICSVDPPGCTDIDDALHCKPLDNGNTEVGVHIADVSYFIRPGNALDEEASLRGTTVYLCEK-------VRCGFLLATISSFLRPADFIFSFLTFSTSRMNNDNLKDILNELIFADFLSYDVPFAIC--VPRSRISLSTQISEFVKCLILRFCVVLAGHD-------------NRSCPFSTRR----ALTLASPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAERIVDEFPECALLRRHPAPPPSNYDILVKAAKSKNIEIQVDSAKALAESLDRAAVPGAPPYLNTLLRILATCCMMQAIYFCSGM--EPDTHHYGLATAIYTHFTSPIRRHTR---------------EIDLLSFYKQQQLCNNLNYRHKMAQYAQRSSVAFHTQLFFKSKG----VVSKEGFVLFVRKNAVVVLIPKYGL 640          
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010014.1 (pep scaffold:Pmarinus_7.0:GL476399:1754172:1773116:-1 gene:ENSPMAG00000009046.1 transcript:ENSPMAT00000010014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.276 bits (617), Expect = 2.097e-68
Identity = 206/697 (29.56%), Postives = 330/697 (47.35%), Query Frame = 3
Query:  786 EYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPE-EVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKL----HYELAQDIYDSKIDFETSLGLIPELA---SKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQD 2852
            E+L    L + V SG F++G    ++    +    V  +G+S K       EVLIQG  + NRA+  D V + + PE +W+     +   E  A        +   E + S ++  P  R++   + + R         ++ + +++ ++ +  R P+I+        L   R +  +  W      P   +    G  GD ETET  LL+E+++ ++PF+ + LA LP  T    + +  E + + R DLR L I S+DP GC D+DD L  + L NGN E+GVHIADV++F++P + LD EA  R T++Y+ ++       V  G L +  S V          L P       D+  S +  ++      H  +A+  + ++  F  S    P+ +   ++ +   D A R   + S++  L +++ ILK RRI+ G L L   EV+    D E     DL  KE  E +  + E M+ AN  VA++ ++ +P  + LR HP+P   ++  L+  A +K   I   S   LA+SLD A     +  +  +  LAT  +  A YF +GM    D +HYGLA   YTHFTSPIRR+                 E  L         CN +N +H+ AQ  QR+S+     +FF++K         EG ++  R N  VV IP+YG++G+VF   +D
Sbjct:   11 EHLPLSQLQQGVRSGRFVQGTFLASRENYLEGTLRVRGDGDSDK-------EVLIQGLHHLNRAMHDDIVCVEMFPEERWVAPSSLVLHDEGVAW----DVVEENEEDVVSGASTLPNQRIIIKIKEDDRLSFNLIRTQEIRTRRFLGLS-WVTRWPLIK-------TLQTPRELCAV--W-----VPMYRWNRDTGDCGDKETETEVLLLEHDVPHQPFSQAVLACLPPPT----FSITAEKDQAGREDLRALSICSVDPPGCTDIDDALHCKPLDNGNTEVGVHIADVSYFIRPGNALDEEASLRGTTVYLCEK-------VRCGFLLATISSV----------LQP------ADFILSFLTLAWAWIRHGHCVIARTPWFTRGVFIVS----PQASLTYTEAQLMMDDAGRKDPVTSSLRGLNSLAKILKQRRIQNGALTLASPEVRFHM-DSETHDPIDLQTKELKETNSMVEEFMLLANISVAERIVDEFPECALLRRHPAPPPSNYDILVKAAKSKNIEIQVDSAKALAESLDRAA----VPGSACI--LATRCVMQAIYFCSGM--EPDTHHYGLATAIYTHFTSPIRRHTR---------------EIDLSFFYKQQQLCNNLNYRHKMAQYAQRSSVAFHTQLFFKSKG----VVSEEGFVLFARKNPVVVLIPKYGLEGTVFFDSKD 622          
BLAST of Dis3 exonuclease 1 vs. Ensembl Yeast
Match: DIS3 (Exosome core complex catalytic subunit; has both endonuclease and 3'-5' exonuclease activity; involved in 3'-5' RNA processing and degradation in both the nucleus and the cytoplasm; role in degradation of tRNAs; similar to E. coli RNase R and to human DIS3, which partially complements dis3-81 heat sensitivity; mutations in Dis3p analogous to human mutations implicated in multiple myeloma impair exosome function; protein abundance increases under to DNA replication stress [Source:SGD;Acc:S000005381])

HSP 1 Score: 434.876 bits (1117), Expect = 1.161e-135
Identity = 307/925 (33.19%), Postives = 465/925 (50.27%), Query Frame = 3
Query:  225 SPDVSNYVIVDTEYLMNFSEVLELLDN----IGFIITLSTMRYIQNYNRRLYYKLKKLFEDP--AKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLN-YQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMAL---HSEVLIQGQFNRNRAIDGDCVVLMILPESQW--------------INKKLEISG------SEASAELALPVAEQ----AENETIDSSSTKT-PTGRVVGISRRNWRDYVCSFEKSDLN----SGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKM-----NPEEVSK------RRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIH--CATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQ-CNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFL 2840
            +P   +YV++DT  ++   + ++LL+N       I+    +  ++N +  +Y +L+ L  D    K  I+F NEF +  F+ +  +E   +   R      Q+Y  HL  Y   VV +T +            R+A    +  VE   I + LV Y       +EL+ + +   D I   D+   ++L  D   ++   E  + +   G    G++         +  + +SE N  +  ++L      VLI GQ N NRA +GD V++ +LP+S+W              +N   +I        +E+S+   +   +Q    A++  I   S K  PT +VV I RR+WR YV     S ++    S Q V V   D+ +P +RI    A +L++ R ++ ID WP + +YP GHFV  +G I   + ET  LL+E+++  RPF+   L  LP    +  WK      +PE VSK      R+DLR+ LI SIDP GC D+DD L  +KL NGN E+GVHIADVTHFVKP + LD E   R TS+Y+ D+R DMLP +L  DLCSL   VDR+A SV+WEL     +V+V++ +SVIRS     YE AQ   D K   +                        +L   +  L+ +S  LK +R+EAG L L   EV+V   D E +   ++  K+ L  +  + E M+ AN  VA+K  + +P  + LR H +P   +F E+++    T K  +I+  S+  LA SLD  VD +D   N ++R ++T  M  AQYF +G     D+ HYGLA+  YTHFTSPIRRY D++ HR L  +I   P      + +  D  C  +N +HR AQ   RASIE +     RN    +      G ++K+ +NG VV +P++G++G + L
Sbjct:   81 APIGKHYVVLDTNVVL---QAIDLLENPNCFFDVIVPQIVLDEVRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQWYSEHLKPYDINVVLVTND---------RLNREAA---TKEVESNIITKSLVQY-------IELLPNADDIRDSIPQMDS-FDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLY--------QGNIQISEYNFLEGSVSLPRFSKPVLIVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSSNTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQNVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYRPFSKKVLECLPAEGHD--WKAPTKLDDPEAVSKDPLLTKRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLRIDDKTQND------------------------ELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHM-DSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNF-EILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTET-----GYVIKVFNNGIVVLVPKFGVEGLIRL 941          
BLAST of Dis3 exonuclease 1 vs. Ensembl Yeast
Match: SSD1 (Translational repressor with a role in polar growth and wall integrity; regulated by Cbk1p phosphorylation to effect bud-specific translational control and localization of specific mRNAs; interacts with TOR pathway components; contains a functional N-terminal nuclear localization sequence and nucleocytoplasmic shuttling appears to be critical to Ssd1p function [Source:SGD;Acc:S000002701])

HSP 1 Score: 142.124 bits (357), Expect = 1.410e-34
Identity = 154/558 (27.60%), Postives = 239/558 (42.83%), Query Frame = 3
Query: 1236 PYDRRIPMIRIG--------ITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENP----WKMNPEEVSKRR---DLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKS---RRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSP---RMDHFVELIHCATTKGFTINFSSNL--ELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVP-EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSV 2834
            P D+++P+I I         + +ADK     F+  I  WP++S +P G  V  +G I D +TE  ++L + N     F +++  +     KE P      +  E +  RR   D  E  IF+I  +G    +  L +R   NG LELG H+ DVT  ++  S +D  ARKRS++++M  +  ++LP   + +L SL    +   +SVV+ L +  + + S     S I  S  L  E        ++D + S G                       S  + L  V  I +S   RRI      L      ++  D E+ K+ DL+  +       I E     N  VA+K        + LR    P   +M  F + I     + F  NF +N   EL K + L + + D+     +  L    M  A+YF  G +  + Y HY L LP YTHFT+P+RRYAD +VHR L   I   P  E +      ++ CN   +   QA   Q  +I L       +         T   ++++  + F V IP +GI+  V
Sbjct:  586 PTDKKVPLIAIPTELAPKDFVENADKYSEKLFVASIKRWPITSLHPFGILVSELGDIHDPDTEIDSILRDNN-----FLSNEYLDQKNPQKEKPSFQPLPLTAESLEYRRNFTDTNEYNIFAISELGWVS-EFALHVRNNGNGTLELGCHVVDVTSHIEEGSSVDRRARKRSSAVFMPQKLVNLLPQSFNDEL-SLAPGKESATLSVVYTLDSSTLRIKSTWVGESTISPSNILSLE--------QLDEKLSTG-----------------------SPTSYLSTVQEIARSFYARRINDPEATLLPTLSLLESLDDEKVKV-DLNILDRTLGFVVINEIKRKVNSTVAEKIYTKLGDLALLRRQMQPIATKMASFRKKI-----QNFGYNFDTNTADELIKGV-LKIKDDDVRVG--IEILLFKTMPRARYFIAGKVDPDQYGHYALNLPIYTHFTAPMRRYADHVVHRQLKAVIHDTPYTEDMEALKITSEYCNFKKDCAYQA---QEQAIHLLLCKTINDMGNTTGQLLTMATVLQVYESSFDVFIPEFGIEKRV 1093          
BLAST of Dis3 exonuclease 1 vs. Ensembl Nematostella
Match: EDO40307 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7H2])

HSP 1 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 403/1040 (38.75%), Postives = 601/1040 (57.79%), Query Frame = 3
Query:   81 IFDVNSLRKIKTSQAQGKLKIVSRYLQ-NIPCKVNCTYDC--NKDFDGL-KVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNY-NRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVV---LSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQY-----VLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEV-YQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVG-QLRSGKQNAKLPTGD 3152
            +   N L ++KT +++    +   YL+ +I C  +   +C  N    GL  +S D+++YV+ D E    + E+ E  +  G I   +   ++Q+  +R+L  +LK L +D  +    F NEF +  ++ ++  E   ++  R  +    +Y  HL+ +  +V +T + +V + +Y+          ++ V +M++ +Y+  ++    S  EL +SL  A   I  +D+N   +   +   EYL  +VL   + SG ++KG + VNK  S+ EA +    +S G  T +     S+VLI G  NRNRA+ GD VV+ +LP+SQW  +   +   E  AE +             +SS    TG VVG+ +RNWRDYV SF +  ++  Q      V+V P+D RIP IRI     + L + R+++RID W + S YP+GHFV ++G+IGDLETE  TL++E+ L   PFT  QL ELP ++   PW ++ EEV +RRDLR+  L+FSIDP GC+DVDDTLSIR+L +G LELGVHIADVTHFV P SL D EAR RSTS+Y+ADRR+DMLP +LS +LCSL S VDR A+SV+W L  + +V+   Y R++IRSSYKL YE+AQ I D  +  E  L  IPEL     +  +     Q ++ +V  L++++   K+RR   G +EL+  EV+V  +  E+  + DL  K+ LE+HETI ECMI ANHWVAK+ ++ +PT S LR HP PR  +F  L+ CA  KGFTI  SSN  LA+SLD   D  D   NK+LR LA  AMS+A YFSTG +  +++ HYGLAL  YTHFTSPIRRYAD++VHR+L+ ++    +  +L N  L +    MN++H+        S+ELFQ +FF + ++DD     + VIV LR+NG +V+IPRY  K +V+L+ ++  +        P +  + V +    +   E  +E      +               T+KLF+ V ++I  + S +H  SL++  V  Q R+G    +L +G+
Sbjct:    1 MLKTNKLLRLKTKRSRLVNVVREHYLRTDISCHSSLCQECKNNNTPTGLVSLSSDLTHYVVPDCEVSKLYLEIFEFPEIQGVIFFQTVKNHLQHSGSRKLLSRLKNLVKDTRQQCTFFSNEFCEGAYVPREAGESLQDWQARCTYAGVLWYYHHLHEKMPLVMVTSSEEV-IERYNG--------RTMGVFVMSMSDYISGFYPGLTSVHELFESLSTA---IAVADSNKSHKGHKEC-SEYLPLDVLEAGIKSGRYIKGNLNVNKHNSQTEAFIQKRDISSGQGTSE-----SDVLIYGVANRNRAVHGDVVVVEVLPKSQWKGRSTALKLHEEDAEDS------------GNSSDVMMTGHVVGVLQRNWRDYVVSFAEDVVSQDQRRSAGKVVVVPWDYRIPKIRISTRQVEALRDQRYVIRIDSWEVDSMYPSGHFVRALGLIGDLETEVATLMVEHTLSAPPFTDGQLKELPSDSPTEPWVISEEEVCRRRDLRKSHLVFSIDPKGCEDVDDTLSIRQLKDGRLELGVHIADVTHFVHPGSLTDAEARSRSTSVYLADRRYDMLPEILSANLCSLISGVDRLAMSVMWVLGSNYDVIKTWYGRTIIRSSYKLFYEVAQAIADGVVPNEDLLKEIPELQGLDSSAANKG--IQDIRWSVLKLMDIARYYKARRQTQGAVELDNPEVKVLLN--EKKDILDLIDKQGLEIHETIEECMILANHWVAKRLVQTFPTCSLLRRHPLPRQQYFENLMQCAKAKGFTIKTSSNKLLAESLDKCEDPDDPTFNKLLRILAVQAMSSALYFSTGSVSVDEFVHYGLALDRYTHFTSPIRRYADVIVHRLLMAALGSDDQSQVLNNEELEELAQHMNDKHKVGHTAA-GSVELFQTLFFNSMSEDDERLLADAVIVGLRANGLLVYIPRYCFKSAVYLKDKNGLVV------TPGAGKDCVTHGPGSIVRGEFAVELHTSSGVF--------------TFKLFNHVKVKISVATSRAHAQSLRVTLVSFQTRTGPPPGELNSGE 985          
BLAST of Dis3 exonuclease 1 vs. Ensembl Nematostella
Match: EDO42429 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B6])

HSP 1 Score: 298.13 bits (762), Expect = 3.571e-87
Identity = 221/717 (30.82%), Postives = 347/717 (48.40%), Query Frame = 3
Query:  783 QEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAE--------------QAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYV--LVTPYDRRIPMIRIG--------ITSADKLINHRFIVRIDGWP----LSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE-GVP-EESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLR 2843
            ++Y S E ++  +  G+ LKG +R++K   R+     +S     +       +V ++G   RNRA+DGD V L I P ++W   K E     AS E     ++              Q +NE I  +  +     V  I +++ R    + +    N G     L +P D R+P +RI                 +  F+ RI  WP    + + +  G    S+G  G++E ET+ +  EY +   PF    L  LP   KE PW +   E + RRD R+  +F+IDP+  +D+DD L  ++L++G +E+GVHIADV+ FVK  + LD  A++R+TS YM      MLP  L  +LCSL  D DR   SVVW +T   E+ S    R +IRS  K+ YE AQ++ D K + + S   +P +A       +G +  + +K  V +L  ++  L+  R E G L L+ +++Q    D E       H  +  E ++ I E M+ AN  VA    + +P  + LR HP P      +L+      G  I +++N   +  + LA        ++IL  L    M NA YF  G ++ E+Y HY L++P YTHFTSPIRRYAD++VHR+L  S+E   P ++  +   S+A  C   N+    A+     S ELF A+F R     +     +G ++ +    F V +P  G+   ++ +
Sbjct:   26 EKYWSLESVSDGLKRGELLKGALRISK---RNFEMAWVSVAGQKR-------DVYLEGVLARNRALDGDIVALNISPRNKWKLMKHEYDAHGASHEGNKTPSKGGTTPHTPESSKNKQRKNEEIPDAYLQQTAHVVYIIEKKHTRAASGNLKPFQYNQGDVPDGLFSPSDSRLPRMRIPHAKCPLGFFDRPQDFASTLFVGRITEWPENAPMDNFFATGEISRSLGEAGEIEPETQGIFFEYGIDPGPFPDEALDCLP---KETPWSIPETEFAHRRDFRDECVFTIDPLTARDLDDALHCKRLSDGLIEVGVHIADVSFFVKTGTPLDDIAQERATSTYMVQTVVPMLPRRLCEELCSLNPDEDRLTFSVVWIMTDQGEIKSDWKGRGIIRSRVKMAYEHAQEMID-KPNKKWSDSELPPIA-------EGTDVSEIVKR-VNLLAKIARQLRRNRFENGALRLDQVKLQFDL-DKETGMPIGYHVYQQRESNKLIEEFMLLANMTVAHHIYKAFPDMALLRRHPKPHEKQMEDLLELCRNLG--IKYNANSSKSIQVSLAQFPSGSAQHEILVQLTMKPMKNALYFCAGTVEEEEYGHYALSVPLYTHFTSPIRRYADVIVHRLLAASLELAEPLDKDAVDVDSIAGHC---NDCKLAAKTAGELSSELFFAIFVRECGPLE----EDGYVLGIMDMSFDVFVPALGVTKRIYCK 710          
BLAST of Dis3 exonuclease 1 vs. Ensembl Nematostella
Match: EDO45137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTS2])

HSP 1 Score: 111.309 bits (277), Expect = 1.361e-24
Identity = 176/759 (23.19%), Postives = 293/759 (38.60%), Query Frame = 3
Query:  783 QEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRR-NWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMI----------RIG----------------ITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRR---FDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSV-DYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTR--SCLRHHPSPRMDHFVELIHCATTKGFTINFSS---------------------NLELAKSLDLAVDNQDM--------ETNKILRSL-ATMAMSN----AQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIP--RYGIKGSVFLRKQD 2852
            +EYLSD      +     L  ++ +N        T  L++ N+         +VLI+ +   NRA  GD V + ++                                  DSS  + P G+VV I    + R Y+C  +  D N     ++TP +   P +          R G                +T A   +   F+V++  W  S RYP G   +    +  LET       +  L        QL    +      W +   E   R    E L  +ID     ++DD LS++  ANG + +GVH+ADV++F+   S  D  A  + TS Y  D      +MLP  L   LCSL     R A+SV++        + + +  RS++ S Y L ++    + + +                       +E  + +K  + +L ++S  L S R   G   L G+   V+ +   ++              + + + MIFAN  VA+K L++  T+  + LR   SP   H ++    A  +   +  SS                      ++L   +  A++ +D+        E +   R+L A   +S+    +QY  +  +    Y H+ L L  YTHFTSP+RRY DI+V R+L+  +  + EE   T   L   C+       QA   +R+      A    +  Q     +TE V+ ++  +   V +P   +  K S+ +R QD
Sbjct: 1371 EEYLSDSATKVLLKGSALLLCVLEINGSTG---GTTALAKVNNPDI-----PDVLIRTRAKMNRAFHGDLVAVRVM----------------------------------DSSVPEMPIGKVVSIVEEIHPRQYLCIADSLDTN-----IMTPINSVNPRVVVLQSKNPQGRTGFAVFELKDGESQLRDFVTEAQGKL---FLVQVMEWGASFRYPLGIVRQCFQEVTSLETALPVFAADNGL--------QLVPARMGGFNEDWTIPDTEWGSRLHFSEAL--TIDCGKTMELDDALSVKAGANGVVSVGVHVADVSYFISKDSSFDQAAFAQGTSAYPTDGSGIAVNMLPEQLR-RLCSLLPGKHRLAISVIFTFNTQGRSLRLPEVRRSIVSSKYSLTFDQCDAVLNGQ----------------------ASELPESVKRYIHVLGSMSRKLYSLRTRQGC--LAGLLDAVRATTFSKSS-------------QIVEQLMIFANTAVAEKLLKSGRTKDLTPLRTQ-SPPKSHILQSWSLACERAGILPESSLTLRRVASNPSSQNTPSTVSVKVDLLGKISTAINAKDITLLTESLAEFDTDGRALEAHCRLSSLQERSQYVLSSKVGPAGYGHFTLGLDAYTHFTSPLRRYFDIVVQRMLVAVM--LDEELPYTADELEQICSRCQTSKVQADTFERSCKLTNLAAGLSSSPQ-----WTEVVVHRVTPDKIRVSLPSASHSKKLSLTIRTQD 2023          
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:101159171])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 413/1009 (40.93%), Postives = 596/1009 (59.07%), Query Frame = 3
Query:  132 KLKIV-SRYL-QNIPCKVN-CTYDCNKDFDGLKVSP-DVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKT-PTGRVVGISRRNWRDYVCSFEKSDLN-----SGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNL-ELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE----GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            K+++V   YL + +PC  + C  DC    +G+KV P D+++YV+ D + ++++ E+LEL +  G I T +  + + +  RR Y +L+ L +DP    + F NEF Q  F  +++ E    + TR  + A+ +Y +HL     VV +T + + A+ QYS+            V ++T+++YL N+  D  +  EL  S+  A +  +  D+            E+L  EV+   + SG +++G + VNK +++ EA +V +EG+S+ Q M L S VL+ G  NRNRA+ GD VV+ +LP S+W  +              L    Q ++ + D    K  PTGRVVG+ +RNWRDYV +F   D +     S Q VL  P+DRRIP IRI    A+ L +HR +VR+D W  +S YPNGH V+ +G  G+LETE +T+L+E  ++  PF+ +Q+ E+P+++ E PW+++P EV++RRDLR+  L+FSIDP+GC+DVDDTLS+R LA G L ELGVHIADVTHFV   SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL    + V  V + R+VIRSSY+LHYELAQ + + +   E     +PEL       KD   +  QL  A+ ML  VS  L+ +R   G LELEG+EV+ +    +   +  L  ++PLEVHET+AECMI+ANHWVA+K  E++P R+ LR HP PR++ F +L+  A   GF+++  +N  LA SLD AVD QD   N++LR +AT AMS A YFSTG    + YYHYGLAL  YTHFTSPIRRYAD++VHR+L  ++E      P   L TN  L +    +NN++  AQ  Q AS  LFQ +FFR++  Q D+    + +I  +R NG +V +P YGIKG V+LR ++  +           + E     +W        +   Y   I   T    A     T++L   + +RI    S  H  +L LE +
Sbjct:   17 KVRVVREHYLRERVPCFSSLCQADCA---NGVKVLPGDLTHYVMPDADVVVDYLEILELKELQGIIFTQTACQALHSKGRRFYNRLRSLVKDPRFHCVQFANEFQQYSFCPREKGESQEKWQTRCVYSAAVWYYNHLAGMMNVVMITEDEE-AVAQYSSLHS--------GVYVVTVQDYLQNFWPDLQAAQELYASISQALEEREAEDSQ-------REFPEHLPAEVMEAGIKSGRYIQGTLSVNKHRAQSEA-LVQTEGSSS-QAMDLSSGVLVHGGKNRNRAVHGDVVVVELLPRSEWRGRA------------TLLTEGQGDDRSPDDGQEKPMPTGRVVGVLQRNWRDYVVTFPSRDASQSQSRSCQRVLTVPWDRRIPKIRISTQQAEALQDHRVVVRLDSWESTSLYPNGHSVKVLGRAGELETEVQTILVENCIHVPPFSEAQMKEMPLSSPEKPWRVDPAEVARRRDLRDSHLVFSIDPLGCEDVDDTLSVRSLAGGTLLELGVHIADVTHFVPEGSLTDLEARTRATTYYLADRRYDMLPAVLSADLCSLLGGVDRYAMSVLWELDAGSLAVRRVWFGRTVIRSSYQLHYELAQALLNGE---EVR---VPELERFCPEEKD--LKLAQLIQALEMLTRVSRHLRLQRDRGGALELEGVEVRAQLDKDK--NITALVPRQPLEVHETVAECMIYANHWVARKIQESFPNRALLRRHPPPRLELFSQLVDTAKAMGFSVDTRTNKALADSLDRAVDPQDPMVNRLLRMMATRAMSQALYFSTGSQPQDQYYHYGLALDRYTHFTSPIRRYADMVVHRLLTAALELEQGAGPAGILATNRELEELAQHINNKNWTAQRAQSASTGLFQCLFFRDRDPQTDLRCVADAIIYAIRDNGVLVFVPEYGIKGPVYLRNKEGQVV----------SAEAGGSCKWQGG-----KVRRYPSYITTTT----AGGCSATFRLMSHITVRISVRSSSCHSDTLVLEVI 963          
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:101159171])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 411/1009 (40.73%), Postives = 595/1009 (58.97%), Query Frame = 3
Query:  132 KLKIVSRYL--QNIPCKVN-CTYDCNKDFDGLKVSP-DVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKT-PTGRVVGISRRNWRDYVCSFEKSDLN-----SGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNL-ELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE----GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            K+++V  +   + +PC  + C  DC    +G+KV P D+++YV+ D + ++++ E+LEL +  G I T +  + + +  RR Y +L+ L +DP    + F NEF Q  F  +++ E    + TR  + A+ +Y +HL     VV +T + + A+ QYS+            V ++T+++YL N+  D  +  EL  S+  A +  +  D+            E+L  EV+   + SG +++G + VNK +++ EA +V +EG+S+ Q M L S VL+ G  NRNRA+ GD VV+ +LP S+W  +              L    Q ++ + D    K  PTGRVVG+ +RNWRDYV +F   D +     S Q VL  P+DRRIP IRI    A+ L +HR +VR+D W  +S YPNGH V+ +G  G+LETE +T+L+E  ++  PF+ +Q+ E+P+++ E PW+++P EV++RRDLR+  L+FSIDP+GC+DVDDTLS+R LA G L ELGVHIADVTHFV   SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL    + V  V + R+VIRSSY+LHYELAQ + + +   E     +PEL       KD   +  QL  A+ ML  VS  L+ +R   G LELEG+EV+ +    +   +  L  ++PLEVHET+AECMI+ANHWVA+K  E++P R+ LR HP PR++ F +L+  A   GF+++  +N  LA SLD AVD QD   N++LR +AT AMS A YFSTG    + YYHYGLAL  YTHFTSPIRRYAD++VHR+L  ++E      P   L TN  L +    +NN++  AQ  Q AS  LFQ +FFR++  Q D+    + +I  +R NG +V +P YGIKG V+LR ++  +           + E     +W        +   Y   I   T    A     T++L   + +RI    S  H  +L LE +
Sbjct:   17 KVRVVREHYLRERVPCFSSLCQADCA---NGVKVLPGDLTHYVMPDADVVVDYLEILELKELQGIIFTQTACQALHSKGRRFYNRLRSLVKDPRFHCVQFANEFQQYSFCPREKGESQEKWQTRCVYSAAVWYYNHLAGMMNVVMITEDEE-AVAQYSSLHS--------GVYVVTVQDYLQNFWPDLQAAQELYASISQALEEREAEDSQ-------REFPEHLPAEVMEAGIKSGRYIQGTLSVNKHRAQSEA-LVQTEGSSS-QAMDLSSGVLVHGGKNRNRAVHGDVVVVELLPRSEWRGRA------------TLLTEGQGDDRSPDDGQEKPMPTGRVVGVLQRNWRDYVVTFPSRDASQSQSRSCQRVLTVPWDRRIPKIRISTQQAEALQDHRVVVRLDSWESTSLYPNGHSVKVLGRAGELETEVQTILVENCIHVPPFSEAQMKEMPLSSPEKPWRVDPAEVARRRDLRDSHLVFSIDPLGCEDVDDTLSVRSLAGGTLLELGVHIADVTHFVPEGSLTDLEARTRATTYYLADRRYDMLPAVLSADLCSLLGGVDRYAMSVLWELDAGSLAVRRVWFGRTVIRSSYQLHYELAQALLNGE---EVR---VPELERFCPEEKD--LKLAQLIQALEMLTRVSRHLRLQRDRGGALELEGVEVRAQLDKDK--NITALVPRQPLEVHETVAECMIYANHWVARKIQESFPNRALLRRHPPPRLELFSQLVDTAKAMGFSVDTRTNKALADSLDRAVDPQDPMVNRLLRMMATRAMSQALYFSTGSQPQDQYYHYGLALDRYTHFTSPIRRYADMVVHRLLTAALELEQGAGPAGILATNRELEELAQHINNKNWTAQRAQSASTGLFQCLFFRDRDPQTDLRCVADAIIYAIRDNGVLVFVPEYGIKGPVYLRNKEGQVV----------SAEAGGSCKWQGG-----KVRRYPSYITTTT----AGGCSATFRLMSHITVRISVRSSSCHSDTLVLEVI 963          
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Match: dis3l (DIS3 like exosome 3'-5' exoribonuclease [Source:NCBI gene;Acc:101159171])

HSP 1 Score: 707.597 bits (1825), Expect = 0.000e+0
Identity = 411/1009 (40.73%), Postives = 591/1009 (58.57%), Query Frame = 3
Query:  132 KLKIV-SRYL-QNIPCKVN-CTYDCNKDFDGLKVSP-DVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKT-PTGRVVGISRRNWRDYVCSFEKSDLN-----SGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLREL-LIFSIDPIGCQDVDDTLSIRKLANGNL-ELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWEL-TPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIE----GVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNK-AQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYV 3104
            K+++V   YL + +PC  + C  DC    +G+KV P D+++YV+ D + ++++ E+LEL +  G I T +  + + +  RR Y +L+ L +DP    + F NEF Q  F  +++ E    + TR  + A+ +Y +HL     VV +T + + A+ QYS          SL+  +  + +YL N+  D  +  EL  S+  A +  +  D+            E+L  EV+   + SG +++G + VNK +++ EA +V +EG+S      L S VL+ G  NRNRA+ GD VV+ +LP S+W  +              L    Q ++ + D    K  PTGRVVG+ +RNWRDYV +F   D +     S Q VL  P+DRRIP IRI    A+ L +HR +VR+D W  +S YPNGH V+ +G  G+LETE +T+L+E  ++  PF+ +Q+ E+P+++ E PW+++P EV++RRDLR+  L+FSIDP+GC+DVDDTLS+R LA G L ELGVHIADVTHFV   SL DLEAR R+T+ Y+ADRR+DMLP VLS DLCSL   VDRYA+SV+WEL    + V  V + R+VIRSSY+LHYELAQ + + +   E     +PEL       KD   +  QL  A+ ML  VS  L+ +R   G LELEG+EV+ +    +   +  L  ++PLEVHET+AECMI+ANHWVA+K  E++P R+ LR HP PR++ F +L+  A   GF+++  +N  LA SLD AVD QD   N++LR +AT AMS A YFSTG    + YYHYGLAL  YTHFTSPIRRYAD++VHR+L  ++E      P   L TN  L +    +NN++  AQ  Q AS  LFQ +FFR++  Q D+    + +I  +R NG +V +P YGIKG V+LR ++  +           + E     +W        +   Y   I   T    A     T++L   + +RI    S  H  +L LE +
Sbjct:   17 KVRVVREHYLRERVPCFSSLCQADCA---NGVKVLPGDLTHYVMPDADVVVDYLEILELKELQGIIFTQTACQALHSKGRRFYNRLRSLVKDPRFHCVQFANEFQQYSFCPREKGESQEKWQTRCVYSAAVWYYNHLAGMMNVVMITEDEE-AVAQYS----------SLHSGVYVVTDYLQNFWPDLQAAQELYASISQALEEREAEDSQ-------REFPEHLPAEVMEAGIKSGRYIQGTLSVNKHRAQSEA-LVQTEGSSN-----LSSGVLVHGGKNRNRAVHGDVVVVELLPRSEWRGRA------------TLLTEGQGDDRSPDDGQEKPMPTGRVVGVLQRNWRDYVVTFPSRDASQSQSRSCQRVLTVPWDRRIPKIRISTQQAEALQDHRVVVRLDSWESTSLYPNGHSVKVLGRAGELETEVQTILVENCIHVPPFSEAQMKEMPLSSPEKPWRVDPAEVARRRDLRDSHLVFSIDPLGCEDVDDTLSVRSLAGGTLLELGVHIADVTHFVPEGSLTDLEARTRATTYYLADRRYDMLPAVLSADLCSLLGGVDRYAMSVLWELDAGSLAVRRVWFGRTVIRSSYQLHYELAQALLNGE---EVR---VPELERFCPEEKD--LKLAQLIQALEMLTRVSRHLRLQRDRGGALELEGVEVRAQLDKDK--NITALVPRQPLEVHETVAECMIYANHWVARKIQESFPNRALLRRHPPPRLELFSQLVDTAKAMGFSVDTRTNKALADSLDRAVDPQDPMVNRLLRMMATRAMSQALYFSTGSQPQDQYYHYGLALDRYTHFTSPIRRYADMVVHRLLTAALELEQGAGPAGILATNRELEELAQHINNKNWTAQRAQSASTGLFQCLFFRDRDPQTDLRCVADAIIYAIRDNGVLVFVPEYGIKGPVYLRNKEGQVV----------SAEAGGSCKWQGG-----KVRRYPSYITTTT----AGGCSATFRLMSHITVRISVRSSSCHSDTLVLEVI 957          
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Match: dis3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:NCBI gene;Acc:101166822])

HSP 1 Score: 490.73 bits (1262), Expect = 1.989e-156
Identity = 324/941 (34.43%), Postives = 498/941 (52.92%), Query Frame = 3
Query:  108 IKTSQAQGKLKIV-SRYLQN-IPCKVNCTYDCNKDFDGLKVSPDVS-------NYVIVDTEYLMNFSEVLE--LLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDC---IKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRD---EATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKK---LEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQ---DIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEG-VPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKS 2858
            +K ++A G +KIV   YL++ I C      +C ++   L+    +        +YV+ DT  +++  +VLE  ++ N+  II  + ++ +++ +  +Y +LK + +   K +  F NE H+E +I +++ E   +   R   +A ++Y  HL              V LL      ++   + SL V      EY+ N      +  ELVD L  + D    I +S    P+ L +  +Q           + SG FL+G  +     SRD   EATV + +G+  +      +EVLIQG  N NRA+  D V + +LP +QW++     L+  G+    ++     E+A   +   ++ K PTG++VGI +RNWR +      S +      L TP DRRIP IRI    A  L+  R +V IDGWP +SRYPNGHFV S+G  G+  TE   LL+E+++ ++ F+ + L+ LP    + PW + PE++ KR+DLR L + S+DP GC D+DD L  R+L NGNLE+GVHIADV+HF++P + LD EA  R T++Y+  +R DM+P +LS +LCSL S+V+R A S +WE+  + E++   + +SVI S   L Y  AQ   D  + K D   SL  + +LA                            ILK +RIE G L L  +EV+    D E     DL  KE +E +  + E M+ AN  VA+K  + +P  + LR HP+P   ++  L+  A +    I+  S   LA SLD+A  +     N +LR LAT  M  A YF +GM    D++HYGLA P YTHFTSPIRRYADI+VHR+L  +I   +    L+     +  CN +N +H+ +Q  QRAS+     +FF+++         EG ++ +R N  +V IP++G++G+VF   +DK+
Sbjct:    8 VKKTRAGGVMKIVREHYLRDDIWCGSEACRECKQESTVLQADACIESNLCPYPHYVVPDTNVVLHQIDVLEDPVIRNV--IILQTVLQEVRHRSAPVYKRLKDMIQAKEKLVYTFTNEHHRETYIEREQGESANDRNDRAIRVAVKWYSQHLK--------ADGLKVVLLTDDQGNKEKAEENSLVV--YKFDEYVKNL----TANPELVDRLALSKDDKAEIISSKVLFPEHLPLSKIQS---------GIKSGTFLQGTFKA----SRDNYLEATVFV-QGDGAES-----TEVLIQGLQNLNRAVHQDVVAVQLLPRNQWVSPSSVVLQDDGAAKDDDMDEDEEEKALRISAAEAAGK-PTGKIVGIIKRNWRPFCGMLNVSQIKESTRHLFTPADRRIPRIRIETRQASTLVGQRIMVAIDGWPKNSRYPNGHFVRSLGSAGEKGTEEAVLLLEHDVPHQAFSQNVLSFLP----KMPWGITPEDMVKRQDLRHLTVCSVDPPGCTDIDDALHCRELENGNLEVGVHIADVSHFIRPGNALDKEAANRGTTVYLCGKRIDMVPELLSSNLCSLRSNVERLAFSCIWEMNHNAEILKTQFTKSVINSKASLTYAEAQMRIDDTNKKDDITESLRGLNKLA---------------------------KILKRKRIENGALTLSSLEVRFHI-DSETHDPIDLQTKELMETNSMVEEFMLLANISVAQKIYDEFPDCALLRKHPAPPPSNYDILLKAAKSMNVEIHTDSAKALADSLDVAKVDGFSYFNTLLRILATRCMMQAVYFCSGM--DSDFHHYGLASPIYTHFTSPIRRYADIIVHRLLAVAIGADITYPDLMDKHKQSALCNNLNYRHKMSQYAQRASVAFHTQLFFKSRG----ILNEEGFVLFVRKNAIIVLIPKFGLEGTVFFDSKDKA 874          
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Match: dis3l2 (DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gene;Acc:101169734])

HSP 1 Score: 307.76 bits (787), Expect = 6.242e-90
Identity = 225/734 (30.65%), Postives = 355/734 (48.37%), Query Frame = 3
Query:  765 LRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQW-----------------------INKKLEISGSEASAELALPVAEQAENETIDSSSTKT--PTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHR--------FIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPE-LASKHKAFKDGAER-FQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFS---DPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLD--LAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYY-HYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLR 2843
            L+    + Y++ E ++  +  G+ ++G +R+N  K   EA +   +            ++ ++G   RNRA++GD VV+ +LP+ QW                       ++ K +IS    +  + +   +  E  +   ++ KT   T +VV I  +     V    K       + L +P D R+P I + ++   +  N R        FI RI  W   + +  G   +++G  G++E ET  +L E+++    FT   L  LP   +  PW + PEE+ KR+DLR   IF+IDP   +D+DD LS + L +GN E+GVHIADV++FVK  + LD  A +R+TS+Y+  +   MLP +L  +LCSL  D DR   SV+W+LTP+ +++S  + RSVIRS  KL Y+ AQ + ++           PE L S ++   D  E    ++  AV  L +++  L+ +RI  G L+L+    QVK S   + E          E  + +  + E M+ AN   A      +P  + LR HP P+     EL    +  G  I+ SS   L +SL+     D        +L  L +  M  A YF +GMLK E  + HY L +P YTHFTSPIRRYADI+VHR+L          SL  +  +  Q    NN+   A+ V   S ELF  +  R     D A     +++++    F V + +YG++  V+ +
Sbjct:   34 LKKQVFEPYMTLEDVSHGLKRGELIQGQLRINP-KKYHEAFIPSPDDKW---------DIFLEGVEARNRALNGDIVVVELLPQEQWKVITYAHLSQNSKSLEYDERTVTVSHKAKISHCYIAFHV-MKAGKPQEGSSTPQTNEKTLQKTAKVVYIVEKKHSRAVTGSLKF-FPDKPFALFSPVDHRVPRINVPLSDCPEDFNIRPEVYANTLFICRITDWTADNAFAQGRLAKTLGQAGEIEPETEGILTEHSVDFSDFTPEVLECLP---QPRPWCIPPEELEKRKDLRRDCIFTIDPATARDLDDALSCKLLPDGNFEVGVHIADVSYFVKEDTALDEAASQRATSVYLVQQVVPMLPRLLCEELCSLNPDFDRLTFSVIWKLTPEGKILSEWFGRSVIRSCAKLSYDHAQSMIEA-----------PEKLFSPNELQLDNPEHPIDEIHEAVLRLHSIAQNLRRQRISTGTLKLD----QVKLSFNINKESMMPNSCSVYEYKDSNRLVEEFMLLANIATAHHIHRKFPDLALLRRHPPPKTKMMEELKEMCSQLGIDIDLSSPGALQESLNNLTGKDEYSAARKAVLTHLCSRPMQMALYFCSGMLKNEQLFKHYALNIPLYTHFTSPIRRYADIIVHRLL--------ASSLSMSQEVEKQALHCNNKKMLAKRVWELSSELFFGLLVRESGPLDSA----AMVMRVLDQSFDVLVIKYGVQKRVYCK 725          
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Match: SMESG000057169.1 (SMESG000057169.1)

HSP 1 Score: 2249.94 bits (5829), Expect = 0.000e+0
Identity = 1094/1096 (99.82%), Postives = 1095/1096 (99.91%), Query Frame = 3
Query:   60 MNNQKYSIFDVNSLRKIKTSQAQGKLKIVSRYLQNIPCKVNCTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQFNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNVREANDMXXXXXXXXXXXXIDESVLIASLHSNTSLCHLFRQFKIRKLGISL 3347
            MNNQKYSIFDVNSLRKIKTSQAQGKLKIVSRYLQNIPCKVNCTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQ NRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLN+GQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNVREANDMKVKKRKYVEEEEIDESVLIASLHSNTSLCHLFRQFKIRKLGISL
Sbjct:    1 MNNQKYSIFDVNSLRKIKTSQAQGKLKIVSRYLQNIPCKVNCTYDCNKDFDGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNRRLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIASQFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEYLVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVLARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQSNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENETIDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNAGQYVLVTPYDRRIPMIRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYFSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEVYQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDASESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNVREANDMKVKKRKYVEEEEIDESVLIASLHSNTSLCHLFRQFKIRKLGISL 1096          
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Match: SMESG000077915.1 (SMESG000077915.1)

HSP 1 Score: 209.92 bits (533), Expect = 6.762e-56
Identity = 180/642 (28.04%), Postives = 304/642 (47.35%), Query Frame = 3
Query: 1137 TGRVVGI-SRRNWRDYVCSFEKSDLN----SGQYVLVTPYDRRIPMIRIGITSADKLINHR--------FIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLA----NGN--LELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYD--SKIDFETSLGLIPELASKHKAFKDGAERF--QQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLE-DLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMD-------HFVEL--IHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQYF-----STGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRIL---LCSIEGVPEES---------LLTNSSLADQC---------NIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTE-GVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIA-WLKSR 2879
            TG+VVGI ++ N R  V   +  D N    S +Y+   P D R P + + + S       R        FI +I+ W    +YP G     +  +  +E ET  +L+E       F    L+ +P  T      M  +++  RRD R   + S+DP   +D+DD L I++L     NG    E+G+HIADVT++V+P S +D+EAR R+T++YM DR   MLP  L  +LCSL    D+ A SVV+++T + E++     R++IR++ KL YE AQ++ D  +K D+            K++ F +    F    + S++  L N++  ++  R  +G L +   ++    +    + +  ++++  P   +  I E M+ AN  +A+   ++ P ++ LR H SP +         F ++   H    KG T  F   ++L    D            ++ ++ +  M  A YF     S GM+     +H+ L +P YTHFTSPIRRY D++VHR L   L  IE   +            +  ++L+  C         +I N + + A+    +SI LF ++F +         + E G++V +    F V +   G    V+L + DK+ + +LK++
Sbjct:  129 TGKVVGIYTKMNSRHCVGYLKLPDNNDNVKSLKYIKFFPVDIRYPRLAVPVESCPTDFLKRPLDYNEVKFIAKIENWNEDEQYPTGVISNCLKNLPIIEQETIRILVENGFPTVEFDEKLLSSIPKIT------MTEDDLKYRRDYRNECVVSVDPKTARDLDDALHIKRLCEKSNNGETLWEVGIHIADVTYYVRPDSEVDVEARHRTTTVYMVDRAVPMLPRELCENLCSLNPGTDKLAYSVVFKITDNCEILETWIGRTIIRTACKLSYEDAQNVIDNPTKSDW------------KNEDFNEVFPPFTTDNVASSILNLHNLAVKMRINRFHSGSLWINQPKLGFMLNSSRDSPVGYNIYKLGP--SNHMIEEWMLRANMSIAEFLHKHSPGKAFLRRHESPTIQAINGLNKQFTQIGWKHLCIEKGTTEEFQDLMQLFPISD--------SNYHVMMNICSKVMQLALYFCLNDESGGMIGC---HHFALNVPLYTHFTSPIRRYPDMIVHRQLTEILMKIESEKKNQGDKIQGKLEWMAPTALSKHCTATALDHIADICNKKRKDAKAADESSITLFYSLFVQK-----CGPFNENGIVVGILDKAFDVFLSHCGFTKRVYLDQIDKNKSVYLKNK 734          
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Match: SMESG000060528.1 (SMESG000060528.1)

HSP 1 Score: 169.859 bits (429), Expect = 8.689e-43
Identity = 169/636 (26.57%), Postives = 279/636 (43.87%), Query Frame = 3
Query: 1134 PTGRVVG-ISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPMIRIGIT---SADK-------------------------LINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPE--RTKLED-------LHQKEPLEVHETIAECMIFANHWVAKKCLENY----PTRS----CLRHHPSPRMDHFVELIHCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKI--LRSLATMAMSNAQY-FSTGMLKAED--------------YYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSL--ADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYTEGVIVKLRSNGFVVHIPRYGIKGSVFLRK 2846
            PTGR+V  I+  N   ++ S +  +     +++  PY+R  P I I      SAD                          + NH  I   D +    ++PN         + DL++    LL  Y L + PF+   +  +P + +E  + +   E   R+D     I SIDP   +D+DD L I+ ++ GN  +GVHIADV++F+KP + LD  A  R++SIY+  +   MLP +LS  LCSL  + D+ A S++  + PD E++S  + +SVIR  +KL Y+ A  + +   D   +  L                 +++   ++ +L  ++++++ RR+++G L +    V   F   E   +   D       L  K     +  I E M+ AN   AK    N+    P  S     LR HPSP               GF      + +L   +++    Q+ E +K   L  L  + M+ A+Y  +   L   D              ++HYGL +P YTHFTSPIRRYADI+VHR L   I+G     +  +  L  A  CN+       +++  R   +   +++  +       R  +G+++ +  N  +V +   GI     LR+
Sbjct:  142 PTGRIVSTITDLNSITFIGSLKPMN----THLMFWPYNRGCPEIHIETDKKYSADNQACKIIEWTNHSVPKGKLLFEALPTIYNHSLIFH-DKF---QQFPNADSTHKQAAVKDLKSAISNLLKVYKLTDEPFSDKDMECVPASAEE--FVIPQHERDNRKDFTAECIISIDPDDAKDIDDALHIQAVSGGNYLVGVHIADVSYFIKPDTALDCTALHRASSIYLKHKVIPMLPPILSEHLCSLNPNEDKLAFSIMLLINPDGEIISEKFTKSVIRPKFKLSYKQANALINGDTDSSLATNL----------------HYEKAVESLLILDKLATVIRKRRVDSGALIINKPTVNFTFESKEFDSSNTNDSIPEPNGLQWKILGRSNFLIEEFMLLANQASAKLLFNNFLSSRPNESEIGAFLRKHPSPEKIKKSRWYDSCKRAGFR---PESKDLNSIMEVVNQIQETEPHKALGLSFLTYINMNVAEYCCAENCLSFNDPEQEVKIINDPDFPFHHYGLNVPLYTHFTSPIRRYADIVVHRQLSAIIKGENSCGISLSQRLEAAHNCNV-------SRIANRRMNDNLTSVYMASYLNQVGWRLVKGILINITGNSVIVLLMSSGILHRCELRE 741          
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Match: SMESG000026051.1 (SMESG000026051.1)

HSP 1 Score: 99.7525 bits (247), Expect = 8.699e-21
Identity = 105/419 (25.06%), Postives = 180/419 (42.96%), Query Frame = 3
Query: 1545 LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMADRR-FDMLPHVLSGDLCSLWSDVDRYAVSVVW----ELTPDIEVVSVDYFRSVIRSSYKLHYE-----LAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPR-MDHFVELIHCATTKGFT--INFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQ----------YFSTGMLKAEDYY-------------------HYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQ--CNIMNNQHR 2669
            ++F+ID    +D+DD +S  K  N  + +G+HI+DVT ++     +  +A++R  +IY   ++   ++   LS D  SL  +V R  VSV +     +T D ++  + +   VI S +KL YE     L Q+     +D        P L             F+ LK++      +S  L+  R+               F       ++DL+     E    + E M+ AN  VAKK    YP  + LR   S R  +++++ +  +T   F   +N   +L   K+ D  V    + + K      ++   +A           Y++  M+   D+Y                   H+ L    YT+FTSPIRR++DI+VHR+L   I G     ++ +SSL     C+I N +++
Sbjct:  499 VVFTIDSKNTKDIDDAISYHKEGNDTV-IGIHISDVTKYISSTHEIYYQAQRRFCTIYPPYKKPIHLIDERLSTDALSLIPNVPRAVVSVFFRFPSNVTTDFKITDLKFREGVIVSKHKLTYEEVSKWLKQNQVPENVD--------PNL-------------FEALKNS----FEISKNLRQARLPKS-----------YFVRSTNKFVKDLYVDNQFEAETLVNEFMLLANENVAKKVYYKYPDSTLLRIQNSVRNYENWLDSLLQSTNMNFEGELNDYCSLLEVKNADFPVKKNILVSRKFFERFISLIKKDADSAKNLLLYDIYYNEFMVHIIDWYKINCPARYECSYKNSVNNKHFSLNKDLYTNFTSPIRRFSDIVVHRLLKSVING----KMIDDSSLDIHYVCSIANQKYK 876          
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Match: SMESG000026073.1 (SMESG000026073.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.371e-18
Identity = 117/516 (22.67%), Postives = 200/516 (38.76%), Query Frame = 3
Query: 1296 NHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRTLLIEYNLYNRPFTT--SQLAELPINTKENPWKMNPEEVSKRRDLREL---------LIFSIDPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRSTSIYMAD----RRFDMLPHVLSGDLCSLWSDVDRYAVSVVWE------LTPDI---EVVSVDYFRSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQQLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQKEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLR-HHPSPRMDHFVELIHCATTKGFTINFSSNL-ELAKSLDLAVDNQDMETNKI--------LRSLATMAMSNAQ-------YFSTGMLKAEDYY-------------------HYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEESLLTNSSLADQCNIMNNQ 2663
            +H FIV  + W     YPNG  V +I      +             N P  +   Q+  L I  +   ++   +E+ K+     +         ++F+ID    +D+DD LS  K    ++ +GVHI DVT ++ P   +  +A  R  + Y           +L   L+ D+ SL  +  R  VSV++       + PD    E++   + + VI S +KL YE                    E++S  K         + L  A+  +  V+  ++  R+          +             +D+  +   E    I E M+ AN +VA+K  E YP  + LR   P      ++E +   T     +NF+  L E    L++  DN D     I          +  ++ +  A+       Y++   +   ++Y                   H+ L  P YTHFTSPIRR+ DI+VHR+L   + G   + +  +  + + C I N +
Sbjct:  490 DHFFIVCYEYWDPYFMYPNGKIVGTISSYDSFKN------------NFPLISLICQINPLDITPR---YQKEVDEIKKKAVCVHVPGSYLPTDSVVFTIDSETTKDMDDALSFHK-EGSDIIIGVHITDVTKYISPTHEIYKQAESRFCTYYPPKFSNIHPIHLLDDTLATDVLSLAPNKPRAVVSVLFRFPGRMLINPDFKLSEIIQPTFRQGVIISQFKLTYE--------------------EVSSWLKQPNQIPNDKENLIYALNEIFAVAKKIRRARLPESYFVCSVNDC-----------YKDMDIETIFEARIVIEEFMLLANEYVARKIYEKYPDFTLLRMQDPVKNCGEWLENLFNLT----NMNFAGQLKEFCNLLNVRPDNFDARKKLIVSKNFYEQFNNFLSIDIDKARSLLQYDAYYNDFFVHIREWYQMNYPARYECSVKDSIENKHFSLNKPLYTHFTSPIRRFTDIVVHRLLKSVLNGTEIDDITLD--IGEVCTIANKK 952          
The following BLAST results are available for this feature:
BLAST of Dis3 exonuclease 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIS3L0.000e+041.97DIS3 like exosome 3'-5' exoribonuclease [Source:HG... [more]
DIS3L0.000e+042.93DIS3 like exosome 3'-5' exoribonuclease [Source:HG... [more]
DIS37.671e-16134.62DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
DIS31.534e-14934.02DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
DIS32.844e-14939.42DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dis-33.415e-13933.16Probable exosome complex exonuclease RRP44 [Sourc... [more]
dis-33.415e-13933.16Probable exosome complex exonuclease RRP44 [Sourc... [more]
disl-21.547e-8028.55DIS3-like exonuclease 2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dis32.714e-15233.82gene:FBgn0039183 transcript:FBtr0334599[more]
Dis32.714e-15233.82gene:FBgn0039183 transcript:FBtr0084605[more]
Dis3l26.786e-5928.53gene:FBgn0035111 transcript:FBtr0072487[more]
Dis3l27.740e-5928.53gene:FBgn0035111 transcript:FBtr0072486[more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dis3l0.000e+041.21DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis3l0.000e+041.01DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis33.389e-15233.80DIS3 exosome endoribonuclease and 3'-5' exoribonuc... [more]
dis33.389e-15233.80DIS3 exosome endoribonuclease and 3'-5' exoribonuc... [more]
dis3l21.476e-9530.18DIS3 like 3'-5' exoribonuclease 2 [Source:ZFIN;Acc... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcna60.000e+040.08potassium channel, voltage gated shaker related su... [more]
kcna60.000e+040.08potassium channel, voltage gated shaker related su... [more]
kcna60.000e+040.55potassium channel, voltage gated shaker related su... [more]
kcna60.000e+040.52potassium channel, voltage gated shaker related su... [more]
dis31.041e-16535.34DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dis3l0.000e+041.68DIS3 like exosome 3'-5' exoribonuclease [Source:MG... [more]
Dis3l0.000e+042.73DIS3 like exosome 3'-5' exoribonuclease [Source:MG... [more]
Dis3l0.000e+042.73DIS3 like exosome 3'-5' exoribonuclease [Source:MG... [more]
Dis3l0.000e+042.73DIS3 like exosome 3'-5' exoribonuclease [Source:MG... [more]
Dis39.536e-16235.15DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C0S1|DI3L1_MOUSE0.000e+041.68DIS3-like exonuclease 1 OS=Mus musculus OX=10090 G... [more]
sp|Q5U2P0|DI3L1_RAT0.000e+041.98DIS3-like exonuclease 1 OS=Rattus norvegicus OX=10... [more]
sp|A0JN80|DI3L1_BOVIN0.000e+041.54DIS3-like exonuclease 1 OS=Bos taurus OX=9913 GN=D... [more]
sp|Q5R5N8|DI3L1_PONAB0.000e+042.07DIS3-like exonuclease 1 OS=Pongo abelii OX=9601 GN... [more]
sp|Q8TF46|DI3L1_HUMAN0.000e+041.97DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FA900.000e+046.52RNB domain-containing protein OS=Macrostomum ligna... [more]
A0A267DPE80.000e+046.42RNB domain-containing protein OS=Macrostomum ligna... [more]
A0A0X3PEG30.000e+040.54RNB domain-containing protein OS=Schistocephalus s... [more]
A0A183TB910.000e+039.71RNB domain-containing protein OS=Schistocephalus s... [more]
A0A1I8HG560.000e+044.06RNB domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dis3l0.000e+040.40DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis3l0.000e+040.40DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis31.307e-15134.15DIS3 exosome endoribonuclease and 3'-5' exoribonuc... [more]
dis3l22.906e-8128.55DIS3 like 3'-5' exoribonuclease 2 [Source:ZFIN;Acc... [more]
ENSAMXT00000053188.11.011e-3433.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dis3l0.000e+042.31DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
ENSPMAT00000003075.11.497e-7230.67pep scaffold:Pmarinus_7.0:GL481740:815:17708:1 gen... [more]
ENSPMAT00000010010.12.981e-6929.38pep scaffold:Pmarinus_7.0:GL476399:1754172:1773464... [more]
ENSPMAT00000003587.11.081e-6831.02pep scaffold:Pmarinus_7.0:GL477460:238964:260573:-... [more]
ENSPMAT00000010014.12.097e-6829.56pep scaffold:Pmarinus_7.0:GL476399:1754172:1773116... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
DIS31.161e-13533.19Exosome core complex catalytic subunit; has both e... [more]
SSD11.410e-3427.60Translational repressor with a role in polar growt... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO403070.000e+038.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424293.571e-8730.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451371.361e-2423.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dis3l0.000e+040.93DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis3l0.000e+040.73DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis3l0.000e+040.73DIS3 like exosome 3'-5' exoribonuclease [Source:NC... [more]
dis31.989e-15634.43DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
dis3l26.242e-9030.65DIS3 like 3'-5' exoribonuclease 2 [Source:NCBI gen... [more]
back to top
BLAST of Dis3 exonuclease 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057169.10.000e+099.82SMESG000057169.1[more]
SMESG000077915.16.762e-5628.04SMESG000077915.1[more]
SMESG000060528.18.689e-4326.57SMESG000060528.1[more]
SMESG000026051.18.699e-2125.06SMESG000026051.1[more]
SMESG000026073.11.371e-1822.67SMESG000026073.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033478 ID=SMED30033478|Name=Dis3 exonuclease 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3370bp
ATTATTTTTTGTATCTTTGTTTAAATAATGTTTAAAATTTTTTTTAATAT
CACATTAGAATGAATAATCAAAAATATTCAATATTTGACGTGAATTCTTT
AAGGAAAATTAAAACTTCCCAAGCACAAGGTAAACTGAAGATCGTGTCGA
GGTATTTACAAAATATTCCATGTAAAGTTAATTGCACATACGATTGCAAT
AAAGATTTTGACGGTTTAAAAGTTTCTCCTGATGTATCAAATTATGTTAT
TGTTGACACAGAATATTTGATGAATTTCTCAGAAGTTTTAGAATTGCTTG
ATAATATCGGTTTTATAATCACACTCTCTACCATGAGATATATACAAAAT
TATAACCGTAGACTTTATTACAAATTGAAAAAATTATTTGAAGACCCAGC
GAAATCTATTATATTATTCCAAAACGAATTTCATCAAGAATGTTTTATTA
CTCAAAAAGAGGATGAAGATACATTAAATTATATTACTCGCCTCAATTTT
ATAGCTTCGCAATTTTATCTAAGTCATCTCAATTACCAACCTACTGTTGT
ATTTTTAACTGGAAATACCGATGTTGCTTTGCTCCAGTACAGTAATTACA
TGAGAAAAGCTGGAATGGATACTTCACTAAATGTTGAAATAATGACAATA
AAAGAATATTTAGTGAATTATCACAAAGATAATTTCTCGACGATGGAGTT
AGTCGACAGTTTAGAAGCTGCCTTTGACTGCATTAAGAATTCCGACGCAA
ACATTCCTCAAGAATTACGGGTCGATGCGATGCAAGAGTATCTGTCTGAC
GAAGTCTTAGCCCGTTCTGTAAATTCCGGAGATTTTCTGAAAGGTATTAT
CCGAGTAAATAAGTTCAAATCGAGAGATGAAGCCACCGTTGTGTTATCTG
AAGGAAATTCCACAAAACAAATGATGGCATTACATAGCGAGGTTTTAATC
CAAGGCCAATTCAACAGGAATCGCGCTATTGATGGGGATTGTGTCGTTTT
GATGATTCTACCCGAATCGCAATGGATCAACAAGAAATTGGAAATATCCG
GATCGGAAGCCAGTGCTGAATTAGCGCTCCCTGTTGCGGAGCAAGCTGAG
AATGAAACTATCGATTCCAGCAGCACAAAAACACCGACCGGTCGTGTTGT
TGGAATTAGCAGACGAAATTGGAGGGATTATGTTTGCAGTTTTGAAAAAA
GTGACCTAAATTCTGGCCAATACGTGCTGGTTACTCCATACGACAGACGA
ATCCCGATGATTAGAATAGGAATCACCAGTGCTGATAAATTGATCAATCA
TCGATTTATCGTTCGAATCGATGGCTGGCCTTTGAGTTCCAGATATCCCA
ATGGACATTTCGTTGAATCGATTGGAGTTATTGGTGATTTAGAAACAGAA
ACCAGAACTTTATTGATTGAGTACAATCTGTATAATCGACCGTTCACCAC
AAGCCAATTGGCTGAATTGCCGATTAACACGAAAGAAAACCCCTGGAAAA
TGAACCCGGAAGAAGTATCCAAGAGAAGAGATCTAAGAGAGTTGTTGATT
TTCAGTATCGATCCAATCGGATGTCAAGATGTCGACGATACACTGTCGAT
ACGGAAATTAGCCAATGGAAATCTAGAGCTCGGTGTTCACATTGCCGATG
TGACGCATTTTGTGAAACCTCACTCGCTGTTGGATTTAGAAGCAAGGAAA
CGGTCGACGAGTATTTATATGGCTGACAGACGATTCGATATGTTGCCACA
TGTTCTCAGTGGGGATCTCTGCTCATTGTGGAGCGATGTCGATCGATACG
CCGTCAGCGTCGTCTGGGAACTGACCCCGGACATTGAGGTGGTATCTGTC
GACTATTTCCGCAGTGTCATTCGATCGAGCTATAAATTGCACTACGAGCT
CGCCCAGGACATTTACGATAGCAAAATCGATTTCGAAACCTCTCTGGGGC
TGATCCCGGAATTGGCCAGTAAACACAAAGCATTCAAAGATGGCGCCGAG
AGATTCCAGCAATTGAAATCCGCAGTTACGATGCTGATCAATGTGTCATC
GATCCTGAAATCGAGACGAATCGAAGCCGGTGGATTGGAACTGGAAGGAA
TGGAAGTCCAGGTGAAATTTTCCGATCCGGAACGAACGAAATTGGAAGAT
CTCCATCAAAAGGAACCACTGGAAGTCCACGAAACAATTGCAGAATGCAT
GATATTTGCCAATCACTGGGTGGCCAAGAAATGCCTTGAAAACTACCCGA
CCAGATCCTGCTTGCGGCACCATCCGTCACCGAGAATGGATCATTTTGTG
GAATTGATCCATTGCGCTACCACCAAAGGATTCACGATCAATTTCTCCTC
GAATTTAGAGCTCGCAAAGTCCCTAGATTTGGCCGTTGACAACCAAGACA
TGGAAACCAACAAAATCCTCCGAAGTCTAGCAACAATGGCAATGTCGAAT
GCTCAATATTTTTCCACTGGAATGCTGAAAGCCGAGGATTACTATCATTA
CGGATTGGCTTTGCCGACTTATACGCATTTCACATCGCCAATTCGTCGAT
ATGCAGATATTCTCGTCCATCGGATTCTACTCTGCTCCATTGAAGGCGTG
CCCGAGGAGAGTTTGCTGACGAATTCATCACTCGCTGATCAGTGTAACAT
CATGAACAATCAGCACCGACAAGCACAATTGGTACAACGGGCGAGTATTG
AACTGTTCCAGGCAATGTTTTTCCGAAACAAAGCCCAAGACGATATTGCT
CGCTACACCGAGGGGGTGATCGTGAAATTGCGCTCCAACGGATTTGTTGT
CCACATCCCTCGATACGGTATCAAGGGTTCCGTGTTCCTGAGGAAGCAGG
ATAAATCGATCGCATGGCTGAAATCCCGCCCGGAACCGTTGTCGAATATG
GAGGAGGTTTATCAGACTCAATGGCTGAGTGACAACGAGCTGACAATCGA
GACCGAATGCTACCAGCAATTGATCAACCAGATAACAGTCGTGCGGGCAG
CCAATCAAAACCGACAGACCTATAAGTTGTTCGATCGGGTCTTCCTGAGA
ATCGATGCCTCTGAGAGTCATTCTCACGGATTGTCGTTACAATTGGAATA
CGTTGGACAGTTGCGATCAGGGAAACAAAATGCAAAACTACCGACTGGTG
ACGATGTGACCGATCGATTGTCAAAGGATGATTTGTTTCAGAATGTCAGA
GAAGCGAATGATATGAAAGTCAAGAAAAGGAAATACGTTGAGGAAGAAGA
AATCGATGAATCAGTGCTCATTGCCAGTCTCCATTCGAATACGTCACTTT
GCCATTTATTTAGGCAATTTAAAATTAGAAAATTGGGAATTAGTCTTTGA
TGAGAATAAAATCTGTTGCG
back to top

protein sequence of SMED30033478-orf-1

>SMED30033478-orf-1 ID=SMED30033478-orf-1|Name=SMED30033478-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1097bp
MNNQKYSIFDVNSLRKIKTSQAQGKLKIVSRYLQNIPCKVNCTYDCNKDF
DGLKVSPDVSNYVIVDTEYLMNFSEVLELLDNIGFIITLSTMRYIQNYNR
RLYYKLKKLFEDPAKSIILFQNEFHQECFITQKEDEDTLNYITRLNFIAS
QFYLSHLNYQPTVVFLTGNTDVALLQYSNYMRKAGMDTSLNVEIMTIKEY
LVNYHKDNFSTMELVDSLEAAFDCIKNSDANIPQELRVDAMQEYLSDEVL
ARSVNSGDFLKGIIRVNKFKSRDEATVVLSEGNSTKQMMALHSEVLIQGQ
FNRNRAIDGDCVVLMILPESQWINKKLEISGSEASAELALPVAEQAENET
IDSSSTKTPTGRVVGISRRNWRDYVCSFEKSDLNSGQYVLVTPYDRRIPM
IRIGITSADKLINHRFIVRIDGWPLSSRYPNGHFVESIGVIGDLETETRT
LLIEYNLYNRPFTTSQLAELPINTKENPWKMNPEEVSKRRDLRELLIFSI
DPIGCQDVDDTLSIRKLANGNLELGVHIADVTHFVKPHSLLDLEARKRST
SIYMADRRFDMLPHVLSGDLCSLWSDVDRYAVSVVWELTPDIEVVSVDYF
RSVIRSSYKLHYELAQDIYDSKIDFETSLGLIPELASKHKAFKDGAERFQ
QLKSAVTMLINVSSILKSRRIEAGGLELEGMEVQVKFSDPERTKLEDLHQ
KEPLEVHETIAECMIFANHWVAKKCLENYPTRSCLRHHPSPRMDHFVELI
HCATTKGFTINFSSNLELAKSLDLAVDNQDMETNKILRSLATMAMSNAQY
FSTGMLKAEDYYHYGLALPTYTHFTSPIRRYADILVHRILLCSIEGVPEE
SLLTNSSLADQCNIMNNQHRQAQLVQRASIELFQAMFFRNKAQDDIARYT
EGVIVKLRSNGFVVHIPRYGIKGSVFLRKQDKSIAWLKSRPEPLSNMEEV
YQTQWLSDNELTIETECYQQLINQITVVRAANQNRQTYKLFDRVFLRIDA
SESHSHGLSLQLEYVGQLRSGKQNAKLPTGDDVTDRLSKDDLFQNVREAN
DMKVKKRKYVEEEEIDESVLIASLHSNTSLCHLFRQFKIRKLGISL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0004540ribonuclease activity
GO:00001753'-5'-exoribonuclease activity
GO:0004527exonuclease activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001900RNase_II/R
IPR041505Dis3_CSD2
IPR033770RRP44_S1
IPR031192DIS3L
IPR022966RNase_II/R_CS
IPR012340NA-bd_OB-fold
Vocabulary: biological process
TermDefinition
GO:0016075rRNA catabolic process
GO:0090503RNA phosphodiester bond hydrolysis, exonucleolytic
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001900Ribonuclease II/RSMARTSM00955RNB_2coord: 489..846
e-value: 8.1E-109
score: 377.5
IPR001900Ribonuclease II/RPFAMPF00773RNBcoord: 489..840
e-value: 1.6E-86
score: 290.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.1010coord: 21..210
e-value: 1.7E-20
score: 75.4
NoneNo IPR availableGENE3DG3DSA:2.40.50.690coord: 234..370
e-value: 3.7E-20
score: 73.7
NoneNo IPR availableGENE3DG3DSA:2.40.50.700coord: 371..442
e-value: 7.7E-23
score: 82.0
NoneNo IPR availablePANTHERPTHR23355RIBONUCLEASEcoord: 48..1063
NoneNo IPR availableCDDcd09862PIN_Rrp44-likecoord: 22..200
e-value: 8.85005E-30
score: 114.61
IPR041505Dis3-like cold-shock domain 2PFAMPF17849OB_Dis3coord: 388..456
e-value: 1.3E-20
score: 73.2
IPR033770Exosome complex exonuclease RRP44, S1 domainPFAMPF17215Rrp44_S1coord: 900..1003
e-value: 8.0E-7
score: 28.9
IPR031192DIS3-like exonuclease 1PANTHERPTHR23355:SF30DIS3-LIKE EXONUCLEASE 1coord: 48..1063
IPR022966Ribonuclease II/R, conserved sitePROSITEPS01175RIBONUCLEASE_IIcoord: 813..837
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 412..890
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 242..438
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 899..1008