Plasminogen

Overview
NamePlasminogen
Smed IDSMED30033477
Length (bp)3746
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plasminogen (SMED30033477) t-SNE clustered cells

Violin plots show distribution of expression levels for Plasminogen (SMED30033477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plasminogen (SMED30033477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plasminogen (SMED30033477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033477

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30033477h1SMcG0006226 SmedASXL_010099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033477h1SMcG0006225 SmedASXL_010099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033477h1SMcG0006225 SmedASXL_009350SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033477h1SMcG0006226 SmedASXL_010099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033477h1SMcG0006225 SmedASXL_010099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30033477h1SMcG0006225 SmedASXL_009350SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006226 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006226 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006225 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006225 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30033477h1SMcG0006225 dd_Smed_v4_5927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006227 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006227 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006226 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006226 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006225 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006225 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30033477h1SMcG0006225 dd_Smed_v4_5927_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006227 Contig34732uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033477h1SMcG0006227 Contig34732newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033477h1SMcG0006226 dd_Smed_v4_9220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033477h1SMcG0006225 dd_Smed_v4_9220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033477h1SMcG0006226 dd_Smed_v4_9220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30033477h1SMcG0006225 dd_Smed_v4_9220_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plasminogen vs. Ensembl Human
Match: LPA (lipoprotein(a) [Source:HGNC Symbol;Acc:HGNC:6667])

HSP 1 Score: 139.428 bits (350), Expect = 2.315e-32
Identity = 226/893 (25.31%), Postives = 316/893 (35.39%), Query Frame = 1
Query:  193 PALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCK-TPCS-------------------------------GIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWC--------WLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTS----------GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCRTTVAGTE---------------YTGTISTTAKGDTCTLWSSVTNGNFNDSS--FPDGSAANAVNYCRNLPRSNLPGPFCF-VGP-------NRVMCVVPMCNTATCRTTV--------------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC---------TPQC---------------RNSQTATD--------YAGIVNRTNSG-VCMFWTDP-RNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCSPTQG-------------------------------CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDA--QNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCY-----------------------TFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            PA  P+A L    NYCRNPD      WCY T+ +    +YC  T CS                               G+  C +   G  Y+G  S T    TC  WSS  + + ++  PEN  +     NYCRNP      PWC        W   +L +              +P  +T A +    +  S          G  Y G+ + T     C  W++      P++++             NYCRNP+A+ S PWCYT   N   EYC + +C  T  + +  +   +  A TE               Y G+ STT  G TC  WSS+T      ++  +P+G      NYCRN P + +  P+C+ + P       N   C V      T  T V                          +G SY GT + + +G  C  W++++       P Y+P+  +   +NYCR+P   +    P+CYT   +   E CN++ C         TP                   S    D        Y GI + T +G  C  W+    + + R P+    A L +  NYCRNPDS    PWCY         YC L  CS T+                                CY   N  +Y G  + T  G +C  WS   P             Q  P+    D    NYCR P   +     PWC+  +P +       + YCN+T C+                           F N   Y G   TT  GTPC  W+            P+  S+ +P     A    NYCR P  D   IN PWCY      L       F +C I  C +++ 
Sbjct:  976 PAYYPNAGL--IKNYCRNPD-PVAAPWCYTTDPS-VRWEYCNLTRCSDAEWTAFVPPNVILAPSLEAFFEQALTEETPGVQDCYY-HYGQSYRGTYSTTVTGRTCQAWSSM-TPHQHSRTPENYPNAGLTRNYCRNPDAEIR-PWCYTMDPSVRWEYCNLTQCLVTESSVLATLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSM----TPHWHQRTTEYYPNGGLTRNYCRNPDAEIS-PWCYTMDPNVRWEYCNLTQCPVTESSVLATSTAVSEQAPTEQSPTVQDCYHGDGQSYRGSFSTTVTGRTCQSWSSMTPHWHQRTTEYYPNGGLTR--NYCRN-PDAEI-RPWCYTMDPSVRWEYCNLTQCPVMESTLLTTPTVVPVPSTELPSEEAPTENSTGVQDCYRGDGQSYRGTLSTTITGRTCQSWSSMTPHWHRRIPLYYPNAGLT--RNYCRNPDAEIR---PWCYTMDPSVRWEYCNLTRCPVTESSVLTTPTVAPVPSTEAPSEQAPPEKSPVVQDCYHGDGRSYRGISSTTVTGRTCQSWSSMIPHWHQRTPENYPNAGLTE--NYCRNPDSG-KQPWCYTTDPCVRWEYCNLTQCSETESGVLETPTVVPVPSMEAHSEAAPTEQTPVVRQCY-HGNGQSYRGTFSTTVTGRTCQSWSSMTP----------HRHQRTPENYPNDGLTMNYCRNPDADTG----PWCFTMDPSIR------WEYCNLTRCSDTEGTVVAPPTVIQVPSLGPPSEQDCMFGNGKGYRGKKATTVTGTPCQEWAAQE---------PHRHSTFIPGTNKWAGLEKNYCRNPDGD---INGPWCYTMNPRKL-------FDYCDIPLCASSSF 1804          

HSP 2 Score: 105.916 bits (263), Expect = 3.235e-22
Identity = 221/904 (24.45%), Postives = 316/904 (34.96%), Query Frame = 1
Query:  193 PALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCK-TPCS-------------------------------GIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANAN---NYCRNPTNNTGGPWCWLQSDLNKFGF-------------------XXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKC-----FTTTPATITR------------NNCRTTVA------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCN----TATCRTTV---------------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC-------------TP----QCRNSQTATD---------------YAGIVNRTNSG-VCMFWTD-PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSP-------------------------------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC----------------------------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCP 2250
            P   P+A L    NYCRNPD      +CY T       +YC  T CS                               G+  C +   G  Y+G  S T    TC  WSS  + ++++  PE    NA    NYCRNP +    P+C+ +    ++ +                     +P+ +      P     G   C    +G  Y GT + T     C  W++ T   + +   P  +  A +  + NYCRNP+A  + P+CYT       EYC + +C         P T+T                R  V       G  Y GT STT  G TC  WSS+T  + + +     +A   +NYCRN     +  P+C+    G     C +  C+    TA    TV                            G SY GT + + +G  C  W++++  S    P Y+P+  ++   NYCR+P  V +   P+CYT   +   E CN++ C             TP    +  + Q  T+               Y G    T +G  C  W+    + + R P     A L    NYCRNPD     PWCY  +  V+  YC L  CS                                 Q CY      +Y G  + T  G +C  WS   P         S   +  P+A  T  +NYCR P  +      PWCY  +P V       + YCN+T C                                    CY  +  S Y G  +TT  G  C  WS+M      +       +   P+  +    NYCR P  +I     PWCY    +V        + +C +  CP
Sbjct:  406 PEYYPNAGL--IMNYCRNPDA-VAAPYCY-TRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQEC-YHGNGQSYRGTYSTTVTGRTCQAWSSM-TPHSHSRTPEY-YPNAGLIMNYCRNP-DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHG-NGQSYRGTYSTTVTGRTCQAWSSMTP--HSHSRTPEYYPNAGL--IMNYCRNPDAV-AAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNP--DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIM--NYCRNPDPVAA---PYCYTRDPSVRWEYCNLTQCSDAEGTAVAPPTITPIPSLEAPSEQAPTEQRPGVQECYHGNGQSYQGTYFITVTGRTCQAWSSMTPHSHSRTPAYYPNAGL--IKNYCRNPDPV-AAPWCYTTDPSVRWEYCNLTRCSDAEWTAFVPPNVILAPSLEAFFEQALTEETPGVQDCYYHYGQ-SYRGTYSTTVTGRTCQAWSSMTPHQH------SRTPENYPNAGLT--RNYCRNPDAEI----RPWCYTMDPSVR------WEYCNLTQCLVTESSVLATLTVVPDPSTEASSEEAPTEQSPGVQDCYHGDGQS-YRGSFSTTVTGRTCQSWSSMTPHWHQR------TTEYYPNGGLT--RNYCRNPDAEIS----PWCYTMDPNV-------RWEYCNLTQCP 1246          

HSP 3 Score: 104.76 bits (260), Expect = 8.201e-22
Identity = 205/828 (24.76%), Postives = 301/828 (36.35%), Query Frame = 1
Query:  331 GIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANAN---NYCRNPTNNTGGPWCWLQSDLNKFGF-------------------XXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKC-----FTTTPATITR------------NNCRTTVA------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCN----TATCRTTV---------------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC-------------TP----QCRNSQTATD---------------YAGIVNRTNSG-VCMFWTD-PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQG-------------------------------CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT----------------------------------SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTA 2256
            G+  C +   G  Y+G  S T    TC  WSS  + ++++  PE    NA    NYCRNP +    P+C+ +    ++ +                     +P+ +      P     G   C    +G  Y GT + T     C  W++ T   + +   P  +  A +  + NYCRNP+A  + P+CYT       EYC + +C         P T+T                R  V       G  Y GT STT  G TC  WSS+T  + + +     +A   +NYCRN     +  P+C+    G     C +  C+    TA    TV                            G SY GT + + +G  C  W++++  S    P Y+P+  ++   NYCR+P    +V  P+CYT       E CN++ C             TP    +  + Q  T+               Y G  + T +G  C  W+    + + R P+    A L    NYCRNPD+    P+CY  +  V+  YC L  CS  +G                               CY   N  +Y G  + T  G +C  WS   P       S S   +  P+A      NYCR P   +A    P+CY  +P V       + YCN+T C+                                   CY   N   Y G  +TT  G  C  WS+M   S S+   P Y     P+  ++   NYCR P      +  P+CY    SV        + +C +  C  A
Sbjct:  138 GVQEC-YHGNGQSYRGTYSTTVTGRTCQAWSSM-TPHSHSRTPEY-YPNAGLIMNYCRNP-DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHG-NGQSYRGTYSTTVTGRTCQAWSSMTP--HSHSRTPEYYPNAGL--IMNYCRNPDAV-AAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNP--DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIM--NYCRNPD---AVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL--IMNYCRNPDAV-AAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECY-HGNGQSYRGTYSTTVTGRTCQAWSSMTPH------SHSRTPEYYPNAGLI--MNYCRNPDAVAA----PYCYTRDPGVR------WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECY-HGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRT--PEY----YPNAGLIM--NYCRNPDP----VAAPYCYTRDPSV-------RWEYCNLTQCSDA 906          

HSP 4 Score: 104.375 bits (259), Expect = 1.112e-21
Identity = 201/822 (24.45%), Postives = 295/822 (35.89%), Query Frame = 1
Query:  349 FDRTGSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGF-------------------XXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKC-----FTTTPATITR------------NNCRTTVA------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCN----TATCRTTV---------------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC-------------TP----QCRNSQTATD---------------YAGIVNRTNSG-VCMFWTD-PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQG-------------------------------CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT----------------------------------SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTA 2256
            +   G  Y+G  S T    TC  WSS        T  N+P   +    NYCRNP +    P+C+ +    ++ +                     +P+ +      P     G   C    +G  Y GT + T     C  W++ T   + +   P  +  A +  + NYCRNP+A  + P+CYT       EYC + +C         P T+T                R  V       G  Y GT STT  G TC  WSS+T  + + +     +A   +NYCRN     +  P+C+    G     C +  C+    TA    TV                            G SY GT + + +G  C  W++++  S    P Y+P+  ++   NYCR+P    +V  P+CYT       E CN++ C             TP    +  + Q  T+               Y G  + T +G  C  W+    + + R P+    A L    NYCRNPD+    P+CY  +  V+  YC L  CS  +G                               CY   N  +Y G  + T  G +C  WS   P       S S   +  P+A      NYCR P   +A    P+CY  +P V       + YCN+T C+                                   CY   N   Y G  +TT  G  C  WS+M   S S+   P Y     P+  ++   NYCR P      +  P+CY       ++  G  + +C +  C  A
Sbjct:   29 YHGDGQSYRGTYSTTVTGRTCQAWSSMTPHQHNRTTENYPNAGLIM--NYCRNP-DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHG-NGQSYRGTYSTTVTGRTCQAWSSMTP--HSHSRTPEYYPNAGL--IMNYCRNPDAV-AAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIMNYCRNP--DAVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGLIM--NYCRNPD---AVAAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECYHGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRTPEYYPNAGL--IMNYCRNPDAV-AAPYCYTRDPGVRWEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECY-HGNGQSYRGTYSTTVTGRTCQAWSSMTPH------SHSRTPEYYPNAGLI--MNYCRNPDAVAA----PYCYTRDPGVR------WEYCNLTQCSDAEGTAVAPPTVTPVPSLEAPSEQAPTEQRPGVQECY-HGNGQSYRGTYSTTVTGRTCQAWSSMTPHSHSRT--PEY----YPNAGLIM--NYCRNPDA----VAAPYCY-------TRDPGVRWEYCNLTQCSDA 792          
BLAST of Plasminogen vs. Ensembl Human
Match: PLG (plasminogen [Source:HGNC Symbol;Acc:HGNC:9071])

HSP 1 Score: 127.102 bits (318), Expect = 5.445e-29
Identity = 137/488 (28.07%), Postives = 203/488 (41.60%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTV-------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC--------------------TPQCRNSQ--TATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCS 1644
            G  Y+G +S T+   TC  WSS       ++ A  P   +    NYCRNP N+  GPWC+      ++ +C I  C                 C    SG  Y G I+ T +   C  W + +   + Y   P  F    + +  NYCRNP+ +   PWC+TT  N+  E C IP+C T  P++     C     G  Y G ++ T  G TC  WS+ T    N +  +FP  +     NYCRN        P+C    ++V    C +P C+++   T                     +G SY GT + + +G  C  W++++    +  P  +P+  +    NYCR+P    +  GP+C+T+  +   E CN+  C                    TP   +        Y G    T +G  C  W   +P   +   P+    A LE   NYCRNPD D  GPWCY  +  K+  YC +P C+
Sbjct:  108 GKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC--------------EEECMH-CSGENYDGKISKTMSGLECQAWDSQSPHAHGYI--PSKFPNKNLKK--NYCRNPDRELR-PWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGT-GENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDE--NYCRNP--DGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTM--NYCRNPD---ADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLE--KNYCRNPDGDVGGPWCYTTNPRKLYDYCDVPQCA 561          

HSP 2 Score: 122.479 bits (306), Expect = 1.625e-27
Identity = 146/506 (28.85%), Postives = 202/506 (39.92%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC----------SPT---------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYT-----------------------FENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G  Y GT+S T  G TC  WSS +     F+ ++ P  S     NYCRN P ++  GP+C+   P +    C +  C       +  G +Y G  + + SGL C  W + S       P+ FP++++   KNYCR+P   L    P+C+T+      E C+I  CT          QC    T  +Y G V  T SG  C  W+   P   N R P+      L++  NYCRNPD     PWC+   SQV+  YC++P C          +PT         Q CY   +  +Y G  + T  G  C  WS   P     +       +  P+A  T   NYCR P         PWC+ ++P V       + YCN+  C+                           F N   Y G   TT  GTPC  W+            P+  S   P+    A    NYCR P  D+G    PWCY +    L       + +C +  C
Sbjct:  108 GKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHP--SEGLEENYCRN-PDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCS--GENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNL--KKNYCRNPDRELR---PWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKG-TGENYRGNVAVTVSGHTCQHWSAQTPHTHN-RTPENFPCKNLDE--NYCRNPDGK-RAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCY-HGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKT------PENYPNAGLT--MNYCRNPDADKG----PWCFTTDPSVR------WEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQE---------PHRHSIFTPETNPRAGLEKNYCRNPDGDVG---GPWCYTTNPRKL-------YDYCDVPQC 560          

HSP 3 Score: 121.709 bits (304), Expect = 2.589e-27
Identity = 142/506 (28.06%), Postives = 201/506 (39.72%), Query Frame = 1
Query:  637 STTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTA--------TCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQTATDYAG---------IVNRTNSG----------------VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCSPTQGCYTQ--------------------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
             T +G  Y GT++ T N   C  W++T+  + P F+ P    +  + E  NYCRNP+ DP GPWCYTT   +  +YC I +C            C    +G  Y G IS T  G  C  W S +     +  S FP+ +     NYCRN  R     P+CF   PN+   +C +P C T          C     G +Y G  A++ SG  C  W+  +    +  P  FP +++   +NYCR+P    +   P+C+T  S    E C I    P C +S  +T+            +V     G                 C  W+    + + + P+    A L    NYCRNPD+D  GPWC+  +  V+  YC L  CS T+                          N   Y G    T  G  C  W+   P          F  +  P A     +NYCR P       G PWCY + P+        + YC+V  C +
Sbjct:  104 KTGNGKNYRGTMSKTKNGITCQKWSSTSP-HRPRFS-PATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPEKRYDYCDILEC---------EEEC-MHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKK--NYCRNPDRELR--PWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGT-GENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNL--DENYCRNPDGKRA---PWCHTTNSQVRWEYCKI----PSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGL--TMNYCRNPDAD-KGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSI-----FTPETNPRAGL--EKNYCRNPDGD---VGGPWCYTTNPR------KLYDYCDVPQCAA 562          

HSP 4 Score: 109.383 bits (272), Expect = 1.776e-23
Identity = 143/466 (30.69%), Postives = 189/466 (40.56%), Query Frame = 1
Query:  178 NPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKY-------CKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFT----------TTPATITR--NNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTT---------------VE-----------GYSYAGTQAISKSGLPCLLWTNISVTSIEPN----YFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
             P F PA  P   L +  NYCRNPDND  G WCY T+     K+Y       C+  C          +G  Y G +S T     C  W S+      Y  + FP  ++    NYCRNP      PWC+      ++  C IP C   PP    T      T      G  Y G +A+T + + C  W+  T   +   NR P  F    + E  NYCRNP+     PWC+TT      EYC IP C +          T P  +T    +C     G  Y GT STT  G  C  WSS+T      +     +A   +NYCRN P ++  GP+CF     V      CN   C  T               VE           G  Y G +A + +G PC  W      + EP+    + P+ +  A   KNYCR+P     V GP+CYT+      + C++  C
Sbjct:  134 RPRFSPATHPSEGLEE--NYCRNPDNDPQGPWCYTTDPE---KRYDYCDILECEEEC-------MHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNL--KKNYCRNPDREL-RPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGT------GENYRGNVAVTVSGHTCQHWSAQTPHTH---NRTPENFPCKNLDE--NYCRNPDGK-RAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHG-DGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRN-PDADK-GPWCFTTDPSVR--WEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEEDCMFGNGKGYRGKRATTVTGTPCQDW-----AAQEPHRHSIFTPETNPRAGLEKNYCRNPDG--DVGGPWCYTTNPRKLYDYCDVPQC 560          

HSP 5 Score: 97.8265 bits (242), Expect = 5.777e-20
Identity = 113/408 (27.70%), Postives = 173/408 (42.40%), Query Frame = 1
Query: 1168 TVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCS-------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS----------------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCP--TAAIINP 2271
            T  G +Y GT + +K+G+ C  W++ S       P   P + +   +NYCR+P N     GP+CYT+      + C+I  C  +C +  +  +Y G +++T SG+ C  W    P    +   +  N        NYCRNPD + L PWC+     K +  C +P C+       PT  C  +     Y GN+ VT +G +C  WS   P   + +   +F  + L        +NYCR P  + A    PWC+ +  QV       + YC +  C S                      CY  +  S Y G ++TT+ G  C  WS+M      K +  NY ++ L         NYCR P  D G    PWC+ +  SV        + +C +  C    A+++ P
Sbjct:  105 TGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGL--EENYCRNPDN--DPQGPWCYTTDPEKRYDYCDILECEEECMHC-SGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNL---KKNYCRNPDRE-LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCL-KGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE-NFPCKNL-------DENYCRNPDGKRA----PWCHTTNSQVR------WEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQS-YRGTSSTTTTGKKCQSWSSMTPHRHQK-TPENYPNAGL-------TMNYCRNPDADKG----PWCFTTDPSV-------RWEYCNLKKCSGTEASVVAP 464          
BLAST of Plasminogen vs. Ensembl Human
Match: HGF (hepatocyte growth factor [Source:HGNC Symbol;Acc:HGNC:4893])

HSP 1 Score: 116.701 bits (291), Expect = 6.952e-26
Identity = 109/359 (30.36%), Postives = 155/359 (43.18%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS-----------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            +G SY GT +I+KSG+ C  W+  S+   E ++ P   +     +NYCR+P       GP+C+TS      E C+I    PQC   +  T     Y G+++ T SG +C  W    P    F  P+       +D  NYCRNPD  P  PWCY L+   +  YC +  C+            T  C  Q     Y G +N   NG+ C +W    P   D +   +F  + L        +NYCR P      S SPWC+ ++P +     S    C+++    CY   N   Y G  + T +G  C +W   NM  L +           PD + +   NYCR P  D    + PWCY
Sbjct:  132 KGRSYKGTVSITKSGIKCQPWS--SMIPHEHSFLPSSYRGKDLQENYCRNPRG--EEGGPWCFTSNPEVRYEVCDI----PQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFL-PERYPDKGFDD--NYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC-IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMT-PENFKCKDL-------RENYCRNPDG----SESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYR-GNGKNYMGNLSQTRSGLTCSMWDK-NMEDLHRH------IFWEPDASKL-NENYCRNPDDD---AHGPWCY 453          

HSP 2 Score: 115.931 bits (289), Expect = 1.180e-25
Identity = 102/351 (29.06%), Postives = 150/351 (42.74%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRVM--CVVPMCNTATCRTTV-----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQ-------TATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLL---NAAKLEDAANYCRNPDSDPLGPWCY 1599
             G  Y GT++IT +   C PW++     + +   P  ++   + E  NYCRNP  +  GPWC+T+     Y  C IP+C        +   C  T  G  Y G +  T  G  C  W   T     F    +PD    +  NYCRN      P P+C+ + P+     C +  C   T   T            +G  Y GT     +G+PC  W +       + P  F  + +   +NYCR+P    S   P+C+T   T     + YC+  P C  S           +Y G +++T SG+ C  W   +N+   +  +    +A+KL +  NYCRNPD D  GPWCY
Sbjct:  132 KGRSYKGTVSITKSGIKCQPWSSMIPHEHSFL--PSSYRGKDLQE--NYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQC--------SEVEC-MTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDD--NYCRNP--DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDL--RENYCRNPDGSES---PWCFT---TDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWD--KNMEDLHRHIFWEPDASKLNE--NYCRNPDDDAHGPWCY 453          

HSP 3 Score: 101.679 bits (252), Expect = 3.576e-21
Identity = 94/303 (31.02%), Postives = 132/303 (43.56%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFVG 1113
             NYCRNP  +  G WC+ +N      + C  P CS +  C+    G  Y+G++  TE  + C  W  + + + +   PE        +NYCRNP +    PWC+      ++ +C I TC                  Q    G  Y GT+    N  PC  W   + + + +   P  FK   + E  NYCRNP+   S PWC+TT  N    YC+ IP C  +      R N      G  Y G +S T  G TC++W      + +   F  PD S  N  NYCRN P  +  GP+C+ G
Sbjct:  174 ENYCRNPRGEEGGPWCFTSN-PEVRYEVCDIPQCSEV-ECM-TCNGESYRGLMDHTESGKICQRWDHQ-TPHRHKFLPERYPDKGFDDNYCRNP-DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEG--YRGTVNTIWNGIPCQRW--DSQYPHEHDMTPENFKCKDLRE--NYCRNPDGSES-PWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGN------GKNYMGNLSQTRSGLTCSMWDKNME-DLHRHIFWEPDASKLNE-NYCRN-PDDDAHGPWCYTG 455          

HSP 4 Score: 100.523 bits (249), Expect = 9.223e-21
Identity = 118/435 (27.13%), Postives = 173/435 (39.77%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANAN---NYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC----FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSS-------VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN-RV--MCVVPMCNTATCRTTVE--GYSYAGTQAISKSGLPCLLW-TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC----TP----------QCRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDA 1548
            G  Y+G VS+T+    C  WSS   I    +F  +S    +   NYCRNP    GGPWC+  +   ++                         C  T +G  Y G +  T +   C  W   T    P+ ++ +  +        NYCRNP+  P  PWCYT   +   EYC I  C       T   +    C     G  Y GT++T   G  C  W S       +T  NF      +       NYCRN   S    P+CF   PN RV     +P C+ +  +      G +Y G  + ++SGL C +W  N+        + PD S +  +NYCR+P +     GP+CYT   L   + C IS C    TP           C  ++      GI  RTN G  +      ++ +RN  +   + ++++
Sbjct:  133 GRSYKGTVSITKSGIKCQPWSS--MIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRY-------------EVCDIPQCSEVECM-TCNGESYRGLMDHTESGKICQRWDHQT----PHRHKFLPERYPDKGFDDNYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC-IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRE-------NYCRNPDGSE--SPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKL-NENYCRNPDD--DAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMV------SLRYRNKHICGGSLIKES 527          

HSP 5 Score: 64.6994 bits (156), Expect = 9.666e-10
Identity = 73/261 (27.97%), Postives = 96/261 (36.78%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACL----------------FDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATIT 903
            F P   PD    D  NYCRNPD      WCY  +  H   +YC      I  C                     G  Y+G V+       C  W S+   + +   PEN        NYCRNP + +  PWC+      + G+C+                 GN        G  Y G ++ T +   C+ W           +R I ++        NYCRNP+ D  GPWCY  TGN     +YC I +C   T  TI 
Sbjct:  245 FLPERYPDKGFDD--NYCRNPDGQPRP-WCYTLD-PHTRWEYC-----AIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYP-HEHDMTPENFKCKDLRENYCRNP-DGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCY--RGN--------GKNYMGNLSQTRSGLTCSMWDKNMED----LHRHIFWEPDASKLNENYCRNPDDDAHGPWCY--TGNPLIPWDYCPISRCEGDTTPTIV 478          
BLAST of Plasminogen vs. Ensembl Human
Match: HGF (hepatocyte growth factor [Source:HGNC Symbol;Acc:HGNC:4893])

HSP 1 Score: 116.316 bits (290), Expect = 1.047e-25
Identity = 108/357 (30.25%), Postives = 153/357 (42.86%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS-----------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            +G SY GT +I+KSG+ C  W     +S+ P+    +     +NYCR+P       GP+C+TS      E C+I    PQC   +  T     Y G+++ T SG +C  W    P    F  P+       +D  NYCRNPD  P  PWCY L+   +  YC +  C+            T  C  Q     Y G +N   NG+ C +W    P   D +   +F  + L        +NYCR P      S SPWC+ ++P +     S    C+++    CY   N   Y G  + T +G  C +W   NM  L +           PD + +   NYCR P  D    + PWCY
Sbjct:  132 KGRSYKGTVSITKSGIKCQPW-----SSMIPHEHSYRGKDLQENYCRNPRG--EEGGPWCFTSNPEVRYEVCDI----PQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFL-PERYPDKGFDD--NYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC-IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMT-PENFKCKDL-------RENYCRNPDG----SESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYR-GNGKNYMGNLSQTRSGLTCSMWDK-NMEDLHRH------IFWEPDASKL-NENYCRNPDDD---AHGPWCY 448          

HSP 2 Score: 114.005 bits (284), Expect = 5.076e-25
Identity = 101/351 (28.77%), Postives = 147/351 (41.88%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRVM--CVVPMCNTATCRTTV-----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQ-------TATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLL---NAAKLEDAANYCRNPDSDPLGPWCY 1599
             G  Y GT++IT +   C PW++     + Y  + +           NYCRNP  +  GPWC+T+     Y  C IP+C        +   C  T  G  Y G +  T  G  C  W   T     F    +PD    +  NYCRN      P P+C+ + P+     C +  C   T   T            +G  Y GT     +G+PC  W +       + P  F  + +   +NYCR+P    S   P+C+T   T     + YC+  P C  S           +Y G +++T SG+ C  W   +N+   +  +    +A+KL +  NYCRNPD D  GPWCY
Sbjct:  132 KGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQ---------ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQC--------SEVEC-MTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDD--NYCRNP--DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDL--RENYCRNPDGSES---PWCFT---TDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWD--KNMEDLHRHIFWEPDASKLNE--NYCRNPDDDAHGPWCY 448          

HSP 3 Score: 101.679 bits (252), Expect = 3.303e-21
Identity = 94/303 (31.02%), Postives = 132/303 (43.56%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFVG 1113
             NYCRNP  +  G WC+ +N      + C  P CS +  C+    G  Y+G++  TE  + C  W  + + + +   PE        +NYCRNP +    PWC+      ++ +C I TC                  Q    G  Y GT+    N  PC  W   + + + +   P  FK   + E  NYCRNP+   S PWC+TT  N    YC+ IP C  +      R N      G  Y G +S T  G TC++W      + +   F  PD S  N  NYCRN P  +  GP+C+ G
Sbjct:  169 ENYCRNPRGEEGGPWCFTSN-PEVRYEVCDIPQCSEV-ECM-TCNGESYRGLMDHTESGKICQRWDHQ-TPHRHKFLPERYPDKGFDDNYCRNP-DGQPRPWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTECIQGQGEG--YRGTVNTIWNGIPCQRW--DSQYPHEHDMTPENFKCKDLRE--NYCRNPDGSES-PWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGN------GKNYMGNLSQTRSGLTCSMWDKNME-DLHRHIFWEPDASKLNE-NYCRN-PDDDAHGPWCYTG 450          

HSP 4 Score: 100.138 bits (248), Expect = 1.182e-20
Identity = 117/435 (26.90%), Postives = 170/435 (39.08%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC----FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSS-------VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN-RV--MCVVPMCNTATCRTTVE--GYSYAGTQAISKSGLPCLLW-TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC----TP----------QCRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDA 1548
            G  Y+G VS+T+    C  WSS       Y   +  EN       YCRNP    GGPWC+  +   ++                         C  T +G  Y G +  T +   C  W   T    P+ ++ +  +        NYCRNP+  P  PWCYT   +   EYC I  C       T   +    C     G  Y GT++T   G  C  W S       +T  NF      +       NYCRN   S    P+CF   PN RV     +P C+ +  +      G +Y G  + ++SGL C +W  N+        + PD S +  +NYCR+P +     GP+CYT   L   + C IS C    TP           C  ++      GI  RTN G  +      ++ +RN  +   + ++++
Sbjct:  133 GRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQEN-------YCRNPRGEEGGPWCFTSNPEVRY-------------EVCDIPQCSEVECM-TCNGESYRGLMDHTESGKICQRWDHQT----PHRHKFLPERYPDKGFDDNYCRNPDGQPR-PWCYTLDPHTRWEYCAIKTCADNTMNDTDVPLETTEC-IQGQGEGYRGTVNTIWNGIPCQRWDSQYPHEHDMTPENFKCKDLRE-------NYCRNPDGSE--SPWCFTTDPNIRVGYCSQIPNCDMSHGQDCYRGNGKNYMGNLSQTRSGLTCSMWDKNMEDLHRHIFWEPDASKL-NENYCRNPDD--DAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTRTNIGWMV------SLRYRNKHICGGSLIKES 522          

HSP 5 Score: 64.6994 bits (156), Expect = 9.963e-10
Identity = 73/261 (27.97%), Postives = 96/261 (36.78%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACL----------------FDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATIT 903
            F P   PD    D  NYCRNPD      WCY  +  H   +YC      I  C                     G  Y+G V+       C  W S+   + +   PEN        NYCRNP + +  PWC+      + G+C+                 GN        G  Y G ++ T +   C+ W           +R I ++        NYCRNP+ D  GPWCY  TGN     +YC I +C   T  TI 
Sbjct:  240 FLPERYPDKGFDD--NYCRNPDGQPRP-WCYTLD-PHTRWEYC-----AIKTCADNTMNDTDVPLETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYP-HEHDMTPENFKCKDLRENYCRNP-DGSESPWCFTTDPNIRVGYCSQIPNCDMSHGQDCY--RGN--------GKNYMGNLSQTRSGLTCSMWDKNMED----LHRHIFWEPDASKLNENYCRNPDDDAHGPWCY--TGNPLIPWDYCPISRCEGDTTPTIV 473          
BLAST of Plasminogen vs. Ensembl Human
Match: MST1 (macrophage stimulating 1 [Source:HGNC Symbol;Acc:HGNC:7380])

HSP 1 Score: 112.464 bits (280), Expect = 1.616e-24
Identity = 112/373 (30.03%), Postives = 149/373 (39.95%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-------SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP---NRVMCVVPMCNT-ATCR---TTV-----EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYT---SLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFWT--DPRNINF---RNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQ 1653
            GV Y GT+A T    PC  W+    F N +   P L          N+CRNP+ DP GPWCYTT     +  C I  C         R        G EY G +  T  G  C  W            G F D    D       NYCRN   S    P+C+       R  C +P C + A  R   TTV     +G  Y GT   + +G+PC  W   +    +  + P++       +N+CR+P      + P+C+T    +       I  CT   R           Y G V++T  GV C  W+   P    F     P     A+LE+  N+CRNPD D  GPWCY ++ +    YC L  C+  Q
Sbjct:  129 GVGYRGTMATTVGGLPCQAWSHK--FPNDHKYTPTLRNGLE----ENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSC---------REAACVWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGLDD-------NYCRNPDGSER--PWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTAGVPCQRWD--AQIPHQHRFTPEKYACKDLRENFCRNPD---GSEAPWCFTLRPGMRAAFCYQIRRCTDDVRPQDCYHGAGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEPH----AQLEE--NFCRNPDGDSHGPWCYTMDPRTPFDYCALRRCADDQ 466          

HSP 2 Score: 105.531 bits (262), Expect = 2.012e-22
Identity = 108/368 (29.35%), Postives = 147/368 (39.95%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF-PDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLW--TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----------DYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YC-QLPVCSPT---QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            G  Y GT++TT  G  C  WS       ND  + P        N+CRN P  +  GP+C+     V    C +  C  A C     G  Y G    ++SG  C  W   +      EP  F DQ +    NYCR+P      + P+CYT+      E C++  C  + +  Q AT           Y G  N T +GV C  W    P    F  P+      L +  N+CRNPD     PWC+ L   ++  +C Q+  C+     Q CY       Y G ++ T+ GV C +WS   P        P F     P A   +  N+CR P   S     PWCY  +P+        F YC +  C  
Sbjct:  129 GVGYRGTMATTVGGLPCQAWSHKFP---NDHKYTPTLRNGLEENFCRN-PDGDPGGPWCYTTDPAVRFQSCGIKSCREAAC-VWCNGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGL--DDNYCRNPD---GSERPWCYTTDPQIEREFCDLPRCGSEAQPRQEATTVSCFRGKGEGYRGTANTTTAGVPCQRWDAQIPHQHRF-TPEKYACKDLRE--NFCRNPDGSE-APWCFTLRPGMRAAFCYQIRRCTDDVRPQDCY-HGAGEQYRGTVSKTRKGVQCQRWSAETPH------KPQFTFTSEPHAQLEE--NFCRNPDGDSH---GPWCYTMDPRTP------FDYCALRRCAD 464          

HSP 3 Score: 88.1965 bits (217), Expect = 6.289e-17
Identity = 87/301 (28.90%), Postives = 121/301 (40.20%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YC-TIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
             N+CRNPD D  G WCY T+     +      C    AC++   G  Y+G V  TE    C  W  +      +    F +  +   +NYCRNP + +  PWC+      +  F       +          A   +C     G  Y GT   TT   PC  W        P+ +R    K A      N+CRNP+     PWC+T        +C  I +C       +   +C    AG +Y GT+S T KG  C  WS+ T     F  +S P   A    N+CRN P  +  GP+C+
Sbjct:  168 ENFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREA-ACVWC-NGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPGKFLDQGL--DDNYCRNP-DGSERPWCYTTDPQIEREF---CDLPRCGSEAQPRQEATTVSC-FRGKGEGYRGTANTTTAGVPCQRWDAQI----PHQHRFTPEKYACKDLRENFCRNPDGS-EAPWCFTLRPGMRAAFCYQIRRCTD----DVRPQDCYHG-AGEQYRGTVSKTRKGVQCQRWSAETPHKPQFTFTSEP--HAQLEENFCRN-PDGDSHGPWCY 446          

HSP 4 Score: 80.8777 bits (198), Expect = 1.083e-14
Identity = 74/264 (28.03%), Postives = 104/264 (39.39%), Query Frame = 1
Query: 1435 YAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISP-SFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            Y G +  T  G+ C  W+   P +  +  P L N   LE+  N+CRNPD DP GPWCY       +    + S  +      N   Y G ++ T++G  C +W    P        P  F+ Q L D       NYCR P      S  PWCY ++PQ+         +C++  C             SC+  +    Y G ANTT+ G PC  W    +    + +   Y    L         N+CR P         PWC+
Sbjct:  132 YRGTMATTVGGLPCQAWSHKFPNDHKY-TPTLRNG--LEE--NFCRNPDGDPGGPWCYTTDPAVRFQSCGIKSCREAACVWCNGEEYRGAVDRTESGRECQRWDLQHP--HQHPFEPGKFLDQGLDD-------NYCRNPDG----SERPWCYTTDPQIERE------FCDLPRCGSEAQPRQEATTVSCFRGKGEG-YRGTANTTTAGVPCQRWDA-QIPHQHRFTPEKYACKDL-------RENFCRNPDGS----EAPWCF 358          

HSP 5 Score: 56.6102 bits (135), Expect = 2.768e-7
Identity = 50/197 (25.38%), Postives = 71/197 (36.04%), Query Frame = 1
Query: 1669 NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAA 2259
            NN   Y G +  T  G+ C  WS   P   D   +P+  + L         +N+CR P       G PWCY ++P V   +      C    C  C    N   Y G  + T +G  C  W   +        G  ++   L D       NYCR P        +PWCY +   +  +       FC +  C + A
Sbjct:  127 NNGVGYRGTMATTVGGLPCQAWSHKFPN--DHKYTPTLRNGL--------EENFCRNPDGD---PGGPWCYTTDPAVRFQSCGIKS-CREAACVWC----NGEEYRGAVDRTESGRECQRWDLQHPHQHPFEPG-KFLDQGLDD-------NYCRNPDGS----ERPWCYTTDPQIERE-------FCDLPRCGSEA 286          
BLAST of Plasminogen vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 61.6178 bits (148), Expect = 3.845e-9
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT-TGNQEYCTIPKC 876
            SG +Y GT+A T++   CAPW  +T   +  FN   + +   +    NYCRNP    S PWCY+   G +EYC +P+C
Sbjct:  332 SGTQYEGTVAQTSSGKQCAPWIDST---SRDFN---VHRFPELMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 403          

HSP 2 Score: 50.8322 bits (120), Expect = 7.149e-6
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP--NRVMCVVPMC 1146
            +GT+Y GT++ T+ G  C  W   T+ +FN   FP+    N+ NYCRN P      P+C+  P      C VP C
Sbjct:  332 SGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRN-PGGKKSRPWCYSKPMGQEEYCDVPQC 403          
BLAST of Plasminogen vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 61.6178 bits (148), Expect = 4.020e-9
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT-TGNQEYCTIPKC 876
            SG +Y GT+A T++   CAPW  +T   +  FN   + +   +    NYCRNP    S PWCY+   G +EYC +P+C
Sbjct:  358 SGTQYEGTVAQTSSGKQCAPWIDST---SRDFN---VHRFPELMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 429          

HSP 2 Score: 50.8322 bits (120), Expect = 7.843e-6
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP--NRVMCVVPMC 1146
            +GT+Y GT++ T+ G  C  W   T+ +FN   FP+    N+ NYCRN P      P+C+  P      C VP C
Sbjct:  358 SGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRN-PGGKKSRPWCYSKPMGQEEYCDVPQC 429          
BLAST of Plasminogen vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 61.2326 bits (147), Expect = 4.116e-9
Identity = 31/78 (39.74%), Postives = 44/78 (56.41%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT-TGNQEYCTIPKC 876
            SG +Y GT+A T++   CAPW  +T   +  FN   + +   +    NYCRNP    S PWCY+   G +EYC +P+C
Sbjct:  199 SGTQYEGTVAQTSSGKQCAPWIDST---SRDFN---VHRFPELMNSKNYCRNPGGKKSRPWCYSKPMGQEEYCDVPQC 270          

HSP 2 Score: 50.8322 bits (120), Expect = 7.159e-6
Identity = 28/75 (37.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP--NRVMCVVPMC 1146
            +GT+Y GT++ T+ G  C  W   T+ +FN   FP+    N+ NYCRN P      P+C+  P      C VP C
Sbjct:  199 SGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPE--LMNSKNYCRN-PGGKKSRPWCYSKPMGQEEYCDVPQC 270          
BLAST of Plasminogen vs. Ensembl Zebrafish
Match: plg (plasminogen [Source:ZFIN;Acc:ZDB-GENE-030131-1411])

HSP 1 Score: 141.354 bits (355), Expect = 1.327e-33
Identity = 149/501 (29.74%), Postives = 205/501 (40.92%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSV--TNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTA--------TCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQ------------TATDYAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVC----------------SPTQGCYTQN---------------NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            G++Y GT + T +   C  W  T  F +     P  +  A +   +N+CRNP+ D  GPWCYTT   +  E+C I  C                 +G  Y G ISTT  G TC  W S    N  +  S+ PD       NYCRN      P P+CF   P++    C +P C T         TC  + EG SY GT +++ +G  C  WT+ S    S  P  +P + +    NYCR+P N  S   P+CYT+   T  E C++  C  Q R  +              + Y G+++ T SG  C FWT    + + + PQ    A L    N CRNPD D   PWCY  +  V+  YC +  C                +PTQ    Q+               N   Y G+ ++T  GV+C  W    P         SF  +  PD       N CR P +       PWCY ++P         + YC +  C S
Sbjct:  115 GMDYRGTKSKTKSGKTCQRWEGT--FPHVPNITPRAYPKADLE--SNFCRNPDGDKGGPWCYTTDPEKRWEHCNIQDCTEEC----------MQCSGENYRGKISTTVSGFTCQRWDSQQPQNHGYLPSALPDKYLEE--NYCRNP--DGEPRPWCFTTSPSKRWEACAIPRCTTEPPTIVPELTC-ASGEGSSYRGTISVTITGKTCQQWTSQSPHKHSRSPENYPCKGLDG--NYCRNPDNERS---PWCYTTDPETRWEYCSVPSCGDQPRPEEPVIPQGEECYEGDGSSYRGVMSETISGKKCQFWTSMEPHRHSKTPQNFPKADLR--RNLCRNPDGD-RAPWCYTTDPTVRWEYCNIERCDNRPNIQEPPAKPAATTPTQSTPAQSTPDQSAPSEKDCKNGNGAEYRGSTSMTVMGVTCQAWRSMTPHQH-----ASFTPETHPDKGL--ESNQCRNPDSD---VNGPWCYTTDPSKK------WDYCQIPDCES 572          

HSP 2 Score: 119.783 bits (299), Expect = 6.062e-27
Identity = 116/387 (29.97%), Postives = 164/387 (42.38%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCS-------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC--------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G  Y GT++ +KSG  C  W      V +I P  +P   + +  N+CR+P       GP+CYT+      E CNI  CT +C    +  +Y G ++ T SG  C  W    P+N  +  P  L    LE+  NYCRNPD +P  PWC+  S  K +  C +P C+       P   C +   + +Y G I+VT  G +C +W+   P     S SP        D       NYCR P N+     SPWCY ++P+        + YC+V  C                CY  +  S Y G  + T +G  C  W++M     SK    N+  + L         N CR P  D      PWCY +  +V        + +C I  C
Sbjct:  115 GMDYRGTKSKTKSGKTCQRWEGTFPHVPNITPRAYPKADLES--NFCRNPDG--DKGGPWCYTTDPEKRWEHCNIQDCTEECMQC-SGENYRGKISTTVSGFTCQRWDSQQPQNHGYL-PSALPDKYLEE--NYCRNPDGEPR-PWCFTTSPSKRWEACAIPRCTTEPPTIVPELTCASGEGS-SYRGTISVTITGKTCQQWTSQSP--HKHSRSPENYPCKGLDG------NYCRNPDNER----SPWCYTTDPETR------WEYCSVPSCGDQPRPEEPVIPQGEECYEGDGSS-YRGVMSETISGKKCQFWTSMEPHRHSKTPQ-NFPKADL-------RRNLCRNPDGD----RAPWCYTTDPTV-------RWEYCNIERC 453          

HSP 3 Score: 102.834 bits (255), Expect = 1.187e-21
Identity = 134/506 (26.48%), Postives = 198/506 (39.13%), Query Frame = 1
Query:   34 VNGVTNYLFKSQTAT----EQYLQSCVPWANIPLQYSN-QSATPTILTTSDIVNPIFH-----PALLPDASLSDASNYCRNPDNDTVGGWCYVTNG----THFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFT----TTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCN---------------TATCRTTVE-----------------GYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS 1362
             N  T+ + +  +A     ++YL  CV    I + Y   +S T +  T         H     P   P A L   SN+CRNPD D  G WCY T+      H   + C   C          +G  Y+G +S T    TC  W S   +   Y  +  P+  +    NYCRNP +    PWC+  S   ++       C          T     TC S   G  Y GTI++T     C  WT+ +   + +   P  +    +    NYCRNP+ + S PWCYTT      EYC++P C        P       C     G+ Y G +S T  G  C  W+S+     + +  +FP   A    N CRN P  +   P+C+     V    C +  C+               T T  T  +                 G  Y G+ +++  G+ C  W +++     S  P   PD+ + +  N CR+P +   V+GP+CYT+
Sbjct:   85 ANSKTDQILRRMSAALYEKKEYLLECV--NGIGMDYRGTKSKTKSGKTCQRWEGTFPHVPNITPRAYPKADLE--SNFCRNPDGDKGGPWCYTTDPEKRWEHCNIQDCTEEC-------MQCSGENYRGKISTTVSGFTCQRWDSQQPQNHGYLPSALPDKYL--EENYCRNP-DGEPRPWCFTTSPSKRW-----EACAIPRCTTEPPTIVPELTCAS-GEGSSYRGTISVTITGKTCQQWTSQSP--HKHSRSPENYPCKGLD--GNYCRNPDNERS-PWCYTTDPETRWEYCSVPSCGDQPRPEEPVIPQGEECYEG-DGSSYRGVMSETISGKKCQFWTSMEPHRHSKTPQNFP--KADLRRNLCRN-PDGDR-APWCYTTDPTVRWEYCNIERCDNRPNIQEPPAKPAATTPTQSTPAQSTPDQSAPSEKDCKNGNGAEYRGSTSMTVMGVTCQAWRSMTPHQHASFTPETHPDKGLES--NQCRNPDS--DVNGPWCYTT 556          
BLAST of Plasminogen vs. Ensembl Zebrafish
Match: mst1 (macrophage stimulating 1 [Source:ZFIN;Acc:ZDB-GENE-020806-3])

HSP 1 Score: 123.25 bits (308), Expect = 4.030e-28
Identity = 106/348 (30.46%), Postives = 145/348 (41.67%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSV--TNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP---NRVMCVVPMCNTATCRTTVEGYS----------YAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC---NISYC-----TPQCRNSQTATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY 1599
             G +Y G ++ TT+   C  W +      P+ +R     +AT     NYCRNP+ D  GPWCYTT   + Y  C IP+C         ++    T  G +Y G +  T  G  C  W         +    +PD S  +  NYCRN   S  P P+C+       R  C +  C     R     Y+          Y G    + SG+PC  W   +    E  +FP   +     +NYCR+P      + P+C+TSL    T     I  C        C N +   +Y G+V +T  G+ C  W+   P      NP+    A L D  NYCRNPD D  GPWCY
Sbjct:  115 KGEDYRGKVSTTTSGRTCQQWWSKF----PHDHR--WTPSATNGLELNYCRNPDGDRIGPWCYTTDPERRYESCNIPQC---------KDEVCITCNGEDYRGQVDHTVSGKECQRWDQQFPHQHIYQPEKYPDKSLDD--NYCRNPDAS--PVPWCYTTDPTMERESCDISKCPEFPKRRLRSSYTTNCFRGRGEDYRGKVNETTSGIPCQRWD--AQKPHEHPFFPKTYECKGLEENYCRNPD---GSEAPWCFTSLPEMRTALCLQIKRCADDIEAEDCYN-EIGKNYRGVVRKTRKGILCQKWSINTPHKTKI-NPKTHPEANLTD--NYCRNPDGDHHGPWCY 434          

HSP 2 Score: 102.834 bits (255), Expect = 9.698e-22
Identity = 110/391 (28.13%), Postives = 154/391 (39.39%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAA---NYCRNPDSDPLGPWCYLE--SQVKIYCQLPVC----------SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTI-CTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC--PTAAIINP 2271
            +G  Y G  + + SG  C  W   S    +  + P  +     NYCR+P       GP+CYT+      E+CNI    PQC++    T    DY G V+ T SG  C  W    +  F +  +    K  D +   NYCRNPD+ P+ PWCY    +  +  C +  C          S T  C+ +     Y G +N T +G+ C +W    P         ++  + L        +NYCR P    A    PWC+ S P++  +       C   I    CY  E    Y G    T  G  C  WS +N    +K++   +  + L D       NYCR P    G  + PWCY S            F +C I  C      II P
Sbjct:  115 KGEDYRGKVSTTTSGRTCQQW--WSKFPHDHRWTPSATNGLELNYCRNPDG--DRIGPWCYTTDPERRYESCNI----PQCKDEVCITCNGEDYRGQVDHTVSGKECQRW----DQQFPHQHIYQPEKYPDKSLDDNYCRNPDASPV-PWCYTTDPTMERESCDISKCPEFPKRRLRSSYTTNCF-RGRGEDYRGKVNETTSGIPCQRWDAQKPHEH-PFFPKTYECKGL-------EENYCRNPDGSEA----PWCFTSLPEMRTALCLQIKRCADDIEAEDCYN-EIGKNYRGVVRKTRKGILCQKWS-INTPHKTKINPKTHPEANLTD-------NYCRNPD---GDHHGPWCYTSDPKT-------EFDYCAIKQCAGEKVPIIGP 460          

HSP 3 Score: 98.9821 bits (245), Expect = 1.430e-20
Identity = 91/313 (29.07%), Postives = 133/313 (42.49%), Query Frame = 1
Query:  205 PDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITR-------NNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            P A+     NYCRNPD D +G WCY T+     +  C  P      C+    G  Y+G V  T   + C  W  +     IY    +P+ S+   +NYCRNP + +  PWC+      +   C I  C + P     ++   N        G +Y G +  TT+  PC  W       +P+F  P  ++   + E  NYCRNP+     PWC+T        ++P+  T     I R        +C   + G  Y G +  T KG  C  WS  T      N  + P+ +  +  NYCRN P  +  GP+C+
Sbjct:  147 PSATNGLELNYCRNPDGDRIGPWCYTTDPERRYES-CNIPQCKDEVCITC-NGEDYRGQVDHTVSGKECQRWDQQFPHQHIYQPEKYPDKSL--DDNYCRNP-DASPVPWCYTTDPTMERESCDISKCPEFPKRRLRSSYTTNCF---RGRGEDYRGKVNETTSGIPCQRWDAQKPHEHPFF--PKTYECKGLEE--NYCRNPDGS-EAPWCFT--------SLPEMRTALCLQIKRCADDIEAEDCYNEI-GKNYRGVVRKTRKGILCQKWSINTPHKTKINPKTHPEANLTD--NYCRN-PDGDHHGPWCY 434          

HSP 4 Score: 53.9138 bits (128), Expect = 1.313e-6
Identity = 38/121 (31.40%), Postives = 50/121 (41.32%), Query Frame = 1
Query:  226 ASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD--------RTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN-ANNYCRNPTNNTGGPWCWLQSDLNKFGF 561
              NYCRNPD  +   WC+ +     L +     C  I  C  D          G  Y+G+V  T K   C  WS      T  N   +  AN  +NYCRNP  +  GPWC+      +F +
Sbjct:  330 EENYCRNPDG-SEAPWCFTS-----LPEMRTALCLQIKRCADDIEAEDCYNEIGKNYRGVVRKTRKGILCQKWSINTPHKTKINPKTHPEANLTDNYCRNPDGDHHGPWCYTSDPKTEFDY 444          
BLAST of Plasminogen vs. Ensembl Zebrafish
Match: hgfa (hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GENE-041014-2])

HSP 1 Score: 114.39 bits (285), Expect = 2.492e-25
Identity = 105/360 (29.17%), Postives = 163/360 (45.28%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP-QCRNSQTATDYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSP--------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTD-AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNV--TICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            G +Y G ++ +K+G+ C  W N+SV   E N+ P +   +   +N+CR+P N    +GP+C+T LT T  + C +  C+  +C      T Y G ++ T SG  C  W   + + +   P       L+D  N+CRNP++D + PWCY   +     YC + VC          T  C+ +     Y G +NVT  GV+C +W          ++SP   S    +    D  +NYCR P      S  PWC+ ++ +V  +  +    C    +  T CY  +N   Y G  + T +G PC +WS       ++ +  +    L          N CR P RD    + PWCY S SS+
Sbjct:  118 GVNYKGRRSFTKTGITCQSW-NMSVPH-EHNFKPTRHKKSDLRQNFCRNPDN--DPNGPWCFTELTETRHQDCGLPQCSDVECMKCNGET-YRGPMDHTESGKECQRWDSQKPHKHTYQPHRHVGKGLDD--NFCRNPNND-VRPWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSCF-RGQGEGYRGTVNVTPAGVTCQRWD---------ALSPHIHSYTPHNYKCKDLRENYCRNPDG----SEIPWCFTTDAKVRKAFCTNIPRCESESSDSTECYE-DNGESYRGNLSKTRSGIPCGLWSDHTFRRDTRSAKASAGLEL----------NLCRNPDRD---KHGPWCYTSNSSI 441          

HSP 2 Score: 105.916 bits (263), Expect = 1.187e-22
Identity = 92/346 (26.59%), Postives = 147/346 (42.49%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYT--TTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCN---------TATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQT---------ATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY 1599
            SGV Y G  + T     C  W  +    + +  +P   K + + +  N+CRNP+ DP+GPWC+T  T    + C +P+C     + +    C     G  Y G +  T  G  C  W S                    N+CRN P +++  P+C+          C + +C+         T++C    +G  Y GT  ++ +G+ C  W  +S  + S  P+ +  + +   +NYCR+P      + P+C+   TT      ++CT  P+C +  +            Y G +++T SG+ C  W+D     FR       A      N CRNPD D  GPWCY
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNF--KPTRHKKSDLRQ--NFCRNPDNDPNGPWCFTELTETRHQDCGLPQC-----SDVECMKCN----GETYRGPMDHTESGKECQRWDSQKPHKHTYQPHRHVGKGLDDNFCRN-PNNDVR-PWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYTPHNYKCKDL--RENYCRNPD---GSEIPWCF---TTDAKVRKAFCTNIPRCESESSDSTECYEDNGESYRGNLSKTRSGIPCGLWSDH---TFRRDTRSAKASAGLELNLCRNPDRDKHGPWCY 435          

HSP 3 Score: 103.605 bits (257), Expect = 5.971e-22
Identity = 108/368 (29.35%), Postives = 153/368 (41.58%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC----------TPQCRNSQTATDYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQV-KIYC-QLPVC----SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            +G  Y G  S T  G TC  W+       N        +    N+CRN P ++  GP+CF          C +P C+   C     G +Y G    ++SG  C  W   S    +  Y P + +      N+CR+P+N +    P+CYT    T  E CNIS C          T  C   Q    Y G VN T +GV C  W     +I+   P       L +  NYCRNPD   + PWC+  +++V K +C  +P C    S +  CY ++N  +Y GN++ T++G+ C  WSD+       S   S   +L          N CR P         PWCY S   +       + YC +  C S
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNFKPTRHKKSDLRQNFCRN-PDNDPNGPWCFTELTETRHQDCGLPQCSDVEC-MKCNGETYRGPMDHTESGKECQRWD--SQKPHKHTYQPHRHVGKGLDDNFCRNPNNDVR---PWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSCFRGQ-GEGYRGTVNVTPAGVTCQRWDALSPHIHSYTPHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCESESSDSTECY-EDNGESYRGNLSKTRSGIPCGLWSDHTFRRDTRSAKASAGLEL----------NLCRNPDRDKH---GPWCYTSNSSIP------WDYCGLERCKS 453          

HSP 4 Score: 95.1301 bits (235), Expect = 2.224e-19
Identity = 95/315 (30.16%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA--NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCT-IPKCFTTTPATIT--RNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            F P     + L    N+CRNPDND  G WC+ T  T    + C  P CS +  C+    G  Y+G +  TE  + C  W S+   + +   P   +     +N+CRNP NN   PWC+       + +C I  C     +    T    ++C     G  Y GT+ +T     C  W   +   + Y   P  +K   + E  NYCRNP+     PWC+TT     + +CT IP+C + +  +     +N      G  Y G +S T  G  C LWS  T     D+     SA   +N CRN P  +  GP+C+
Sbjct:  147 FKPTRHKKSDLR--QNFCRNPDNDPNGPWCF-TELTETRHQDCGLPQCSDV-ECM-KCNGETYRGPMDHTESGKECQRWDSQ-KPHKHTYQPHRHVGKGLDDNFCRNP-NNDVRPWCYTMDKNTPWEYCNISVCDSDSDVEVEVT----SSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYT--PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCESESSDSTECYEDN------GESYRGNLSKTRSGIPCGLWSDHT--FRRDTRSAKASAGLELNLCRN-PDRDKHGPWCY 435          

HSP 5 Score: 80.4925 bits (197), Expect = 9.227e-15
Identity = 76/277 (27.44%), Postives = 114/277 (41.16%), Query Frame = 1
Query: 1423 TATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISP-SFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC-----------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA--ANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            +  +Y G  + T +G+ C  W  + P   NF+ P     + L    N+CRNPD+DP GPWC+ E     +  C LP CS  +    + N   Y G ++ T++G  C +W    P     +  P   + + L D       N+CR P N       PWCY  +          + YCN+++C           +SC+  +    Y G  N T  G  C  W  ++           ++ S  P N        NYCR P  D   I  PWC+ + + V
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNFK-PTRHKKSDLR--QNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDVE--CMKCNGETYRGPMDHTESGKECQRWDSQKP--HKHTYQPHRHVGKGLDD-------NFCRNPNNDV----RPWCYTMDKNTP------WEYCNISVCDSDSDVEVEVTSSCFRGQGEG-YRGTVNVTPAGVTCQRWDALS----------PHIHSYTPHNYKCKDLRENYCRNP--DGSEI--PWCFTTDAKV 354          

HSP 6 Score: 71.2478 bits (173), Expect = 5.542e-12
Identity = 68/243 (27.98%), Postives = 100/243 (41.15%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCK-TPCSG-------IWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKC 876
            + P       L D  N+CRNP+ND V  WCY  +  +   +YC  + C         + +  F   G  Y+G V+VT    TC  W +       YT  N+    +    NYCRNP + +  PWC+      +  FCT     ++           N        G  Y G ++ T +  PC  W+      +  F R      A+     N CRNP+ D  GPWCYT+  +   +YC + +C
Sbjct:  230 YQPHRHVGKGLDD--NFCRNPNND-VRPWCYTMD-KNTPWEYCNISVCDSDSDVEVEVTSSCFRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYTPHNYKCKDL--RENYCRNP-DGSEIPWCFTTDAKVRKAFCTNIPRCESESSDSTECYEDN--------GESYRGNLSKTRSGIPCGLWS------DHTFRRDTRSAKASAGLELNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERC 451          

HSP 7 Score: 51.6026 bits (122), Expect = 7.282e-6
Identity = 37/131 (28.24%), Postives = 54/131 (41.22%), Query Frame = 1
Query:  169 DIVNPIFHPALLPDASLSD-ASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWAC---------LFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCW 531
            D ++P  H     +    D   NYCRNPD   +  WC+ T+      K  K  C+ I  C          ++  G  Y+G +S T     C +WS   +   +    + S     N CRNP  +  GPWC+
Sbjct:  312 DALSPHIHSYTPHNYKCKDLRENYCRNPDGSEIP-WCFTTDA-----KVRKAFCTNIPRCESESSDSTECYEDNGESYRGNLSKTRSGIPCGLWSDH-TFRRDTRSAKASAGLELNLCRNPDRDKHGPWCY 435          
BLAST of Plasminogen vs. Ensembl Zebrafish
Match: hgfa (hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GENE-041014-2])

HSP 1 Score: 114.005 bits (284), Expect = 3.153e-25
Identity = 105/360 (29.17%), Postives = 163/360 (45.28%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP-QCRNSQTATDYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSP--------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTD-AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNV--TICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            G +Y G ++ +K+G+ C  W N+SV   E N+ P +   +   +N+CR+P N    +GP+C+T LT T  + C +  C+  +C      T Y G ++ T SG  C  W   + + +   P       L+D  N+CRNP++D + PWCY   +     YC + VC          T  C+ +     Y G +NVT  GV+C +W          ++SP   S    +    D  +NYCR P      S  PWC+ ++ +V  +  +    C    +  T CY  +N   Y G  + T +G PC +WS       ++ +  +    L          N CR P RD    + PWCY S SS+
Sbjct:  118 GVNYKGRRSFTKTGITCQSW-NMSVPH-EHNFKPTRHKKSDLRQNFCRNPDN--DPNGPWCFTELTETRHQDCGLPQCSDVECMKCNGET-YRGPMDHTESGKECQRWDSQKPHKHTYQPHRHVGKGLDD--NFCRNPNND-VRPWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSCF-RGQGEGYRGTVNVTPAGVTCQRWD---------ALSPHIHSYTPHNYKCKDLRENYCRNPDG----SEIPWCFTTDAKVRKAFCTNIPRCESESSDSTECYE-DNGESYRGNLSKTRSGIPCGLWSDHTFRRDTRSAKASAGLEL----------NLCRNPDRD---KHGPWCYTSNSSI 441          

HSP 2 Score: 106.301 bits (264), Expect = 8.552e-23
Identity = 102/387 (26.36%), Postives = 160/387 (41.34%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYT--TTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCN---------TATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQT---------ATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVC-SPTQGCYTQNNAWAYTGNINVTK 1710
            SGV Y G  + T     C  W  +    + +  +P   K + + +  N+CRNP+ DP+GPWC+T  T    + C +P+C     + +    C     G  Y G +  T  G  C  W S                    N+CRN P +++  P+C+          C + +C+         T++C    +G  Y GT  ++ +G+ C  W  +S  + S  P+ +  + +   +NYCR+P      + P+C+   TT      ++CT  P+C +  +            Y G +++T SG+ C  W+D     FR       A      N CRNPD D  GPWCY  S   I   YC L  C  P   C+         G + V +
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNF--KPTRHKKSDLRQ--NFCRNPDNDPNGPWCFTELTETRHQDCGLPQC-----SDVECMKCN----GETYRGPMDHTESGKECQRWDSQKPHKHTYQPHRHVGKGLDDNFCRN-PNNDVR-PWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYTPHNYKCKDL--RENYCRNPD---GSEIPWCF---TTDAKVRKAFCTNIPRCESESSDSTECYEDNGESYRGNLSKTRSGIPCGLWSDH---TFRRDTRSAKASAGLELNLCRNPDRDKHGPWCYT-SNSSIPWDYCGLERCGGPKPSCFIHKTT-RIVGGMRVQR 474          

HSP 3 Score: 102.064 bits (253), Expect = 1.809e-21
Identity = 107/366 (29.23%), Postives = 152/366 (41.53%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC----------TPQCRNSQTATDYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQV-KIYC-QLPVC----SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            +G  Y G  S T  G TC  W+       N        +    N+CRN P ++  GP+CF          C +P C+   C     G +Y G    ++SG  C  W   S    +  Y P + +      N+CR+P+N +    P+CYT    T  E CNIS C          T  C   Q    Y G VN T +GV C  W     +I+   P       L +  NYCRNPD   + PWC+  +++V K +C  +P C    S +  CY ++N  +Y GN++ T++G+ C  WSD+       S   S   +L          N CR P         PWCY S   +       + YC +  C
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNFKPTRHKKSDLRQNFCRN-PDNDPNGPWCFTELTETRHQDCGLPQCSDVEC-MKCNGETYRGPMDHTESGKECQRWD--SQKPHKHTYQPHRHVGKGLDDNFCRNPNNDVR---PWCYTMDKNTPWEYCNISVCDSDSDVEVEVTSSCFRGQ-GEGYRGTVNVTPAGVTCQRWDALSPHIHSYTPHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCESESSDSTECY-EDNGESYRGNLSKTRSGIPCGLWSDHTFRRDTRSAKASAGLEL----------NLCRNPDRDKH---GPWCYTSNSSIP------WDYCGLERC 451          

HSP 4 Score: 94.7449 bits (234), Expect = 2.760e-19
Identity = 95/315 (30.16%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA--NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCT-IPKCFTTTPATIT--RNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            F P     + L    N+CRNPDND  G WC+ T  T    + C  P CS +  C+    G  Y+G +  TE  + C  W S+   + +   P   +     +N+CRNP NN   PWC+       + +C I  C     +    T    ++C     G  Y GT+ +T     C  W   +   + Y   P  +K   + E  NYCRNP+     PWC+TT     + +CT IP+C + +  +     +N      G  Y G +S T  G  C LWS  T     D+     SA   +N CRN P  +  GP+C+
Sbjct:  147 FKPTRHKKSDLR--QNFCRNPDNDPNGPWCF-TELTETRHQDCGLPQCSDV-ECM-KCNGETYRGPMDHTESGKECQRWDSQ-KPHKHTYQPHRHVGKGLDDNFCRNP-NNDVRPWCYTMDKNTPWEYCNISVCDSDSDVEVEVT----SSC-FRGQGEGYRGTVNVTPAGVTCQRWDALSPHIHSYT--PHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDAKVRKAFCTNIPRCESESSDSTECYEDN------GESYRGNLSKTRSGIPCGLWSDHT--FRRDTRSAKASAGLELNLCRN-PDRDKHGPWCY 435          

HSP 5 Score: 80.1073 bits (196), Expect = 1.153e-14
Identity = 76/277 (27.44%), Postives = 115/277 (41.52%), Query Frame = 1
Query: 1423 TATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISP-SFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC-----------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA--ANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            +  +Y G  + T +G+ C  W  + P   NF+ P     + L    N+CRNPD+DP GPWC+ E     +  C LP CS  +    + N   Y G ++ T++G  C +W    P     +  P   + + L D       N+CR P N       PWCY  +        + + YCN+++C           +SC+  +    Y G  N T  G  C  W  ++           ++ S  P N        NYCR P  D   I  PWC+ + + V
Sbjct:  117 SGVNYKGRRSFTKTGITCQSWNMSVPHEHNFK-PTRHKKSDLR--QNFCRNPDNDPNGPWCFTELTETRHQDCGLPQCSDVE--CMKCNGETYRGPMDHTESGKECQRWDSQKP--HKHTYQPHRHVGKGLDD-------NFCRNPNNDV----RPWCYTMDKN------TPWEYCNISVCDSDSDVEVEVTSSCFRGQGEG-YRGTVNVTPAGVTCQRWDALS----------PHIHSYTPHNYKCKDLRENYCRNP--DGSEI--PWCFTTDAKV 354          

HSP 6 Score: 72.4034 bits (176), Expect = 2.930e-12
Identity = 70/256 (27.34%), Postives = 104/256 (40.62%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCK-TPCSG-------IWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCR 918
            + P       L D  N+CRNP+ND V  WCY  +  +   +YC  + C         + +  F   G  Y+G V+VT    TC  W +  S + ++  P N        NYCRNP + +  PWC+      +  FCT     ++           N        G  Y G ++ T +  PC  W+      +  F R      A+     N CRNP+ D  GPWCYT+  +   +YC + +C    P+       R
Sbjct:  230 YQPHRHVGKGLDD--NFCRNPNND-VRPWCYTMD-KNTPWEYCNISVCDSDSDVEVEVTSSCFRGQGEGYRGTVNVTPAGVTCQRWDAL-SPHIHSYTPHNYKCKDLRENYCRNP-DGSEIPWCFTTDAKVRKAFCTNIPRCESESSDSTECYEDN--------GESYRGNLSKTRSGIPCGLWS------DHTFRRDTRSAKASAGLELNLCRNPDRDKHGPWCYTSNSSIPWDYCGLERCGGPKPSCFIHKTTR 465          

HSP 7 Score: 51.2174 bits (121), Expect = 7.805e-6
Identity = 37/131 (28.24%), Postives = 54/131 (41.22%), Query Frame = 1
Query:  169 DIVNPIFHPALLPDASLSD-ASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWAC---------LFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCW 531
            D ++P  H     +    D   NYCRNPD   +  WC+ T+      K  K  C+ I  C          ++  G  Y+G +S T     C +WS   +   +    + S     N CRNP  +  GPWC+
Sbjct:  312 DALSPHIHSYTPHNYKCKDLRENYCRNPDGSEIP-WCFTTDA-----KVRKAFCTNIPRCESESSDSTECYEDNGESYRGNLSKTRSGIPCGLWSDH-TFRRDTRSAKASAGLELNLCRNPDRDKHGPWCY 435          
BLAST of Plasminogen vs. Ensembl Zebrafish
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 105.916 bits (263), Expect = 1.075e-22
Identity = 100/361 (27.70%), Postives = 152/361 (42.11%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLE--SQVKIYCQLPVCSPTQGCYTQN-------NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENV-SRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            G +Y G ++++KSG+ C LW   S    E N+ P +        N CR+P N  +  GP+C+T+      + C+I    PQC   +  T     Y G ++ T SG  C  W   +P    F +P+      L+D  NYCRNPD     PWC+    S    YC +  C        +N           Y G I +T +GV+C +W    P     +        L         +NYCR P  +      PWC+ ++P V  +  +    C V        ++ +   YNG  + T +G PC  W   + ++   +       +LL   T   A N+CR P +D    + PWCY + SS+
Sbjct:  112 GLNYKGKRSVTKSGVQCQLWN--SKMPHEHNFLPQRHKHRDLRDNLCRNPDNTTT--GPWCFTTDPKLRHQDCSI----PQCSEVECMTCNGESYRGPLDHTESGRECQRWDLEEPHKHIF-HPKRYPDKGLKD--NYCRNPDGRQR-PWCFTTDPSTPWEYCNIKQCDSDNSGDVENTTTCFRGRGEGYRGTIGITPDGVTCQRWDAQFPHRHSYTPQNYHCKDL--------RENYCRNPDGRHL----PWCFTTDPTVPIAFCTNIPRCGVKPPEPGECYKGIGDMYNGHRSKTRSGIPCAPWKDHSESNERDV-------NLL---TTEQAGNFCRNPDKD---KHGPWCYTNSSSI 435          

HSP 2 Score: 105.145 bits (261), Expect = 1.778e-22
Identity = 103/351 (29.34%), Postives = 143/351 (40.74%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLW--SSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMC---------NTATC-RTTVEGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQC--RNSQTATDYAGIVN-------RTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLES 1608
            G+ Y G  ++T +   C  W +     + +   P   K   + +  N CRNP+   +GPWC+TT     +  C+IP+C      T           G  Y G +  T  G  C  W         F+   +PD    +  NYCRN        P+CF          C +  C         NT TC R   EGY   GT  I+  G+ C  W        S  P  +  + +   +NYCR+P        P+C+T   T  T  I++CT  P+C  +  +    Y GI +       +T SG+ C  W D    N R+  LL     E A N+CRNPD D  GPWCY  S
Sbjct:  112 GLNYKGKRSVTKSGVQCQLWNSKMPHEHNFL--PQRHKHRDLRD--NLCRNPDNTTTGPWCFTTDPKLRHQDCSIPQCSEVECMTCN---------GESYRGPLDHTESGRECQRWDLEEPHKHIFHPKRYPDKGLKD--NYCRNP--DGRQRPWCFTTDPSTPWEYCNIKQCDSDNSGDVENTTTCFRGRGEGYR--GTIGITPDGVTCQRWDAQFPHRHSYTPQNYHCKDL--RENYCRNPDGRHL---PWCFT---TDPTVPIAFCTNIPRCGVKPPEPGECYKGIGDMYNGHRSKTRSGIPCAPWKDHSESNERDVNLLTT---EQAGNFCRNPDKDKHGPWCYTNS 432          

HSP 3 Score: 91.6633 bits (226), Expect = 3.149e-18
Identity = 92/314 (29.30%), Postives = 126/314 (40.13%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            F P       L D  N CRNPDN T G WC+ T+      + C  P CS +  C+    G  Y+G +  TE    C  W  +     I+    +P+  +   +NYCRNP +    PWC+       + +     C         +    N T      G  Y GTI IT +   C  W       + Y   P  +    + E  NYCRNP+     PWC+TT  T    +CT IP+C    P       C   + G  Y G  S T  G  C  W   +  N  D +    +   A N+CRN P  +  GP+C+
Sbjct:  141 FLPQRHKHRDLRD--NLCRNPDNTTTGPWCFTTD-PKLRHQDCSIPQCSEV-ECMTC-NGESYRGPLDHTESGRECQRWDLEEPHKHIFHPKRYPDKGL--KDNYCRNP-DGRQRPWCFTTDPSTPWEY-----CNIKQCDSDNSGDVENTTTCFRGRGEGYRGTIGITPDGVTCQRWDAQFPHRHSYT--PQNYHCKDLRE--NYCRNPDGR-HLPWCFTTDPTVPIAFCTNIPRCGVKPPEP---GECYKGI-GDMYNGHRSKTRSGIPCAPWKDHSESNERDVNLL--TTEQAGNFCRN-PDKDKHGPWCY 429          

HSP 4 Score: 78.9518 bits (193), Expect = 2.265e-14
Identity = 76/266 (28.57%), Postives = 104/266 (39.10%), Query Frame = 1
Query:  118 PLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLK----KYCKTPCSGIWA---CLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCF 879
            PL ++            +    IFHP   PD  L D  NYCRNPD      WC+ T+ +   +    K C +  SG        F   G  Y+G + +T    TC  W ++      YT  N+    +    NYCRNP +    PWC+         FCT        P  P     G         G  Y G  + T +  PCAPW   +       N        T  +  N+CRNP+ D  GPWCYT + +   +YC++   F
Sbjct:  201 PLDHTESGRECQRWDLEEPHKHIFHPKRYPDKGLKD--NYCRNPDGRQRP-WCFTTDPSTPWEYCNIKQCDSDNSGDVENTTTCFRGRGEGYRGTIGITPDGVTCQRWDAQFPHRHSYTPQNYHCKDLRE--NYCRNP-DGRHLPWCFTTDPTVPIAFCTNIPRCGVKPPEPGECYKG--------IGDMYNGHRSKTRSGIPCAPWKDHSESNERDVN------LLTTEQAGNFCRNPDKDKHGPWCYTNSSSIPWDYCSLKPLF 446          

HSP 5 Score: 53.5286 bits (127), Expect = 1.560e-6
Identity = 49/192 (25.52%), Postives = 73/192 (38.02%), Query Frame = 1
Query: 1672 NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            N   Y G  +VTK+GV C  W+   P         +F+ Q        D  N CR P N +     PWC+ ++P++     S    C+   C +C    N   Y G  + T +G  C  W       L +     +     PD  +   +NYCR P        +PWC+ +  S         + +C I  C
Sbjct:  111 NGLNYKGKRSVTKSGVQCQLWNSKMPH------EHNFLPQRHKHRDLRD--NLCRNPDNTTT---GPWCFTTDPKLRHQDCS-IPQCSEVECMTC----NGESYRGPLDHTESGRECQRW------DLEEPHKHIFHPKRYPDKGL--KDNYCRNPDGR----QRPWCFTTDPST-------PWEYCNIKQC 267          
BLAST of Plasminogen vs. Ensembl Xenopus
Match: ENSXETT00000037804.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 147.517 bits (371), Expect = 1.621e-35
Identity = 146/471 (31.00%), Postives = 207/471 (43.95%), Query Frame = 1
Query:  364 SYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-SVTNGNFNDSSFPDGSAANAV--NYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCR-------TTVE-----GYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCT---------PQCRNSQTATDYAGIVNRT-NSGVCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPT 1650
            S+ +G  S T   +TC  W+  GS     NF      NA    N+CRNP N+  GPWC+      +F +C IP C                 C    SG  Y G I+ T +   C  W + T   + Y    I  K        NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C  +  G  Y+G I+ TA G TC  WS  V + +      PD      +  NYCRN    ++  P+C+   +      C +P C+  T         T +E     G  Y GT  I+ SG  C  W + +    +  P+ FP+  +   +NYCR+P       GP+CYT+  +   E C++  C+         PQ   S    DY GI + T N  +C  W+   P+      P     + LE  +NYCRNPD D  GPWC++ +   +   YC +P C+ T
Sbjct:   88 SFIEGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC--------------EEDCMH-CSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER----NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRT---PDNYPCKNLEKNYCRNPDGESM--PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGL--EQNYCRNPD---EDKGPWCYTTDASVRWEYCSLKKCSELPSTEQRPPQTTESPKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 523          

HSP 2 Score: 125.176 bits (313), Expect = 1.758e-28
Identity = 140/484 (28.93%), Postives = 203/484 (41.94%), Query Frame = 1
Query:  946 GTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC-------SPTQ-----GCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENV----------SRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV-SPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            GT S T  G TC  W+       NF    FP+  A    N+CRN P ++L GP+C+     V    C +P C       +  G +Y G  + + SG  C  W + +  S    P+  PD+++   +NYCR+P        P+C+T+      E CNI  CT          QC + +   +Y+G +  T SG  C  W+    + + R P       LE   NYCRNPD + + PWCY  +S+ +  YC +P C       +PT       CY  N +  Y G   +T +G  C  W+   P         + M    P+A     QNYCR P         PWCY ++  V       + YC++  C+   + E              Y G  +TT NG  C  WS+ +    +  +   +  S L        +NYCR P  D   IN PWC+V +P +V        + +C I  C T  I
Sbjct:   92 GTESKTHSGKTCQNWTGSFPHVPNFTPEKFPN--AGLEGNFCRN-PDNDLNGPWCYTTDFSVRFEYCNIPQCEEDCMHCS--GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNPDGEPR---PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQCLSGK-GENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLE--KNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGS-KYRGTAYITVSGKKCQPWNSQTPHKH------TKMPDNFPNAGL--EQNYCRNPDEDKG----PWCYTTDASVR------WEYCSLKKCSELPSTEQRPPQTTESPKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGL-------ESNYCRNPDGD---INGPWCFVTTPGTV-------KWEYCDIPRCATTGI 525          

HSP 3 Score: 123.25 bits (308), Expect = 6.569e-28
Identity = 149/474 (31.43%), Postives = 204/474 (43.04%), Query Frame = 1
Query:  664 GTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWT-NISVTSIE-PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ-------------TATDYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS--------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            GT + T +   C  WT +   + P F  P  F  A +    N+CRNP+ D +GPWCYTT  +   EYC IP+C           +C    +G  Y G IS TA G  C  W S T  +  ++ S+ PD +     NYCRN      P P+CF   PN+    C +P C T          C  + +G +Y+G  A++ SG  C  W+  +    I  P+ +P +++   KNYCR+P        P+CYT  S T  E CNI  C     N+                + Y G    T SG  C  W +   + + + P     A LE   NYCRNPD D  GPWCY  ++ V+  YC L  CS        P Q   +      Y G  + T NG  C  WS   P    AS +P    Q      +    NYCR P         PWC+ + P     T+  + YC++  C +
Sbjct:   92 GTESKTHSGKTCQNWTGSFP-HVPNFT-PEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC---------EEDC-MHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP--DGEPRPWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNL--EKNYCRNPD---GESMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKCSELPSTEQRPPQTTESPKGE-DYRGIKSTTLNGHICQAWSSQSPQEH-ASFTPITHPQ------SGLESNYCRNPDGD---INGPWCFVTTP----GTVK-WEYCDIPRCAT 522          

HSP 4 Score: 121.324 bits (303), Expect = 2.720e-27
Identity = 131/442 (29.64%), Postives = 189/442 (42.76%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD---RTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFT-------TTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG--SAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTA--------TCRTTVEGYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P F P   P+A L    N+CRNPDND  G WCY T+ +    +YC  P      C  D    +G  Y+G +S T     C  W S+      Y+ +N P+ ++    NYCRNP +    PWC+  +   ++       C          T+A    C S   G  Y+G IA+T +   C  W+      + +   P  +    + +  NYCRNP+ + S PWCYTT      EYC IP C         T P+TI    C     G++Y GT   T  G  C  W+S T      +  PD   +A    NYCRN       GP+C+     V    C +  C+              + +G  Y G ++ + +G  C  W++ S     S  P   P   + +  NYCR+P     ++GP+C+  +TT  T    YC  P+C
Sbjct:  114 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIP-----QCEEDCMHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNP-DGEPRPWCFTTNPNKRW-----EHCNIPRCTTNPPTSAPGVQCLS-GKGENYSGNIAVTASGKTCQEWSLQVP--HKHIRTPDNYPCKNLEK--NYCRNPDGE-SMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILE--CYDG-NGSKYRGTAYITVSGKKCQPWNSQT--PHKHTKMPDNFPNAGLEQNYCRNPDEDK--GPWCYTTDASVRWEYCSLKKCSELPSTEQRPPQTTESPKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDG--DINGPWCF--VTTPGTVKWEYCDIPRC 520          
BLAST of Plasminogen vs. Ensembl Xenopus
Match: ENSXETT00000037863.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 140.969 bits (354), Expect = 2.021e-33
Identity = 147/484 (30.37%), Postives = 208/484 (42.98%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-SVTNGNFNDSSFPDGSAANAV--NYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCR-------TTVE-----GYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC---------------------TPQCRNSQTATDYAGIVNRT-NSGVCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPT 1650
            G  Y+G  S T   +TC  W+  GS     NF      NA    N+CRNP N+  GPWC+      +F +C IP C                 C    SG  Y G I+ T +   C  W + T   + Y    I  K        NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C  +  G  Y+G I+ TA G TC  WS  V + +      PD      +  NYCRN    ++  P+C+   +      C +P C+  T         T +E     G  Y GT  I+ SG  C  W + +    +  P+ FP+  +   +NYCR+P       GP+CYT+  +   E C++  C                     +P C  S+   DY GI + T N  +C  W+   P+      P     + LE  +NYCRNPD D  GPWC++ +   +   YC +P C+ T
Sbjct:   83 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC--------------EEDCMH-CSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER----NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRT---PDNYPCKNLEKNYCRNPDGESM--PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGL--EQNYCRNPD---EDKGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSK-GEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 530          

HSP 2 Score: 126.716 bits (317), Expect = 5.147e-29
Identity = 145/503 (28.83%), Postives = 210/503 (41.75%), Query Frame = 1
Query:  922 TVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC-------SPTQ-----GCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFEN------------------VSR---YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV-SPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            T  G +Y GT S T  G TC  W+       NF    FP+  A    N+CRN P ++L GP+C+     V    C +P C       +  G +Y G  + + SG  C  W + +  S    P+  PD+++   +NYCR+P        P+C+T+      E CNI  CT          QC + +   +Y+G +  T SG  C  W+    + + R P       LE   NYCRNPD + + PWCY  +S+ +  YC +P C       +PT       CY  N +  Y G   +T +G  C  W+   P         + M    P+A     QNYCR P         PWCY ++  V       + YC++  C+   + E                   VS+   Y G  +TT NG  C  WS+ +    +  +   +  S L        +NYCR P  D   IN PWC+V +P +V        + +C I  C T  I
Sbjct:   80 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPN--AGLEGNFCRN-PDNDLNGPWCYTTDFSVRFEYCNIPQCEEDCMHCS--GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNPDGEPR---PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQCLSGK-GENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLE--KNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGS-KYRGTAYITVSGKKCQPWNSQTPHKH------TKMPDNFPNAGL--EQNYCRNPDEDKG----PWCYTTDASVR------WEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGL-------ESNYCRNPDGD---INGPWCFVTTPGTV-------KWEYCDIPRCATTGI 532          

HSP 3 Score: 125.176 bits (313), Expect = 1.813e-28
Identity = 152/492 (30.89%), Postives = 208/492 (42.28%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWT-NISVTSIE-PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ-------------TATDYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS--------PTQGCYTQ----------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            T  G +Y GT + T +   C  WT +   + P F  P  F  A +    N+CRNP+ D +GPWCYTT  +   EYC IP+C           +C    +G  Y G IS TA G  C  W S T  +  ++ S+ PD +     NYCRN      P P+CF   PN+    C +P C T          C  + +G +Y+G  A++ SG  C  W+  +    I  P+ +P +++   KNYCR+P        P+CYT  S T  E CNI  C     N+                + Y G    T SG  C  W +   + + + P     A LE   NYCRNPD D  GPWCY  ++ V+  YC L  CS        P Q               +    Y G  + T NG  C  WS   P    AS +P    Q      +    NYCR P         PWC+ + P     T+  + YC++  C +
Sbjct:   80 TGKGKDYRGTESKTHSGKTCQNWTGSFP-HVPNFT-PEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC---------EEDC-MHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP--DGEPRPWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNL--EKNYCRNPD---GESMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEH-ASFTPITHPQ------SGLESNYCRNPDGD---INGPWCFVTTP----GTVK-WEYCDIPRCAT 529          

HSP 4 Score: 117.087 bits (292), Expect = 5.369e-26
Identity = 133/453 (29.36%), Postives = 192/453 (42.38%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD---RTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFT-------TTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG--SAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT--ATCRTTVE-----------------GYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P F P   P+A L    N+CRNPDND  G WCY T+ +    +YC  P      C  D    +G  Y+G +S T     C  W S+      Y+ +N P+ ++    NYCRNP +    PWC+  +   ++       C          T+A    C S   G  Y+G IA+T +   C  W+      + +   P  +    + +  NYCRNP+ + S PWCYTT      EYC IP C         T P+TI    C     G++Y GT   T  G  C  W+S T      +  PD   +A    NYCRN       GP+C+     V    C +  C+   +T +  V+                 G  Y G ++ + +G  C  W++ S     S  P   P   + +  NYCR+P     ++GP+C+  +TT  T    YC  P+C
Sbjct:  110 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIP-----QCEEDCMHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNP-DGEPRPWCFTTNPNKRW-----EHCNIPRCTTNPPTSAPGVQCLS-GKGENYSGNIAVTASGKTCQEWSLQVP--HKHIRTPDNYPCKNLEK--NYCRNPDGE-SMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILE--CYDG-NGSKYRGTAYITVSGKKCQPWNSQT--PHKHTKMPDNFPNAGLEQNYCRNPDEDK--GPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDG--DINGPWCF--VTTPGTVKWEYCDIPRC 527          

HSP 5 Score: 86.2705 bits (212), Expect = 1.865e-16
Identity = 73/243 (30.04%), Postives = 114/243 (46.91%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPC-------------SGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQS------TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTT 885
             NYCRNPD +++  WCY T+ +    +YC  P              S I  C +D  GS Y+G   +T   + C  W+S+ + + +   P+N  +     NYCRNP  + G PWC+      ++ +C++  C + P            T  +       + G +Y G  + T N + C  W++ +   +  F  PI    + +   +NYCRNP+ D +GPWC+ TT      EYC IP+C TT
Sbjct:  296 KNYCRNPDGESMP-WCYTTD-SETRWEYCNIPSCDAPTVNAAPTNPSTILEC-YDGNGSKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFT-PITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 530          
BLAST of Plasminogen vs. Ensembl Xenopus
Match: ENSXETT00000025429.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 140.584 bits (353), Expect = 2.607e-33
Identity = 147/489 (30.06%), Postives = 208/489 (42.54%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-SVTNGNFNDSSFPDGSAANAV--NYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTV---------------EG--YSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC---------------------TPQCRNSQTATDYAGIVNRT-NSGVCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPT 1650
            G  Y+G  S T   +TC  W+  GS     NF      NA    N+CRNP N+  GPWC+      +F +C IP C                 C    SG  Y G I+ T +   C  W + T   + Y    I  K        NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C  +  G  Y+G I+ TA G TC  WS  V + +      PD      +  NYCRN    ++  P+C+   +      C +P C+  T    +               EG  Y Y GT  I+ SG  C  W + +    +  P+ FP+  +   +NYCR+P       GP+CYT+  +   E C++  C                     +P C  S+   DY GI + T N  +C  W+   P+      P     + LE  +NYCRNPD D  GPWC++ +   +   YC +P C+ T
Sbjct:   83 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC--------------EEDCMH-CSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER----NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRT---PDNYPCKNLEKNYCRNPDGESM--PWCYTTDSETRWEYCNIPSCDAPTVNEQLSPTGTPKGITVLRQREGAIYKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGL--EQNYCRNPD---EDKGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSK-GEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 535          

HSP 2 Score: 125.561 bits (314), Expect = 1.311e-28
Identity = 153/497 (30.78%), Postives = 207/497 (41.65%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWT-NISVTSIE-PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ---TATDYAGIVNRTNSGV----------------CMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS--------PTQGCYTQ----------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            T  G +Y GT + T +   C  WT +   + P F  P  F  A +    N+CRNP+ D +GPWCYTT  +   EYC IP+C           +C    +G  Y G IS TA G  C  W S T  +  ++ S+ PD +     NYCRN      P P+CF   PN+    C +P C T          C  + +G +Y+G  A++ SG  C  W+  +    I  P+ +P +++   KNYCR+P        P+CYT  S T  E CNI  C     N Q   T T     V R   G                 C  W +   + + + P     A LE   NYCRNPD D  GPWCY  ++ V+  YC L  CS        P Q               +    Y G  + T NG  C  WS   P    AS +P    Q      +    NYCR P         PWC+ + P     T+  + YC++  C +
Sbjct:   80 TGKGKDYRGTESKTHSGKTCQNWTGSFP-HVPNFT-PEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC---------EEDC-MHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP--DGEPRPWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNL--EKNYCRNPD---GESMPWCYTTDSETRWEYCNIPSCDAPTVNEQLSPTGTPKGITVLRQREGAIYKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEH-ASFTPITHPQ------SGLESNYCRNPDGD---INGPWCFVTTP----GTVK-WEYCDIPRCAT 534          

HSP 3 Score: 122.865 bits (307), Expect = 9.531e-28
Identity = 144/507 (28.40%), Postives = 210/507 (41.42%), Query Frame = 1
Query:  922 TVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC---------SPT---QGC----YTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFEN------------------VSR---YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV-SPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            T  G +Y GT S T  G TC  W+       NF    FP+  A    N+CRN P ++L GP+C+     V    C +P C       +  G +Y G  + + SG  C  W + +  S    P+  PD+++   +NYCR+P        P+C+T+      E CNI  CT          QC + +   +Y+G +  T SG  C  W+    + + R P       LE   NYCRNPD + + PWCY  +S+ +  YC +P C         SPT   +G       +   + Y G   +T +G  C  W+   P         + M    P+A     QNYCR P         PWCY ++  V       + YC++  C+   + E                   VS+   Y G  +TT NG  C  WS+ +    +  +   +  S L        +NYCR P  D   IN PWC+V +P +V        + +C I  C T  I
Sbjct:   80 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPN--AGLEGNFCRN-PDNDLNGPWCYTTDFSVRFEYCNIPQCEEDCMHCS--GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNPDGEPR---PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQCLSGK-GENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLE--KNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNEQLSPTGTPKGITVLRQREGAIYKYRGTAYITVSGKKCQPWNSQTPHKH------TKMPDNFPNAGL--EQNYCRNPDEDKG----PWCYTTDASVR------WEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGL-------ESNYCRNPDGD---INGPWCFVTTPGTV-------KWEYCDIPRCATTGI 537          

HSP 4 Score: 116.701 bits (291), Expect = 8.753e-26
Identity = 134/456 (29.39%), Postives = 191/456 (41.89%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD---RTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCF----------TTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG--SAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT--ATCRTTVE-----------------GYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P F P   P+A L    N+CRNPDND  G WCY T+ +    +YC  P      C  D    +G  Y+G +S T     C  W S+      Y+ +N P+ ++    NYCRNP +    PWC+  +   ++       C          T+A    C S   G  Y+G IA+T +   C  W+      + +   P  +    + +  NYCRNP+ + S PWCYTT      EYC IP C           T TP  IT    R   A  +Y GT   T  G  C  W+S T      +  PD   +A    NYCRN       GP+C+     V    C +  C+   +T +  V+                 G  Y G ++ + +G  C  W++ S     S  P   P   + +  NYCR+P     ++GP+C+  +TT  T    YC  P+C
Sbjct:  110 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIP-----QCEEDCMHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNP-DGEPRPWCFTTNPNKRW-----EHCNIPRCTTNPPTSAPGVQCLS-GKGENYSGNIAVTASGKTCQEWSLQVP--HKHIRTPDNYPCKNLEK--NYCRNPDGE-SMPWCYTTDSETRWEYCNIPSCDAPTVNEQLSPTGTPKGITVLRQREG-AIYKYRGTAYITVSGKKCQPWNSQT--PHKHTKMPDNFPNAGLEQNYCRNPDEDK--GPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDG--DINGPWCF--VTTPGTVKWEYCDIPRC 532          

HSP 5 Score: 79.7221 bits (195), Expect = 2.017e-14
Identity = 72/248 (29.03%), Postives = 113/248 (45.56%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPC----------------SGIWACLFDRTGSYYQ--GIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQS------TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTT 885
             NYCRNPD +++  WCY T+ +    +YC  P                  GI   L  R G+ Y+  G   +T   + C  W+S+ + + +   P+N  +     NYCRNP  + G PWC+      ++ +C++  C + P            T  +       + G +Y G  + T N + C  W++ +   +  F  PI    + +   +NYCRNP+ D +GPWC+ TT      EYC IP+C TT
Sbjct:  296 KNYCRNPDGESMP-WCYTTD-SETRWEYCNIPSCDAPTVNEQLSPTGTPKGI-TVLRQREGAIYKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTSPDCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFT-PITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 535          
BLAST of Plasminogen vs. Ensembl Xenopus
Match: ENSXETT00000025361.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 138.658 bits (348), Expect = 6.386e-33
Identity = 144/480 (30.00%), Postives = 204/480 (42.50%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-SVTNGNFNDSSFPDGSAANAV--NYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATC--------RTTVEG---YSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQ------------------TATDYAGIVNRT-NSGVCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPT 1650
            G  Y+G  S T   +TC  W+  GS     NF      NA    N+CRNP N+  GPWC+      +F +C IP C                 C    SG  Y G I+ T +   C  W + T   + Y    I  K        NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C  +  G  Y+G I+ TA G TC  WS  V + +      PD      +  NYCRN    ++  P+C+   +      C +P C+  T         R T +      Y GT  I+ SG  C  W + +    +  P+ FP+  +   +NYCR+P       GP+CYT+  +   E C++  C+      Q                     DY GI + T N  +C  W+   P+      P     + LE  +NYCRNPD D  GPWC++ +   +   YC +P C+ T
Sbjct:   16 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC--------------EEDCMH-CSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER----NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRT---PDNYPCKNLEKNYCRNPDGESM--PWCYTTDSETRWEYCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGL--EQNYCRNPD---EDKGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 460          

HSP 2 Score: 130.183 bits (326), Expect = 3.398e-30
Identity = 145/499 (29.06%), Postives = 208/499 (41.68%), Query Frame = 1
Query:  922 TVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC-SPT---------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFEN----------------VSR---YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV-SPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            T  G +Y GT S T  G TC  W+       NF    FP+  A    N+CRN P ++L GP+C+     V    C +P C       +  G +Y G  + + SG  C  W + +  S    P+  PD+++   +NYCR+P        P+C+T+      E CNI  CT          QC  S    +Y+G +  T SG  C  W+    + + R P       LE   NYCRNPD + + PWCY  +S+ +  YC +P C +PT         +G Y       Y G   +T +G  C  W+   P         + M    P+A     QNYCR P         PWCY ++  V       + YC++  C+   + E                 VS+   Y G  +TT NG  C  WS+ +    +  +   +  S L        +NYCR P  D   IN PWC+V +P +V        + +C I  C T  I
Sbjct:   13 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPN--AGLEGNFCRN-PDNDLNGPWCYTTDFSVRFEYCNIPQCEEDCMHCS--GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNPDGEPR---PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQCL-SGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLE--KNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQTPHKH------TKMPDNFPNAGL--EQNYCRNPDEDKG----PWCYTTDASVR------WEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGL-------ESNYCRNPDGD---INGPWCFVTTPGTV-------KWEYCDIPRCATTGI 462          

HSP 3 Score: 129.028 bits (323), Expect = 7.418e-30
Identity = 155/489 (31.70%), Postives = 210/489 (42.94%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWT-NISVTSIE-PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCT---------PQCRNSQTAT---DYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS--------PTQGCYTQ--------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            T  G +Y GT + T +   C  WT +   + P F  P  F  A +    N+CRNP+ D +GPWCYTT  +   EYC IP+C           +C    +G  Y G IS TA G  C  W S T  +  ++ S+ PD +     NYCRN      P P+CF   PN+    C +P C T          C  + +G +Y+G  A++ SG  C  W+  +    I  P+ +P +++   KNYCR+P        P+CYT  S T  E CNI  C          PQ R +  A     Y G    T SG  C  W +   + + + P     A LE   NYCRNPD D  GPWCY  ++ V+  YC L  CS        P Q             +    Y G  + T NG  C  WS   P    AS +P    Q      +    NYCR P         PWC+ + P     T+  + YC++  C +
Sbjct:   13 TGKGKDYRGTESKTHSGKTCQNWTGSFP-HVPNFT-PEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC---------EEDC-MHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP--DGEPRPWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNL--EKNYCRNPD---GESMPWCYTTDSETRWEYCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEH-ASFTPITHPQ------SGLESNYCRNPDGD---INGPWCFVTTP----GTVK-WEYCDIPRCAT 459          

HSP 4 Score: 116.701 bits (291), Expect = 7.059e-26
Identity = 130/447 (29.08%), Postives = 187/447 (41.83%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD---RTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGT---EYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG--SAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT--ATCRTTVE---------------GYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P F P   P+A L    N+CRNPDND  G WCY T+ +    +YC  P      C  D    +G  Y+G +S T     C  W S+      Y+ +N P+ ++    NYCRNP +    PWC+  +   ++       C          T+A    C S   G  Y+G IA+T +   C  W+      + +   P  +    + +  NYCRNP+ + S PWCYTT      EYC IP C   T         R T       +Y GT   T  G  C  W+S T      +  PD   +A    NYCRN       GP+C+     V    C +  C+   +T +  V+               G  Y G ++ + +G  C  W++ S     S  P   P   + +  NYCR+P     ++GP+C+  +TT  T    YC  P+C
Sbjct:   43 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIP-----QCEEDCMHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNP-DGEPRPWCFTTNPNKRW-----EHCNIPRCTTNPPTSAPGVQCLS-GKGENYSGNIAVTASGKTCQEWSLQVP--HKHIRTPDNYPCKNLEK--NYCRNPDGE-SMPWCYTTDSETRWEYCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQT--PHKHTKMPDNFPNAGLEQNYCRNPDEDK--GPWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDG--DINGPWCF--VTTPGTVKWEYCDIPRC 457          

HSP 5 Score: 80.1073 bits (196), Expect = 1.618e-14
Identity = 70/239 (29.29%), Postives = 112/239 (46.86%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWAC----LFDRTGSY-------YQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQS----TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTT 885
             NYCRNPD +++  WCY T+ +    +YC  P           L  + G+Y       Y+G   +T   + C  W+S+ + + +   P+N  +     NYCRNP  + G PWC+      ++ +C++  C + P            T  +     + G +Y G  + T N + C  W++ +   +  F  PI    + +   +NYCRNP+ D +GPWC+ TT      EYC IP+C TT
Sbjct:  229 KNYCRNPDGESMP-WCYTTD-SETRWEYCNIPSCDAPTVNDRKLPQQRGTYQARGQLKYRGTAYITVSGKKCQPWNSQ-TPHKHTKMPDNFPNAGLEQNYCRNPDEDKG-PWCYTTDASVRWEYCSLKKCSELPSTEQRPVQTTKITTITTNCIVSKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFT-PITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 460          
BLAST of Plasminogen vs. Ensembl Xenopus
Match: ENSXETT00000025386.1 (plasminogen [Source:NCBI gene;Acc:100496227])

HSP 1 Score: 137.887 bits (346), Expect = 1.268e-32
Identity = 144/473 (30.44%), Postives = 202/473 (42.71%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS-SVTNGNFNDSSFPDGSAANAV--NYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCR-------TTVE-----GYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQ------------TATDYAGIVNRT-NSGVCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPT 1650
            G  Y+G  S T   +TC  W+  GS     NF      NA    N+CRNP N+  GPWC+      +F +C IP C                 C    SG  Y G I+ T +   C  W + T   + Y    I  K        NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C  +  G  Y+G I+ TA G TC  WS  V + +      PD      +  NYCRN    ++  P+C+   +      C +P C+  T         T +E     G  Y GT  I+ SG  C  W + +    +  P+ FP+  +   +NYCR+P       GP+CY   TT  +    YC+ +                    DY GI + T N  +C  W+   P+      P     + LE  +NYCRNPD D  GPWC++ +   +   YC +P C+ T
Sbjct:   27 GKDYRGTESKTHSGKTCQNWT--GSFPHVPNFTPEKFPNAGLEGNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC--------------EEDCMH-CSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER----NYCRNPDGEPR-PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRT---PDNYPCKNLEKNYCRNPDGESM--PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGL--EQNYCRNPD---EDKGPWCY---TTDASVRWEYCSLKKLPYPLLLLPKAFLPLIKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLE--SNYCRNPDGDINGPWCFVTTPGTVKWEYCDIPRCATT 461          

HSP 2 Score: 123.635 bits (309), Expect = 4.557e-28
Identity = 142/490 (28.98%), Postives = 203/490 (41.43%), Query Frame = 1
Query:  922 TVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC-------SPTQ-----GCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVS--------RYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV-SPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            T  G +Y GT S T  G TC  W+       NF    FP+  A    N+CRN P ++L GP+C+     V    C +P C       +  G +Y G  + + SG  C  W + +  S    P+  PD+++   +NYCR+P        P+C+T+      E CNI  CT          QC  S    +Y+G +  T SG  C  W+    + + R P       LE   NYCRNPD + + PWCY  +S+ +  YC +P C       +PT       CY  N +  Y G   +T +G  C  W+   P         + M    P+A     QNYCR P         PWCY ++  V       + YC++            +         Y G  +TT NG  C  WS+ +    +  +   +  S L        +NYCR P  D   IN PWC+V +P +V        + +C I  C T  I
Sbjct:   24 TGKGKDYRGTESKTHSGKTCQNWTGSFPHVPNFTPEKFPN--AGLEGNFCRN-PDNDLNGPWCYTTDFSVRFEYCNIPQCEEDCMHCS--GENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNPDGEPR---PWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQCL-SGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNLE--KNYCRNPDGESM-PWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGS-KYRGTAYITVSGKKCQPWNSQTPHKH------TKMPDNFPNAGL--EQNYCRNPDEDKG----PWCYTTDASVR------WEYCSLKKLPYPLLLLPKAFLPLIKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGL-------ESNYCRNPDGD---INGPWCFVTTPGTV-------KWEYCDIPRCATTGI 463          

HSP 3 Score: 119.783 bits (299), Expect = 6.992e-27
Identity = 148/479 (30.90%), Postives = 204/479 (42.59%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWT-NISVTSIE-PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ-------------TATDYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQGCYTQN-----NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            T  G +Y GT + T +   C  WT +   + P F  P  F  A +    N+CRNP+ D +GPWCYTT  +   EYC IP+C           +C    +G  Y G IS TA G  C  W S T  +  ++ S+ PD +     NYCRN      P P+CF   PN+    C +P C T          C  + +G +Y+G  A++ SG  C  W+  +    I  P+ +P +++   KNYCR+P        P+CYT  S T  E CNI  C     N+                + Y G    T SG  C  W +   + + + P     A LE   NYCRNPD D  GPWCY  ++ V+  YC L           +          Y G  + T NG  C  WS   P    AS +P    Q      +    NYCR P         PWC+ + P     T+  + YC++  C +
Sbjct:   24 TGKGKDYRGTESKTHSGKTCQNWTGSFP-HVPNFT-PEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRFEYCNIPQC---------EEDC-MHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNLER--NYCRNP--DGEPRPWCFTTNPNKRWEHCNIPRCTTNPPTSAPGVQC-LSGKGENYSGNIAVTASGKTCQEWSLQVPHKHIRTPDNYPCKNL--EKNYCRNPD---GESMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILECYDGNGSKYRGTAYITVSGKKCQPWNSQTPHKHTKMPDNFPNAGLEQ--NYCRNPDED-KGPWCYTTDASVRWEYCSLKKLPYPLLLLPKAFLPLIKGEDYRGIKSTTLNGHICQAWSSQSPQEH-ASFTPITHPQ------SGLESNYCRNPDGD---INGPWCFVTTP----GTVK-WEYCDIPRCAT 460          

HSP 4 Score: 117.472 bits (293), Expect = 3.238e-26
Identity = 130/440 (29.55%), Postives = 187/440 (42.50%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFD---RTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFT-------TTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG--SAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTT------VEGYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P F P   P+A L    N+CRNPDND  G WCY T+ +    +YC  P      C  D    +G  Y+G +S T     C  W S+      Y+ +N P+ ++    NYCRNP +    PWC+  +   ++       C          T+A    C S   G  Y+G IA+T +   C  W+      + +   P  +    + +  NYCRNP+ + S PWCYTT      EYC IP C         T P+TI    C     G++Y GT   T  G  C  W+S T      +  PD   +A    NYCRN       GP+C+     V    C +                 ++G  Y G ++ + +G  C  W++ S     S  P   P   + +  NYCR+P     ++GP+C+  +TT  T    YC  P+C
Sbjct:   54 PNFTPEKFPNAGLE--GNFCRNPDNDLNGPWCYTTDFSVRF-EYCNIP-----QCEEDCMHCSGENYRGRISKTASGTECQNWDSQTPHSHGYSPSNIPDKNL--ERNYCRNP-DGEPRPWCFTTNPNKRW-----EHCNIPRCTTNPPTSAPGVQCLS-GKGENYSGNIAVTASGKTCQEWSLQVP--HKHIRTPDNYPCKNLEK--NYCRNPDGE-SMPWCYTTDSETRWEYCNIPSCDAPTVNAAPTNPSTILE--CYDG-NGSKYRGTAYITVSGKKCQPWNSQT--PHKHTKMPDNFPNAGLEQNYCRNPDEDK--GPWCYTTDASVRWEYCSLKKLPYPLLLLPKAFLPLIKGEDYRGIKSTTLNGHICQAWSSQSPQEHASFTPITHPQSGLES--NYCRNPDG--DINGPWCF--VTTPGTVKWEYCDIPRC 458          
BLAST of Plasminogen vs. Ensembl Mouse
Match: Plg (plasminogen [Source:MGI Symbol;Acc:MGI:97620])

HSP 1 Score: 131.339 bits (329), Expect = 1.896e-30
Identity = 148/519 (28.52%), Postives = 211/519 (40.66%), Query Frame = 1
Query:  907 NNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVCSPT-------------------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC------------------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAA 2259
            + C+T + G  Y GT+S T  G  C  W +      N++ S+ P+       NYCRN P ++  GP+C+   P++    C +P C          G  Y G  + + SGL C  W + S       P  FP +++    NYCR+P        P+C+T+  T   E C+I  CT          QC   +   +Y G V+ T SG  C  W++  P   N R P+      LE+  NYCRNPD +   PWCY  +SQ++  YC++P C  +                   Q CY Q++  +Y G  + T  G  C  W+    A+F    S +   +  PDA      NYCR P         PWCY ++P V       + YCN+  C                        T C  + N   Y G    T+ GTPC  W+            P+  S   P     A    NYCR P  D   +N PWCY +    L       + +C I  C +A+
Sbjct:  101 SECKTGI-GNGYRGTMSRTKSGVACQKWGATFPHVPNYSPSTHPNEGLEE--NYCRN-PDNDEQGPWCYTTDPDKRYDYCNIPECEEEC--MYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNL--KMNYCRNPDGEPR---PWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGR-GENYRGTVSVTVSGKTCQRWSEQTPHRHN-RTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECY-QSDGQSYRGTSSTTITGKKCQSWA----AMFPHRHSKT--PENFPDAGL--EMNYCRNPDGDKG----PWCYTTDPSVR------WEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDC-MYGNGKDYRGKTAVTAAGTPCQGWAAQE---------PHRHSIFTPQTNPRAGLEKNYCRNPDGD---VNGPWCYTTNPRKL-------YDYCDIPLCASAS 564          

HSP 2 Score: 129.413 bits (324), Expect = 6.159e-30
Identity = 146/507 (28.80%), Postives = 197/507 (38.86%), Query Frame = 1
Query:  637 STTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQT--------------------ATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCSPTQGCYTQ--------------------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFE 1968
             T  G  Y GT++ T +   C  W  T      Y   P       + E  NYCRNP+ D  GPWCYTT  ++  +YC IP+C            C    +G +Y G IS T  G  C  W S +     +  + FP  S    +NYCRN      P P+CF   P +    C +P C T     +         G +Y GT +++ SG  C  W+  +    +  P  FP +++   +NYCR+P    +   P+CYT  S    E C I  C       Q+                       Y G  + T +G  C  W    P   + + P+    A LE   NYCRNPD D  GPWCY  +  V+  YC L  CS T G   +                     N   Y G   VT  G  C  W+   P          F  Q  P A     +NYCR P         PWCY + P+        + YC++ +C S  +FE
Sbjct:  104 KTGIGNGYRGTMSRTKSGVACQKWGATFPHVPNY--SPSTHPNEGLEE--NYCRNPDNDEQGPWCYTTDPDKRYDYCNIPEC---------EEEC-MYCSGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFP--SKNLKMNYCRNP--DGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRGENYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFPCKNL--EENYCRNPDGETA---PWCYTTDSQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHR-HSKTPENFPDAGLE--MNYCRNPDGDK-GPWCYTTDPSVRWEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGWAAQEPHRHSI-----FTPQTNPRAGL--EKNYCRNPDGD---VNGPWCYTTNPR------KLYDYCDIPLCASASSFE 567          

HSP 3 Score: 124.79 bits (312), Expect = 2.154e-28
Identity = 142/460 (30.87%), Postives = 199/460 (43.26%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNC----RTTVA-------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTT----VE----------------------GYSYAGTQAISKSGLPCLLWTNISVTSIEPN----YFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
            P + P+  P+  L +  NYCRNPDND  G WCY T+       YC  P C     C++  +G  Y+G +S T     C  W S+      Y  A FP  ++    NYCRNP +    PWC+      ++ +C IP C   PP P  T             G  Y GT+++T +   C  W+  T   +   NR P  F    + E  NYCRNP+ + + PWCYTT      EYC IP C ++     + ++     +T V        G  Y GT STT  G  C  W+++     + +  +FPD  A   +NYCRN P  +  GP+C+     V      CN   C  T    VE                      G  Y G  A++ +G PC  W      + EP+    + P  +  A   KNYCR+P     V+GP+CYT+      + C+I  C
Sbjct:  135 PNYSPSTHPNEGLEE--NYCRNPDNDEQGPWCYTTDPDKRY-DYCNIPECEE--ECMYC-SGEKYEGKISKTMSGLDCQAWDSQSPHAHGYIPAKFPSKNL--KMNYCRNP-DGEPRPWCFTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKG------RGENYRGTVSVTVSGKTCQRWSEQTPHRH---NRTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSQLRWEYCEIPSCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSYRGTSSTTITGKKCQSWAAMFPHRHSKTPENFPD--AGLEMNYCRN-PDGD-KGPWCYTTDPSVR--WEYCNLKRCSETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYRGKTAVTAAGTPCQGW-----AAQEPHRHSIFTPQTNPRAGLEKNYCRNPDG--DVNGPWCYTTNPRKLYDYCDIPLC 560          
BLAST of Plasminogen vs. Ensembl Mouse
Match: Mst1 (macrophage stimulating 1 (hepatocyte growth factor-like) [Source:MGI Symbol;Acc:MGI:96080])

HSP 1 Score: 122.479 bits (306), Expect = 7.949e-28
Identity = 112/365 (30.68%), Postives = 152/365 (41.64%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN--RVMCVVPMCNTATCRTTV---------EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTS---LTTTETCNISYCT----PQCRNSQTATDYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQ 1653
            GV Y GT+A T    PC  W+    F N +   P    T       N+CRNP+ DP GPWCYTT  +  +  C I  C         R        G +Y G +  T  G  C  W      +  F    F D    +  NYCRN   S    P+C+   PN  R  C +P C + + R            +G  Y GT   + +G+PC  W   + +  +  + P++       +N+CR+P      + P+C+TS   L       I  CT    P+     +   Y G V++T  GV C  W+   P    F  P     A LE  AN+CRNPD D  GPWCY L+  +   YC L  C   Q
Sbjct:  115 GVSYRGTVARTAGGLPCQAWSRR--FPNDHKYTP----TPKNGLEENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTC---------REAVCVLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFQPEKFLDKDLKD--NYCRNPDGSER--PWCYTTDPNVEREFCDLPSCGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWD--AQSPHQHRFVPEKYACKDLRENFCRNPD---GSEAPWCFTSRPGLRMAFCHQIPRCTEELVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHKPQF-TPTSAPQAGLE--ANFCRNPDGDSHGPWCYTLDPDILFDYCALQRCDDDQ 452          

HSP 2 Score: 114.005 bits (284), Expect = 3.713e-25
Identity = 106/365 (29.04%), Postives = 147/365 (40.27%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTET--CNISYC--TPQCRNSQTA--------TDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLES---QVKIYCQLPVCSPT---QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            G  Y GT++ TA G  C  WS     +   +  P        N+CRN P  +  GP+C+     V    C +  C  A C     G  Y G   +++SG  C  W      S   +P  F D+ +    NYCR+P      + P+CYT+    E   C++  C    Q RN   A         DY G  N T++GV C  W    P    F  P+      L +  N+CRNPD     PWC+      ++    Q+P C+     +GCY   +   Y G+++ T+ GV C  WS   P        P F     P A      N+CR P   S     PWCY  +P +       F YC +  C
Sbjct:  115 GVSYRGTVARTAGGLPCQAWSRRFPNDHKYTPTPKNGLEE--NFCRN-PDGDPRGPWCYTTNRSVRFQSCGIKTCREAVC-VLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFQPEKFLDKDL--KDNYCRNPD---GSERPWCYTTDPNVEREFCDLPSCGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQSPHQHRF-VPEKYACKDLRE--NFCRNPDGSE-APWCFTSRPGLRMAFCHQIPRCTEELVPEGCY-HGSGEQYRGSVSKTRKGVQCQHWSSETPH------KPQFTPTSAPQAGL--EANFCRNPDGDSH---GPWCYTLDPDI------LFDYCALQRC 448          

HSP 3 Score: 103.99 bits (258), Expect = 4.206e-22
Identity = 100/374 (26.74%), Postives = 142/374 (37.97%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQ--VKIYCQLPVCSPTQGCYTQNNAW--------AYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPD--ASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G SY GT A +  GLPC  W+       +  Y P       +N+CR+P       GP+CYT+  +   ++C I  C           DY G V+ T SG  C  W    P +  F+  + L+   L+D  NYCRNPD     PWCY       + +C LP C        +  A          Y G  N T  GV C +W    P             + +P+  A     +N+CR P    A    PWC+ S P +  +       C   +        +  +Y G  + T  G  C  WS+           P +  +  P   + A  N+CR P  D    + PWCY     +L       F +C +  C
Sbjct:  115 GVSYRGTVARTAGGLPCQAWSRRFPN--DHKYTPTPKNGLEENFCRNPDG--DPRGPWCYTTNRSVRFQSCGIKTCREAVCVLCNGEDYRGEVDVTESGRECQRWDLQHPHSHPFQPEKFLDK-DLKD--NYCRNPDGSER-PWCYTTDPNVEREFCDLPSCGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQSP----------HQHRFVPEKYACKDLRENFCRNPDGSEA----PWCFTSRPGLRMAFCHQIPRCTEELVPEGCYHGSGEQYRGSVSKTRKGVQCQHWSSETPHK------PQFTPTSAPQAGLEA--NFCRNPDGD---SHGPWCYTLDPDIL-------FDYCALQRC 448          

HSP 4 Score: 99.3673 bits (246), Expect = 1.146e-20
Identity = 89/300 (29.67%), Postives = 127/300 (42.33%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYC-TIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
             N+CRNPD D  G WCY TN +   +      C      L +  G  Y+G V VTE    C  W  +   +++   PE  +     +NYCRNP + +  PWC+  +D N            +          G A       G +Y GT   T+   PC  W       +P+ +R +  K A      N+CRNP+     PWC+T+       +C  IP+C       +    C    +G +Y G++S T KG  C  WSS T     F  +S P   A    N+CRN P  +  GP+C+
Sbjct:  154 ENFCRNPDGDPRGPWCYTTNRSVRFQSCGIKTCREAVCVLCN--GEDYRGEVDVTESGRECQRWDLQ-HPHSHPFQPEKFLDKDLKDNYCRNP-DGSERPWCYT-TDPN---VEREFCDLPSCGSKSQRRNKGKALNCFRGKGEDYRGTTNTTSAGVPCQRWDAQ----SPHQHRFVPEKYACKDLRENFCRNPDGS-EAPWCFTSRPGLRMAFCHQIPRCT----EELVPEGCYHG-SGEQYRGSVSKTRKGVQCQHWSSETPHKPQFTPTSAP--QAGLEANFCRN-PDGDSHGPWCY 432          
BLAST of Plasminogen vs. Ensembl Mouse
Match: Hgf (hepatocyte growth factor [Source:MGI Symbol;Acc:MGI:96079])

HSP 1 Score: 119.783 bits (299), Expect = 4.990e-27
Identity = 105/351 (29.91%), Postives = 153/351 (43.59%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNR--VMCVVPMC-NTATCRTTV----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQ-------TATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLL---NAAKLEDAANYCRNPDSDPLGPWCY 1599
             G  Y GT++IT +   C PW +     + +   P  ++   + E  NYCRNP  +  GPWC+T+     Y  C IP+C        +   C  T  G  Y G +  T  G TC  W   T     F    +PD    +  NYCRN      P P+C+ + P+     C +  C ++A   T V          +G  Y GT     +G+PC  W +       I P  F  + +   +NYCR+P    S   P+C+T   T     + YC+  P+C  S           +Y G +++T SG+ C  W   +N+   +  +    +A+KL    NYCRNPD D  GPWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWNSMIPHEHSFL--PSSYRGKDLQE--NYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQC--------SEVEC-MTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDD--NYCRNP--DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDL--RENYCRNPDGAES---PWCFT---TDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWD--KNMEDLHRHIFWEPDASKLN--KNYCRNPDDDAHGPWCY 454          

HSP 2 Score: 109.383 bits (272), Expect = 1.025e-23
Identity = 111/360 (30.83%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS-----------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPS-FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            +G SY GT +I+KSG+ C  W   S+   E ++ P   +     +NYCR+P       GP+C+TS      E C+I    PQC   +  T     Y G ++ T SG  C  W    P    F  P+       +D  NYCRNPD  P  PWCY L+      YC +  C+            T  C  Q     Y G  N   NG+ C +W    P   D  I+P  F  + L        +NYCR P        SPWC+ ++P +     S    C+V+    CY   N   Y G  + T +G  C +W   NM  L +           PD + +   NYCR P  D    + PWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWN--SMIPHEHSFLPSSYRGKDLQENYCRNPRG--EEGGPWCFTSNPEVRYEVCDI----PQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFL-PERYPDKGFDD--NYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHD--ITPENFKCKDL-------RENYCRNPDGAE----SPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYR-GNGKNYMGNLSKTRSGLTCSMWDK-NMEDLHRH------IFWEPDASKL-NKNYCRNPDDD---AHGPWCY 454          

HSP 3 Score: 99.7525 bits (247), Expect = 1.108e-20
Identity = 96/303 (31.68%), Postives = 133/303 (43.89%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFVG 1113
             NYCRNP  +  G WC+ +N      + C  P CS +  C+    G  Y+G +  TE  +TC  W  + + + +   PE        +NYCRNP +    PWC+       + +C I TC  +               Q    G  Y GT     N  PC  W   + + + +   P  FK   + E  NYCRNP+   S PWC+TT  N    YC+ IPKC  ++     R N      G  Y G +S T  G TC++W      + +   F  PD S  N  NYCRN P  +  GP+C+ G
Sbjct:  175 ENYCRNPRGEEGGPWCFTSN-PEVRYEVCDIPQCSEV-ECM-TCNGESYRGPMDHTESGKTCQRWDQQ-TPHRHKFLPERYPDKGFDDNYCRNP-DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEG--YRGTSNTIWNGIPCQRW--DSQYPHKHDITPENFKCKDLRE--NYCRNPDGAES-PWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGN------GKNYMGNLSKTRSGLTCSMWDKNME-DLHRHIFWEPDASKLNK-NYCRN-PDDDAHGPWCYTG 456          

HSP 4 Score: 99.3673 bits (246), Expect = 1.316e-20
Identity = 108/377 (28.65%), Postives = 153/377 (40.58%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANAN---NYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC----FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSS-------VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN-RV--MCVVPMCNTATCRTTVE--GYSYAGTQAISKSGLPCLLW-TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
            C+  + GSY +G VS+T+    C  W+S   I    +F  +S    +   NYCRNP    GGPWC+  +   ++                         C  T +G  Y G +  T +   C  W   T    P+ ++ +  +        NYCRNP+  P  PWCYT   +   EYC I  C       T   +    C     G  Y GT +T   G  C  W S       +T  NF      +       NYCRN        P+CF   PN RV     +P C+ ++ +      G +Y G  + ++SGL C +W  N+        + PD S +  KNYCR+P +     GP+CYT   L   + C IS C
Sbjct:  129 CIIGKGGSY-KGTVSITKSGIKCQPWNS--MIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRY-------------EVCDIPQCSEVECM-TCNGESYRGPMDHTESGKTCQRWDQQT----PHRHKFLPERYPDKGFDDNYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRE-------NYCRNP--DGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKL-NKNYCRNPDD--DAHGPWCYTGNPLIPWDYCPISRC 470          

HSP 5 Score: 60.4622 bits (145), Expect = 1.312e-8
Identity = 69/256 (26.95%), Postives = 95/256 (37.11%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDN-----------DTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATIT 903
            F P   PD    D  NYCRNPD            DT   +C +    H        P      C+  + G  Y+G  +       C  W S+   + +   PEN        NYCRNP +    PWC+      + G+C+                +    C    +G  Y G ++ T +   C+ W           +R I ++        NYCRNP+ D  GPWCY  TGN     +YC I +C   T  TI 
Sbjct:  246 FLPERYPDKGFDD--NYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETT-ECIQGQ-GEGYRGTSNTIWNGIPCQRWDSQ-YPHKHDITPENFKCKDLRENYCRNP-DGAESPWCFTTDPNIRVGYCSQIPKCDV---------SSGQDCYRG-NGKNYMGNLSKTRSGLTCSMWDKNMED----LHRHIFWEPDASKLNKNYCRNPDDDAHGPWCY--TGNPLIPWDYCPISRCEGDTTPTIV 479          
BLAST of Plasminogen vs. Ensembl Mouse
Match: Hgf (hepatocyte growth factor [Source:MGI Symbol;Acc:MGI:96079])

HSP 1 Score: 119.783 bits (299), Expect = 4.990e-27
Identity = 105/351 (29.91%), Postives = 153/351 (43.59%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNR--VMCVVPMC-NTATCRTTV----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQ-------TATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLL---NAAKLEDAANYCRNPDSDPLGPWCY 1599
             G  Y GT++IT +   C PW +     + +   P  ++   + E  NYCRNP  +  GPWC+T+     Y  C IP+C        +   C  T  G  Y G +  T  G TC  W   T     F    +PD    +  NYCRN      P P+C+ + P+     C +  C ++A   T V          +G  Y GT     +G+PC  W +       I P  F  + +   +NYCR+P    S   P+C+T   T     + YC+  P+C  S           +Y G +++T SG+ C  W   +N+   +  +    +A+KL    NYCRNPD D  GPWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWNSMIPHEHSFL--PSSYRGKDLQE--NYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQC--------SEVEC-MTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDD--NYCRNP--DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDL--RENYCRNPDGAES---PWCFT---TDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWD--KNMEDLHRHIFWEPDASKLN--KNYCRNPDDDAHGPWCY 454          

HSP 2 Score: 109.383 bits (272), Expect = 1.025e-23
Identity = 111/360 (30.83%), Postives = 150/360 (41.67%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS-----------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPS-FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            +G SY GT +I+KSG+ C  W   S+   E ++ P   +     +NYCR+P       GP+C+TS      E C+I    PQC   +  T     Y G ++ T SG  C  W    P    F  P+       +D  NYCRNPD  P  PWCY L+      YC +  C+            T  C  Q     Y G  N   NG+ C +W    P   D  I+P  F  + L        +NYCR P        SPWC+ ++P +     S    C+V+    CY   N   Y G  + T +G  C +W   NM  L +           PD + +   NYCR P  D    + PWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWN--SMIPHEHSFLPSSYRGKDLQENYCRNPRG--EEGGPWCFTSNPEVRYEVCDI----PQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFL-PERYPDKGFDD--NYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHD--ITPENFKCKDL-------RENYCRNPDGAE----SPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYR-GNGKNYMGNLSKTRSGLTCSMWDK-NMEDLHRH------IFWEPDASKL-NKNYCRNPDDD---AHGPWCY 454          

HSP 3 Score: 99.7525 bits (247), Expect = 1.108e-20
Identity = 96/303 (31.68%), Postives = 133/303 (43.89%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFVG 1113
             NYCRNP  +  G WC+ +N      + C  P CS +  C+    G  Y+G +  TE  +TC  W  + + + +   PE        +NYCRNP +    PWC+       + +C I TC  +               Q    G  Y GT     N  PC  W   + + + +   P  FK   + E  NYCRNP+   S PWC+TT  N    YC+ IPKC  ++     R N      G  Y G +S T  G TC++W      + +   F  PD S  N  NYCRN P  +  GP+C+ G
Sbjct:  175 ENYCRNPRGEEGGPWCFTSN-PEVRYEVCDIPQCSEV-ECM-TCNGESYRGPMDHTESGKTCQRWDQQ-TPHRHKFLPERYPDKGFDDNYCRNP-DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEG--YRGTSNTIWNGIPCQRW--DSQYPHKHDITPENFKCKDLRE--NYCRNPDGAES-PWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGN------GKNYMGNLSKTRSGLTCSMWDKNME-DLHRHIFWEPDASKLNK-NYCRN-PDDDAHGPWCYTG 456          

HSP 4 Score: 99.3673 bits (246), Expect = 1.316e-20
Identity = 108/377 (28.65%), Postives = 153/377 (40.58%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANAN---NYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC----FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSS-------VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN-RV--MCVVPMCNTATCRTTVE--GYSYAGTQAISKSGLPCLLW-TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
            C+  + GSY +G VS+T+    C  W+S   I    +F  +S    +   NYCRNP    GGPWC+  +   ++                         C  T +G  Y G +  T +   C  W   T    P+ ++ +  +        NYCRNP+  P  PWCYT   +   EYC I  C       T   +    C     G  Y GT +T   G  C  W S       +T  NF      +       NYCRN        P+CF   PN RV     +P C+ ++ +      G +Y G  + ++SGL C +W  N+        + PD S +  KNYCR+P +     GP+CYT   L   + C IS C
Sbjct:  129 CIIGKGGSY-KGTVSITKSGIKCQPWNS--MIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRY-------------EVCDIPQCSEVECM-TCNGESYRGPMDHTESGKTCQRWDQQT----PHRHKFLPERYPDKGFDDNYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRE-------NYCRNP--DGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKL-NKNYCRNPDD--DAHGPWCYTGNPLIPWDYCPISRC 470          

HSP 5 Score: 60.4622 bits (145), Expect = 1.312e-8
Identity = 69/256 (26.95%), Postives = 95/256 (37.11%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDN-----------DTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATIT 903
            F P   PD    D  NYCRNPD            DT   +C +    H        P      C+  + G  Y+G  +       C  W S+   + +   PEN        NYCRNP +    PWC+      + G+C+                +    C    +G  Y G ++ T +   C+ W           +R I ++        NYCRNP+ D  GPWCY  TGN     +YC I +C   T  TI 
Sbjct:  246 FLPERYPDKGFDD--NYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETT-ECIQGQ-GEGYRGTSNTIWNGIPCQRWDSQ-YPHKHDITPENFKCKDLRENYCRNP-DGAESPWCFTTDPNIRVGYCSQIPKCDV---------SSGQDCYRG-NGKNYMGNLSKTRSGLTCSMWDKNMED----LHRHIFWEPDASKLNKNYCRNPDDDAHGPWCY--TGNPLIPWDYCPISRCEGDTTPTIV 479          
BLAST of Plasminogen vs. Ensembl Mouse
Match: Hgf (hepatocyte growth factor [Source:MGI Symbol;Acc:MGI:96079])

HSP 1 Score: 117.857 bits (294), Expect = 2.077e-26
Identity = 104/351 (29.63%), Postives = 150/351 (42.74%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNR--VMCVVPMC-NTATCRTTV----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQ-------TATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLL---NAAKLEDAANYCRNPDSDPLGPWCY 1599
             G  Y GT++IT +   C PW +     + Y  + +           NYCRNP  +  GPWC+T+     Y  C IP+C        +   C  T  G  Y G +  T  G TC  W   T     F    +PD    +  NYCRN      P P+C+ + P+     C +  C ++A   T V          +G  Y GT     +G+PC  W +       I P  F  + +   +NYCR+P    S   P+C+T   T     + YC+  P+C  S           +Y G +++T SG+ C  W   +N+   +  +    +A+KL    NYCRNPD D  GPWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWNSMIPHEHSYRGKDLQ---------ENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQC--------SEVEC-MTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDD--NYCRNP--DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDL--RENYCRNPDGAES---PWCFT---TDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWD--KNMEDLHRHIFWEPDASKLN--KNYCRNPDDDAHGPWCY 449          

HSP 2 Score: 108.997 bits (271), Expect = 1.442e-23
Identity = 110/358 (30.73%), Postives = 148/358 (41.34%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS-----------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPS-FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY 2178
            +G SY GT +I+KSG+ C  W      S+ P+    +     +NYCR+P       GP+C+TS      E C+I    PQC   +  T     Y G ++ T SG  C  W    P    F  P+       +D  NYCRNPD  P  PWCY L+      YC +  C+            T  C  Q     Y G  N   NG+ C +W    P   D  I+P  F  + L        +NYCR P        SPWC+ ++P +     S    C+V+    CY   N   Y G  + T +G  C +W   NM  L +           PD + +   NYCR P  D    + PWCY
Sbjct:  133 KGGSYKGTVSITKSGIKCQPWN-----SMIPHEHSYRGKDLQENYCRNPRG--EEGGPWCFTSNPEVRYEVCDI----PQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFL-PERYPDKGFDD--NYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHD--ITPENFKCKDL-------RENYCRNPDGAE----SPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYR-GNGKNYMGNLSKTRSGLTCSMWDK-NMEDLHRH------IFWEPDASKL-NKNYCRNPDDD---AHGPWCY 449          

HSP 3 Score: 99.7525 bits (247), Expect = 1.069e-20
Identity = 96/303 (31.68%), Postives = 133/303 (43.89%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFVG 1113
             NYCRNP  +  G WC+ +N      + C  P CS +  C+    G  Y+G +  TE  +TC  W  + + + +   PE        +NYCRNP +    PWC+       + +C I TC  +               Q    G  Y GT     N  PC  W   + + + +   P  FK   + E  NYCRNP+   S PWC+TT  N    YC+ IPKC  ++     R N      G  Y G +S T  G TC++W      + +   F  PD S  N  NYCRN P  +  GP+C+ G
Sbjct:  170 ENYCRNPRGEEGGPWCFTSN-PEVRYEVCDIPQCSEV-ECM-TCNGESYRGPMDHTESGKTCQRWDQQ-TPHRHKFLPERYPDKGFDDNYCRNP-DGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEG--YRGTSNTIWNGIPCQRW--DSQYPHKHDITPENFKCKDLRE--NYCRNPDGAES-PWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGN------GKNYMGNLSKTRSGLTCSMWDKNME-DLHRHIFWEPDASKLNK-NYCRN-PDDDAHGPWCYTG 451          

HSP 4 Score: 98.9821 bits (245), Expect = 1.702e-20
Identity = 107/377 (28.38%), Postives = 150/377 (39.79%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC----FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSS-------VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPN-RV--MCVVPMCNTATCRTTVE--GYSYAGTQAISKSGLPCLLW-TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
            C+  + GSY +G VS+T+    C  W+S       Y   +  EN       YCRNP    GGPWC+  +   ++                         C  T +G  Y G +  T +   C  W   T    P+ ++ +  +        NYCRNP+  P  PWCYT   +   EYC I  C       T   +    C     G  Y GT +T   G  C  W S       +T  NF      +       NYCRN        P+CF   PN RV     +P C+ ++ +      G +Y G  + ++SGL C +W  N+        + PD S +  KNYCR+P +     GP+CYT   L   + C IS C
Sbjct:  129 CIIGKGGSY-KGTVSITKSGIKCQPWNSMIPHEHSYRGKDLQEN-------YCRNPRGEEGGPWCFTSNPEVRY-------------EVCDIPQCSEVECM-TCNGESYRGPMDHTESGKTCQRWDQQT----PHRHKFLPERYPDKGFDDNYCRNPDGKPR-PWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTEC-IQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRE-------NYCRNP--DGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKL-NKNYCRNPDD--DAHGPWCYTGNPLIPWDYCPISRC 465          

HSP 5 Score: 60.4622 bits (145), Expect = 1.341e-8
Identity = 69/256 (26.95%), Postives = 95/256 (37.11%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDN-----------DTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATIT 903
            F P   PD    D  NYCRNPD            DT   +C +    H        P      C+  + G  Y+G  +       C  W S+   + +   PEN        NYCRNP +    PWC+      + G+C+                +    C    +G  Y G ++ T +   C+ W           +R I ++        NYCRNP+ D  GPWCY  TGN     +YC I +C   T  TI 
Sbjct:  241 FLPERYPDKGFDD--NYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETT-ECIQGQ-GEGYRGTSNTIWNGIPCQRWDSQ-YPHKHDITPENFKCKDLRENYCRNP-DGAESPWCFTTDPNIRVGYCSQIPKCDV---------SSGQDCYRG-NGKNYMGNLSKTRSGLTCSMWDKNMED----LHRHIFWEPDASKLNKNYCRNPDDDAHGPWCY--TGNPLIPWDYCPISRCEGDTTPTIV 474          
BLAST of Plasminogen vs. UniProt/SwissProt
Match: sp|O18783|PLMN_MACEU (Plasminogen OS=Macropus eugenii OX=9315 GN=PLG PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.008e-38
Identity = 150/520 (28.85%), Postives = 221/520 (42.50%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSI---YTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQST---TSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCNTATCRTTV-------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCT---PQCRNSQT--------------------ATDYAGIVNRTNSG-VCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVC-SPTQ-------------------GCYTQNNAWAY 1686
            G  Y+G +S T+   TC  WS        Y  + +P+  +    NYCRNP ++  GPWC+  +   ++ +C +                    C+      SG  Y GTI+ T +   C PW +     + Y   P  F +  + E  NYCRNP+ +P  PWC+T+   +  E+C IP+C +  P       C     G  Y G I+ T  G TC  W+  T    N +  +FP        NYCRN P   L  P+C+       +  C +P C T++  T               +G +Y GT + + SG  C  W++++    +  P+ FP+  ++  +NYCR+P    S   P+CYT   T   E CN+  C+       N+QT                      DY G  + T +G +C  WT  +P       P     A LE+  NYCRNPD DP GPWCY  +  K+  YC +P C SP+                    GCY Q ++W +
Sbjct:  108 GRNYRGTLSKTKSGITCQKWSDLSPHVPNYAPSKYPDAGL--EKNYCRNPDDDVKGPWCYTTNPDIRYEYCDV------------------PECEDECMHCSGENYRGTISKTESGIECQPWDSQEPHSHEYI--PSKFPSKDLKE--NYCRNPDGEPR-PWCFTSNPEKRWEFCNIPRCSSPPPPPGPMLQC-LKGRGENYRGKIAVTKSGHTCQRWNKQTPHKHNRTPENFP--CRGLDENYCRN-PDGELE-PWCYTTNPDVRQEYCAIPSCGTSSPHTDRVEQSPVIQECYEGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKTPDNFPNADLI--RNYCRNPDGDKS---PWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGKDYRGKRSTTVTGTLCQAWTAQEPHRHTIFTPDTYPRAGLEE--NYCRNPDGDPNGPWCYTTNPKKLFDYCDIPQCVSPSSFDCGKPRVEPQKCPGRIVGGCYAQPHSWPW 590          

HSP 2 Score: 132.494 bits (332), Expect = 4.723e-30
Identity = 143/450 (31.78%), Postives = 193/450 (42.89%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCRTTV-----AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMC--------NTATCRT-TVE-------------GYSYAGTQAISKSGLPCLLWTNIS---VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC 1398
            P + P+  PDA L    NYCRNPD+D  G WCY TN      +YC  P C     C+   +G  Y+G +S TE    C  W S+      Y  + FP   +    NYCRNP +    PWC+  +   ++ FC IP C   PP P                G  Y G IA+T + + C  W   T   +   NR P  F    + E  NYCRNP+ +   PWCYTT  +  QEYC IP C T++P T                G  Y GT STT  G  C  WSS+T      +  +FP+       NYCRN P  +   P+C+     V    C +  C        N  T R  +V+             G  Y G ++ + +G  C  WT       T   P+ +P   +   +NYCR+P      +GP+CYT+      + C+I  C
Sbjct:  135 PNYAPSKYPDAGLE--KNYCRNPDDDVKGPWCYTTN-PDIRYEYCDVPECED--ECMHC-SGENYRGTISKTESGIECQPWDSQEPHSHEYIPSKFPSKDL--KENYCRNP-DGEPRPWCFTSNPEKRWEFCNIPRCSSPPPPPGPMLQCLKG------RGENYRGKIAVTKSGHTCQRWNKQTPHKH---NRTPENFPCRGLDE--NYCRNPDGELE-PWCYTTNPDVRQEYCAIPSCGTSSPHTDRVEQSPVIQECYEGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKTPDNFPNADLIR--NYCRN-PDGD-KSPWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGKDYRGKRSTTVTGTLCQAWTAQEPHRHTIFTPDTYPRAGL--EENYCRNPDG--DPNGPWCYTTNPKKLFDYCDIPQC 555          

HSP 3 Score: 130.954 bits (328), Expect = 1.458e-29
Identity = 145/501 (28.94%), Postives = 199/501 (39.72%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQ--VKIYCQLPVC------------SPT-QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT------------------------SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G  Y GT+S T  G TC  WS ++    N+  S +PD  A    NYCRN P  ++ GP+C+     +    C VP C       +  G +Y GT + ++SG+ C  W +    S E  P+ FP + +   +NYCR+P        P+C+TS      E CNI  C+          QC   +   +Y G +  T SG  C  W    P   N R P+      L++  NYCRNPD + L PWCY  +    + YC +P C            SP  Q CY +     Y G  + T +G  C  WS   P     +          P+A     +NYCR P        SPWCY  +P V       + +CN+  C+                        S   + +   Y G  +TT  GT C  W+            P+  +   PD    A    NYCR P  D    N PWCY +    L       F +C I  C
Sbjct:  108 GRNYRGTLSKTKSGITCQKWSDLSPHVPNYAPSKYPD--AGLEKNYCRN-PDDDVKGPWCYTTNPDIRYEYCDVPECEDECMHCS--GENYRGTISKTESGIECQPWDSQEPHSHEYIPSKFPSKDL--KENYCRNPDGEPR---PWCFTSNPEKRWEFCNIPRCSSPPPPPGPMLQCLKGR-GENYRGKIAVTKSGHTCQRWNKQTPHKHN-RTPENFPCRGLDE--NYCRNPDGE-LEPWCYTTNPDVRQEYCAIPSCGTSSPHTDRVEQSPVIQECY-EGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKT------PDNFPNADLI--RNYCRNPDGDK----SPWCYTMDPTVR------WEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGKDYRGKRSTTVTGTLCQAWTAQE---------PHRHTIFTPDTYPRAGLEENYCRNPDGD---PNGPWCYTTNPKKL-------FDYCDIPQC 555          

HSP 4 Score: 125.561 bits (314), Expect = 7.894e-28
Identity = 143/501 (28.54%), Postives = 193/501 (38.52%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVG-PNRV--MCVVPMCNTATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT-PQCRNSQTATD------------------YAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCS----------------------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFE 1968
            G  Y GT++ T +   C  W+  +     Y   P  +  A + +  NYCRNP+ D  GPWCYTT  +   EYC +P+C          + C    +G  Y GTIS T  G  C  W S    +  +  S FP  S     NYCRN      P P+CF   P +    C +P C++               G +Y G  A++KSG  C  W   +    +  P  FP + +   +NYCR+P   L    P+CY   TT       YC  P C  S   TD                  Y G  + T SG  C  W+    + + + P     A L    NYCRNPD D   PWCY ++  V+  +C L  CS                      P   C   +    Y G  + T  G  C  W+   P          F     P A     +NYCR P         PWCY + P+        F YC++  C S  +F+
Sbjct:  108 GRNYRGTLSKTKSGITCQKWSDLSPHVPNYA--PSKYPDAGLEK--NYCRNPDDDVKGPWCYTTNPDIRYEYCDVPEC---------EDEC-MHCSGENYRGTISKTESGIECQPWDSQEPHSHEYIPSKFP--SKDLKENYCRNP--DGEPRPWCFTSNPEKRWEFCNIPRCSSPPPPPGPMLQCLKGRGENYRGKIAVTKSGHTCQRWNKQTPHKHNRTPENFPCRGL--DENYCRNPDGELE---PWCY---TTNPDVRQEYCAIPSCGTSSPHTDRVEQSPVIQECYEGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKTPDNFPNADL--IRNYCRNPDGDK-SPWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGK-DYRGKRSTTVTGTLCQAWTAQEPHRHTI-----FTPDTYPRAGL--EENYCRNPDGD---PNGPWCYTTNPK------KLFDYCDIPQCVSPSSFD 562          

HSP 5 Score: 92.0485 bits (227), Expect = 1.664e-17
Identity = 78/245 (31.84%), Postives = 105/245 (42.86%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRT-------------GSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTT---------SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFT 882
             NYCRNPD + +  WCY TN     ++YC  P  G  +   DR              G  Y+G  S T   + C  WSS        T  NFP   +    NYCRNP  +   PWC+      ++ FC +  C  T        T    +  +T+         SG +Y G  + T     C  WT      +  F  P  +  A + E  NYCRNP+ DP+GPWCYTT   +  +YC IP+C +
Sbjct:  321 ENYCRNPDGE-LEPWCYTTN-PDVRQEYCAIPSCGTSSPHTDRVEQSPVIQECYEGKGENYRGTTSTTISGKKCQAWSSMTPHQHKKTPDNFPNADLIR--NYCRNPDGDKS-PWCYTMDPTVRWEFCNLEKCSGTGSTVLNAQTTRVPSVDTTSHPESDCMYGSGKDYRGKRSTTVTGTLCQAWTAQEPHRHTIFT-PDTYPRAGLEE--NYCRNPDGDPNGPWCYTTNPKKLFDYCDIPQCVS 557          
BLAST of Plasminogen vs. UniProt/SwissProt
Match: sp|Q01177|PLMN_RAT (Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg PE=2 SV=2)

HSP 1 Score: 151.754 bits (382), Expect = 4.331e-36
Identity = 145/490 (29.59%), Postives = 208/490 (42.45%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQST---TSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVE------------------GYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCT------------PQCRN----SQT------ATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCS 1644
            G  Y+G +S T+   TC  WS        Y+ +  P   +    NYCRNP N+  GPWC+      ++ +C I                    C+      SG +Y G I+ T +   C  W + +   + Y   P  F +  +    NYCRNP+ +P  PWC+TT  N+  EYC IP+C T  P       C     G  Y GT+S TA G TC  WS  T    N +  +FP  +     NYCRN        P+C+   +++    C +P C ++      +                  G SY GT + + +G  C  W +++    S  P  FPD  +    NYCR+P N     GP+C+T+  +   E CN+  C+            PQ  +    S+T        +Y G    T +G  C  W   +P +     PQ    A LE   NYCRNPD D  GPWCY  +  K+  YC +P+C+
Sbjct:  108 GKGYRGTMSKTKTGVTCQKWSDTSPHVPKYSPSTHPSEGL--EENYCRNPDNDEQGPWCYTTDPDQRYEYCNI------------------PECEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYI--PAKFPSKNLK--MNYCRNPDGEPR-PWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQC-LKGRGENYRGTVSVTASGKTCQRWSEQTPHRHNRTPENFPCKNLEE--NYCRNP--DGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGL--EMNYCRNPDN--DQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETDCMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLE--KNYCRNPDGDVNGPWCYTMNPRKLYDYCNIPLCA 561          

HSP 2 Score: 142.895 bits (359), Expect = 3.240e-33
Identity = 149/505 (29.50%), Postives = 201/505 (39.80%), Query Frame = 1
Query:  637 STTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQT-------------------ATDYAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCSPTQGCYTQN--------------------NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFE 1968
             T  G  Y GT++ T     C  W+ T+     Y   P    +  + E  NYCRNP+ D  GPWCYTT  +Q  EYC IP+C            C    +G +Y G IS T  G  C  W S +     +  + FP  S    +NYCRN      P P+CF   PN+    C +P C T               G +Y GT +++ SG  C  W+  +    +  P  FP +++   +NYCR+P    +   P+CYT  S    E C I  C       Q+                      Y G  + TN+G  C  W     + + + P     A LE   NYCRNPD+D  GPWC+  +  V+  YC L  CS T G   ++                    N   Y G   VT  G  C +W+   P          F  Q  P A     +NYCR P         PWCY   P+        + YCN+ +C S  +FE
Sbjct:  104 KTGIGKGYRGTMSKTKTGVTCQKWSDTSPHVPKY--SPSTHPSEGLEE--NYCRNPDNDEQGPWCYTTDPDQRYEYCNIPEC---------EEEC-MYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFP--SKNLKMNYCRNP--DGEPRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWSEQTPHRHNRTPENFPCKNL--EENYCRNPDGETA---PWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGLE--MNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETDCMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRI-----FTPQTNPRAGL--EKNYCRNPDGD---VNGPWCYTMNPR------KLYDYCNIPLCASLSSFE 567          

HSP 3 Score: 132.88 bits (333), Expect = 3.552e-30
Identity = 142/454 (31.28%), Postives = 197/454 (43.39%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNC---RTTVA-------GTEYTGTISTTAKGDTCTLWSSVTNGNFND--SSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM-------------------CVVPMCNTATCRTTVE-----GYSYAGTQAISKSGLPCLLWTNISVTSIE---PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYC 1398
            P + P+  P   L +  NYCRNPDND  G WCY T+      +YC  P C     C++  +G  Y+G +S T     C  W S+      Y  A FP  ++    NYCRNP +    PWC+      ++ +C IP C   PP P  T             G  Y GT+++T +   C  W+  T   +   NR P  F    + E  NYCRNP+ + + PWCYTT      EYC IP C ++     + ++    +T V        G  Y GT STT  G  C  W S+T  + +   ++FPD  A   +NYCRN P ++  GP+CF     V                     +VP   +A   +  +     G  Y G  A++ +G PC  W      S     P   P   +   KNYCR+P     V+GP+CYT       + CNI  C
Sbjct:  135 PKYSPSTHPSEGLEE--NYCRNPDNDEQGPWCYTTDPDQRY-EYCNIPECEE--ECMYC-SGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNL--KMNYCRNP-DGEPRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKG------RGENYRGTVSVTASGKTCQRWSEQTPHRH---NRTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPD--AGLEMNYCRN-PDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETDCMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGL--EKNYCRNPDG--DVNGPWCYTMNPRKLYDYCNIPLC 560          

HSP 4 Score: 129.028 bits (323), Expect = 6.361e-29
Identity = 150/517 (29.01%), Postives = 206/517 (39.85%), Query Frame = 1
Query:  907 NNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVK-IYCQLPVC----SPTQG--------------CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQL---LPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC------------------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            + C+T + G  Y GT+S T  G TC  WS  +     ++ S+ P  S     NYCRN P ++  GP+C+   P++    C +P C          G  Y G  + + SGL C  W + S       P  FP +++    NYCR+P        P+C+T+      E C+I  CT          QC   +   +Y G V+ T SG  C  W++  P   N R P+      LE+  NYCRNPD +   PWCY  +SQ++  YC++P C    SP Q               CY Q N  +Y G  + T  G  C  W          S++P   S+     PDA      NYCR P N       PWC+ ++P V       + YCN+  C                        T C  + N   Y G    T+ GTPC  W+            P+      P     A    NYCR P  D   +N PWCY      L       + +C I  C
Sbjct:  101 SECKTGI-GKGYRGTMSKTKTGVTCQKWSDTSPHVPKYSPSTHP--SEGLEENYCRN-PDNDEQGPWCYTTDPDQRYEYCNIPECEEEC--MYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNL--KMNYCRNPDGEPR---PWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGR-GENYRGTVSVTASGKTCQRWSEQTPHRHN-RTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSQLRWEYCEIPSCGSSVSPDQSDSSVLPEQTPVVQECY-QGNGKSYRGTSSTTNTGKKCQSW---------VSMTPHSHSKTPANFPDAGL--EMNYCRNPDNDQR---GPWCFTTDPSVR------WEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETDC-MYGNGKEYRGKTAVTAAGTPCQEWAAQE---------PHSHRIFTPQTNPRAGLEKNYCRNPDGD---VNGPWCYTMNPRKL-------YDYCNIPLC 560          
BLAST of Plasminogen vs. UniProt/SwissProt
Match: sp|P06867|PLMN_PIG (Plasminogen OS=Sus scrofa OX=9823 GN=PLG PE=1 SV=3)

HSP 1 Score: 146.747 bits (369), Expect = 1.942e-34
Identity = 146/489 (29.86%), Postives = 200/489 (40.90%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWS-SKGSI--YTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQST---TSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTV-------------------EGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCT---------PQCRNSQTATD------------YAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVC 1641
            G  Y+G  S T+    C  WS S   I  Y+   FP   +    NYCRNP N+  GPWC+      +F +C I                    C+      SG  Y G I+ T +   C  W + +   + Y       K   M    NYCRNP+ +P  PWC+TT  N+  E+C IP+C T  P +     C     G  Y GT+S TA G TC  WS+ +    N +  +FP  +     NYCRN        P+C+   + V    C +P C ++T  T                      G SY GT + + +G  C  W +++    E  P  FP+  +    NYCR+P    S   P+CYT+      E CN+  C+         P      +  D            Y G    T +GV C  W   +P   +   P+    A LE   NYCRNPD D  GPWCY  +  K+  YC +P C
Sbjct:  108 GKNYRGTTSKTKSGVICQKWSVSSPHIPKYSPEKFPLAGL--EENYCRNPDNDEKGPWCYTTDPETRFDYCDI------------------PECEDECMHCSGEHYEGKISKTMSGIECQSWGSQSPHAHGYLPSKFPNKNLKM----NYCRNPDGEPR-PWCFTTDPNKRWEFCDIPRCTTPPPTSGPTYQC-LKGRGENYRGTVSVTASGHTCQRWSAQSPHKHNRTPENFPCKNLEE--NYCRNP--DGETAPWCYTTDSEVRWDYCKIPSCGSSTTSTEYLDAPVPPEQTPVAQDCYRGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPGNFPNAGLTM--NYCRNPDADKS---PWCYTTDPRVRWEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDCMFGNGKRYRGKRATTVAGVPCQEWAAQEPHRHSIFTPETNPRAGLE--KNYCRNPDGDDNGPWCYTTNPQKLFDYCDVPQC 559          

HSP 2 Score: 130.954 bits (328), Expect = 1.510e-29
Identity = 147/503 (29.22%), Postives = 201/503 (39.96%), Query Frame = 1
Query:  637 STTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT-PQCRNSQTATD------------------------YAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQGCYTQ-------------------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
             T +G  Y GT + T +   C  W+ ++     Y   P  F  A + E  NYCRNP+ D  GPWCYTT      +YC IP+C          + C    +G  Y G IS T  G  C  W S +     +  S FP+ +    +NYCRN      P P+CF   PN+    C +P C T    +          G +Y GT +++ SG  C  W+  S    +  P  FP +++   +NYCR+P    +   P+CY   TT       YC  P C +S T+T+                        Y G  + T +G  C  W     + + + P     A L    NYCRNPD+D   PWCY  + +V+  YC L  CS T+   T                     N   Y G    T  GV C +W+   P          F  +  P A     +NYCR P         PWCY + PQ        F YC+V  C +
Sbjct:  104 KTGNGKNYRGTTSKTKSGVICQKWSVSSPHIPKY--SPEKFPLAGLEE--NYCRNPDNDEKGPWCYTTDPETRFDYCDIPEC---------EDEC-MHCSGEHYEGKISKTMSGIECQSWGSQSPHAHGYLPSKFPNKNL--KMNYCRNP--DGEPRPWCFTTDPNKRWEFCDIPRCTTPPPTSGPTYQCLKGRGENYRGTVSVTASGHTCQRWSAQSPHKHNRTPENFPCKNL--EENYCRNPDGETA---PWCY---TTDSEVRWDYCKIPSCGSSTTSTEYLDAPVPPEQTPVAQDCYRGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPGNFPNAGL--TMNYCRNPDADK-SPWCYTTDPRVRWEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDCMFGNGKRYRGKRATTVAGVPCQEWAAQEPHRHSI-----FTPETNPRAGL--EKNYCRNPDGD---DNGPWCYTTNPQ------KLFDYCDVPQCVT 561          

HSP 3 Score: 128.257 bits (321), Expect = 1.007e-28
Identity = 144/510 (28.24%), Postives = 199/510 (39.02%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVCSPT-------------------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCY----------------------TFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            G  Y GT S T  G  C  WS  S     ++   FP   A    NYCRN P ++  GP+C+          C +P C       +  G  Y G  + + SG+ C  W + S       P+ FP++++    NYCR+P        P+C+T+      E C+I  CT          QC   +   +Y G V+ T SG  C  W+   P   N R P+      LE+  NYCRNPD +   PWCY  +S+V+  YC++P C  +                   Q CY + N  +Y G  + T  G  C  W    P   + +          P+A  T   NYCR P        SPWCY ++P+V       + YCN+  C+                          F N  RY G   TT  G PC  W+            P+  S   P+    A    NYCR P  D    N PWCY +    L       F +C +  C T++ 
Sbjct:  108 GKNYRGTTSKTKSGVICQKWSVSSPHIPKYSPEKFP--LAGLEENYCRN-PDNDEKGPWCYTTDPETRFDYCDIPECEDECMHCS--GEHYEGKISKTMSGIECQSWGSQSPHAHGYLPSKFPNKNL--KMNYCRNPDGEPR---PWCFTTDPNKRWEFCDIPRCTTPPPTSGPTYQCLKGR-GENYRGTVSVTASGHTCQRWSAQSPHKHN-RTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSEVRWDYCKIPSCGSSTTSTEYLDAPVPPEQTPVAQDCY-RGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPG------NFPNAGLT--MNYCRNPDADK----SPWCYTTDPRVR------WEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDCMFGNGKRYRGKRATTVAGVPCQEWAAQE---------PHRHSIFTPETNPRAGLEKNYCRNPDGD---DNGPWCYTTNPQKL-------FDYCDVPQCVTSSF 564          

HSP 4 Score: 127.872 bits (320), Expect = 1.387e-28
Identity = 146/463 (31.53%), Postives = 202/463 (43.63%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTN-GTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNN----CRTTVA-------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVE-------------------------GYSYAGTQAISKSGLPCLLWTNISVTSIEPN----YFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQC 1410
            P + P   P A L +  NYCRNPDND  G WCY T+  T F   YC  P C     C+   +G +Y+G +S T     C  W S+      Y  + FP  ++    NYCRNP +    PWC+      ++ FC IP C   PP    T             G  Y GT+++T + + C  W+  +   +   NR P  F    + E  NYCRNP+ + + PWCYTT      +YC IP C ++T +T   +      +T VA       G  Y GT STT  G  C  W S+T      +  +FP+  A   +NYCRN P ++   P+C+    RV      CN   C  T +                         G  Y G +A + +G+PC  W      + EP+    + P+ +  A   KNYCR+P      +GP+CY   TT       YC  PQC
Sbjct:  135 PKYSPEKFPLAGLEE--NYCRNPDNDEKGPWCYTTDPETRF--DYCDIPECED--ECMHC-SGEHYEGKISKTMSGIECQSWGSQSPHAHGYLPSKFPNKNL--KMNYCRNP-DGEPRPWCFTTDPNKRWEFCDIPRCTTPPPTSGPTYQCLKG------RGENYRGTVSVTASGHTCQRWSAQSPHKH---NRTPENFPCKNLEE--NYCRNPDGE-TAPWCYTTDSEVRWDYCKIPSCGSSTTSTEYLDAPVPPEQTPVAQDCYRGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPGNFPN--AGLTMNYCRN-PDAD-KSPWCYTTDPRVR--WEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDCMFGNGKRYRGKRATTVAGVPCQEW-----AAQEPHRHSIFTPETNPRAGLEKNYCRNPDG--DDNGPWCY---TTNPQKLFDYCDVPQC 559          

HSP 5 Score: 79.7221 bits (195), Expect = 1.310e-13
Identity = 72/252 (28.57%), Postives = 95/252 (37.70%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSG-------------------IWACLFDRTGSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWC--------WLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTT 888
             NYCRNPD +T   WCY T+ +     YCK P  G                   +    +   G  Y+G  S T     C  W S        T  NFP   +    NYCRNP  +   PWC        W   +L K                  +    +  C    +G  Y G  A T    PC  W       +  F  P     A + +  NYCRNP+ D +GPWCYTT   +  +YC +P+C T++
Sbjct:  321 ENYCRNPDGETAP-WCYTTD-SEVRWDYCKIPSCGSSTTSTEYLDAPVPPEQTPVAQDCYRGNGESYRGTSSTTITGRKCQSWVSMTPHRHEKTPGNFPNAGLTM--NYCRNPDADKS-PWCYTTDPRVRWEYCNLKKCSETEQQVTNFPAIAQVPSVEDLSEDCM-FGNGKRYRGKRATTVAGVPCQEWAAQEPHRHSIFT-PETNPRAGLEK--NYCRNPDGDDNGPWCYTTNPQKLFDYCDVPQCVTSS 563          

HSP 6 Score: 64.3142 bits (155), Expect = 7.196e-9
Identity = 51/192 (26.56%), Postives = 78/192 (40.62%), Query Frame = 1
Query: 1672 NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            N   Y G  + TK+GV C KWS   P +      P +  +  P A     +NYCR P N       PWCY ++P+        F YC++  C       +   Y G  + T +G  C  W + +  +        Y+ S  P+  +    NYCR P  +     +PWC+ +  +       + + FC I  C
Sbjct:  107 NGKNYRGTTSKTKSGVICQKWSVSSPHI------PKYSPEKFPLAGL--EENYCRNPDNDEK---GPWCYTTDPETR------FDYCDIPECEDECMHCSGEHYEGKISKTMSGIECQSWGSQSPHAH------GYLPSKFPNKNLKM--NYCRNPDGE----PRPWCFTTDPN-------KRWEFCDIPRC 262          
BLAST of Plasminogen vs. UniProt/SwissProt
Match: sp|Q29485|PLMN_ERIEU (Plasminogen OS=Erinaceus europaeus OX=9365 GN=PLG PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 5.468e-34
Identity = 138/484 (28.51%), Postives = 200/484 (41.32%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN-SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCNTATCRTTVE---------------------GYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP-----------QCRNSQTATD----------YAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVC 1641
            G YY+G VS T+   TC  WS++       +  EN S     NYCRNP N+  GPWC+      ++ +C I  C+                     SG  Y G I+ T +   C PW   +   +P+   P  F +  +    NYCRNP+ +P  PWC+T   N+  EYC IP+C T  P +     C     G  Y G ++ T  G TC  W   +    + +           NYCRN      P P+CF   + V    C +P C ++   T                        G +Y GT + + +G  C  WT++     S  P  +PD  +    NYCR+P       GP+CYT+  +   E CN+  C+            Q  ++  +++          Y G    T +G  C  W   +P   +   P+    A L++  NYCRNPD D  GPWCY  +  K+  YC +P C
Sbjct:  108 GKYYRGTVSKTKTGLTCQKWSAETPHKPRFSPDENPSEGLDQNYCRNPDNDPKGPWCYTMDPEVRYEYCEIIQCEDECMH---------------CSGQNYVGKISRTMSGLECQPW--DSQIPHPHGFIPSKFPSKNLK--MNYCRNPDGEPR-PWCFTMDRNKRWEYCDIPRCTTPPPPSGPTYQC-LMGNGEHYQGNVAVTVSGLTCQRWGEQSPHRHDRTPENYPCKNLDENYCRNP--DGEPAPWCFTTNSSVRWEFCKIPDCVSSASETEHSDAPVIVPPEQTPVVQECYQGNGQTYRGTSSTTITGKKCQPWTSMRPHRHSKTPENYPDADLTM--NYCRNPD---GDKGPWCYTTDPSVRWEFCNLKKCSGTEMSATNSSPVQVSSASESSEQDCIIDNGKGYRGTKATTGAGTPCQAWAAQEPHRHSIFTPETNPRADLQE--NYCRNPDGDANGPWCYTTNPRKLFDYCDIPHC 561          

HSP 2 Score: 120.939 bits (302), Expect = 2.314e-26
Identity = 142/502 (28.29%), Postives = 193/502 (38.45%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVE-------GYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQTATD--------------------------YAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCSPTQGCYTQ-------------------NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            G  Y GT++ T     C  W+  T    P+  R    +  +     NYCRNP+ DP GPWCYT       EYC I +C          + C    +G  Y G IS T  G  C  W S       F  S FP  S    +NYCRN      P P+CF          C +P C T    +          G  Y G  A++ SGL C  W   S    +  P  +P +++   +NYCR+P    +   P+C+T+ ++   E C I    P C +S + T+                          Y G  + T +G  C  WT  R + + + P+    A L    NYCRNPD D  GPWCY  +  V+  +C L  CS T+   T                    +N   Y G    T  G  C  W+   P          F  +  P A     +NYCR P      +  PWCY + P+        F YC++  C S
Sbjct:  108 GKYYRGTVSKTKTGLTCQKWSAET----PHKPRFSPDENPSEGLDQNYCRNPDNDPKGPWCYTMDPEVRYEYCEIIQC---------EDEC-MHCSGQNYVGKISRTMSGLECQPWDSQIPHPHGFIPSKFP--SKNLKMNYCRNP--DGEPRPWCFTMDRNKRWEYCDIPRCTTPPPPSGPTYQCLMGNGEHYQGNVAVTVSGLTCQRWGEQSPHRHDRTPENYPCKNL--DENYCRNPDGEPA---PWCFTTNSSVRWEFCKI----PDCVSSASETEHSDAPVIVPPEQTPVVQECYQGNGQTYRGTSSTTITGKKCQPWTSMRPHRHSKTPENYPDADL--TMNYCRNPDGD-KGPWCYTTDPSVRWEFCNLKKCSGTEMSATNSSPVQVSSASESSEQDCIIDNGKGYRGTKATTGAGTPCQAWAAQEPHRHSI-----FTPETNPRADL--QENYCRNPDGD---ANGPWCYTTNPR------KLFDYCDIPHCVS 563          

HSP 3 Score: 118.242 bits (295), Expect = 1.321e-25
Identity = 140/504 (27.78%), Postives = 190/504 (37.70%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTP---------QCRNSQTATDYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVCSPT---------------------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYT----------------------FENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA--ANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G  Y GT+S T  G TC  WS+ T      S   + S     NYCRN P ++  GP+C+     V    C +  C       +  G +Y G  + + SGL C  W +         P+ FP +++    NYCR+P        P+C+T       E C+I  CT          QC        Y G V  T SG+ C  W +   + + R P+      L++  NYCRNPD +P  PWC+   S V+  +C++P C  +                     Q CY Q N   Y G  + T  G  C  W+   P         S   +  PDA  T   NYCR P         PWCY ++P V       + +CN+  C+                           +N   Y G   TT  GTPC  W+            P+  S   P+    A    NYCR P  D    N PWCY +    L       F +C I  C
Sbjct:  108 GKYYRGTVSKTKTGLTCQKWSAETPHKPRFSPDENPSEGLDQNYCRN-PDNDPKGPWCYTMDPEVRYEYCEIIQCEDECMHCS--GQNYVGKISRTMSGLECQPWDSQIPHPHGFIPSKFPSKNL--KMNYCRNPDGEPR---PWCFTMDRNKRWEYCDIPRCTTPPPPSGPTYQCLMG-NGEHYQGNVAVTVSGLTCQRWGEQSPHRHDRTPENYPCKNLDE--NYCRNPDGEP-APWCFTTNSSVRWEFCKIPDCVSSASETEHSDAPVIVPPEQTPVVQECY-QGNGQTYRGTSSTTITGKKCQPWTSMRPHRH------SKTPENYPDADLT--MNYCRNPDGDKG----PWCYTTDPSVR------WEFCNLKKCSGTEMSATNSSPVQVSSASESSEQDCIIDNGKGYRGTKATTGAGTPCQAWAAQE---------PHRHSIFTPETNPRADLQENYCRNPDGD---ANGPWCYTTNPRKL-------FDYCDIPHC 561          

HSP 4 Score: 109.768 bits (273), Expect = 6.589e-23
Identity = 134/463 (28.94%), Postives = 193/463 (41.68%), Query Frame = 1
Query:  178 NPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWAC---LFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXX--AGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNN------CRTTVA-------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCN----TATCRTTVE----------------GYSYAGTQAISKSGLPCLLWT-----NISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCT 1401
             P F P   P   L    NYCRNPDND  G WCY  +      +YC+     I  C       +G  Y G +S T     C  W S+      +  + FP  ++    NYCRNP +    PWC+      ++ +C IP C   PP    T     GN        G  Y G +A+T +   C  W   +     +   P  +    + E  NYCRNP+ +P+ PWC+TT      E+C IP C ++   T   +        +T V        G  Y GT STT  G  C  W+S+     + +  ++PD  A   +NYCRN P  +  GP+C+     V    C +  C+    +AT  + V+                G  Y GT+A + +G PC  W        S+ + E N   D      +NYCR+P      +GP+CYT+      + C+I +C 
Sbjct:  134 KPRFSPDENPSEGLD--QNYCRNPDNDPKGPWCYTMD-PEVRYEYCE-----IIQCEDECMHCSGQNYVGKISRTMSGLECQPWDSQIPHPHGFIPSKFPSKNL--KMNYCRNP-DGEPRPWCFTMDRNKRWEYCDIPRCTTPPPPSGPTYQCLMGN--------GEHYQGNVAVTVSGLTCQRWGEQSPHR--HDRTPENYPCKNLDE--NYCRNPDGEPA-PWCFTTNSSVRWEFCKIPDCVSSASETEHSDAPVIVPPEQTPVVQECYQGNGQTYRGTSSTTITGKKCQPWTSMRPHRHSKTPENYPD--ADLTMNYCRN-PDGDK-GPWCYTTDPSVRWEFCNLKKCSGTEMSATNSSPVQVSSASESSEQDCIIDNGKGYRGTKATTGAGTPCQAWAAQEPHRHSIFTPETNPRAD----LQENYCRNPDG--DANGPWCYTTNPRKLFDYCDIPHCV 562          
BLAST of Plasminogen vs. UniProt/SwissProt
Match: sp|P06868|PLMN_BOVIN (Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2)

HSP 1 Score: 143.665 bits (361), Expect = 1.760e-33
Identity = 141/493 (28.60%), Postives = 203/493 (41.18%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQST---TSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT---ATCRTTV----------------EGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCT---------PQCRNSQ----------TATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSPTQGC 1659
            G  Y+G  + T+   TC  WS+       ++   FP   +    NYCRNP N+  GPWC+      ++ +C I                    C+      SG  Y G IA T +   C  W + +   + Y       K   M    NYCRNP+ +P  PWC+TT   +  E+C IP+C T  P++  +  C     G  Y GT++ T  G TC  WS  T    N +  +FP  +     NYCRN   +    P+C+   + V    C +P C +   +T R  V                 G SY GT + + +G  C  W++++       P  +P+  +    NYCR+P    S   P+CYT+      E CN+  C+         PQ    +          T   Y G    T +GV C  W   +P   +   P+    + LE   NYCRNPD D  GPWCY  +  K   YC +P C  +  C
Sbjct:  115 GQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGL--EENYCRNPDNDENGPWCYTTDPDKRYDYCDI------------------PECEDKCMHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNLKM----NYCRNPDGEPR-PWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGT-GKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNLEE--NYCRNP--NGEKAPWCYTTNSEVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTM--NYCRNPDADKS---PWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPCQEWAAQEPHQHSIFTPETNPQSGLE--RNYCRNPDGDVNGPWCYTMNPRKPFDYCDVPQCESSFDC 570          

HSP 2 Score: 139.428 bits (350), Expect = 4.015e-32
Identity = 147/459 (32.03%), Postives = 193/459 (42.05%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR-PILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNNC-----RTTVA-------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVE-----------------------GYSYAGTQAISKSGLPCLLWTNISVTS---IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC-TPQCRNS 1419
            P F P   P A L +  NYCRNPDND  G WCY T+       YC  P C     C+   +G  Y+G ++ T     C  W S+      Y  + FP  ++    NYCRNP +    PWC+      ++ FC IP C   PP           T      G  Y GT+A+T + + C  W+  T   +   NR P  F    + E  NYCRNPN +   PWCYTT      EYCTIP C  ++P +  R +      +T V        G  Y GT STT  G  C  WSS+T      +     +A   +NYCRN P ++   P+C+    RV      CN   C  T E                       G SY G +A + +G+PC  W            P   P   +   +NYCR+P     V+GP+CYT           YC  PQC +S
Sbjct:  142 PKFSPEKFPLAGLEE--NYCRNPDNDENGPWCYTTDPDKRY-DYCDIPECED--KCMHC-SGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL--KMNYCRNP-DGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGT------GKNYGGTVAVTESGHTCQRWSEQTPHKH---NRTPENFPCKNLEE--NYCRNPNGE-KAPWCYTTNSEVRWEYCTIPSC-ESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGLTMNYCRN-PDADK-SPWCYTTDPRVR--WEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPCQEWAAQEPHQHSIFTPETNPQSGL--ERNYCRNPDG--DVNGPWCYTMNPRKP---FDYCDVPQCESS 567          

HSP 3 Score: 129.413 bits (324), Expect = 4.499e-29
Identity = 148/505 (29.31%), Postives = 211/505 (41.78%), Query Frame = 1
Query:  637 STTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRV--MCVVPMCNTATCRTTVE-------GYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT-PQCRNSQTATD------------------------YAGIVNRTNSG-VCMFWTD-PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVK-IYCQLPVCSPT--------QGCYTQNNAWA---------YTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDA--QNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCY 1959
             T +G  Y GT A T +   C  W+ T+  + P F+ P  F  A + E  NYCRNP+ D +GPWCYTT  ++  +YC IP+C          + C    +G  Y G I+ T  G  C  W S +     +  S FP+ +    +NYCRN      P P+CF   P +    C +P C T    +  +       G +Y GT A+++SG  C  W+  +       P  FP +++   +NYCR+P+       P+CY   TT       YCT P C +S  +T+                        Y G  + T +G  C  W+    + + + P+    A L    NYCRNPD+D   PWCY  + +V+  +C L  CS T        Q    +N   A         Y G    T  GV C +W         A+  P   S   P+ +      +NYCR P         PWCY   P+        F YC+V  C S +
Sbjct:  111 KTGNGQTYRGTTAETKSGVTCQKWSATSP-HVPKFS-PEKFPLAGLEE--NYCRNPDNDENGPWCYTTDPDKRYDYCDIPEC---------EDKC-MHCSGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL--KMNYCRNP--DGEPRPWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPENFPCKNL--EENYCRNPN---GEKAPWCY---TTNSEVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCYHGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKTPENYPNAGL--TMNYCRNPDAD-KSPWCYTTDPRVRWEFCNLKKCSETPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPCQEW---------AAQEPHQHSIFTPETNPQSGLERNYCRNPDGD---VNGPWCYTMNPR------KPFDYCDVPQCESSF 568          

HSP 4 Score: 123.635 bits (309), Expect = 2.782e-27
Identity = 143/505 (28.32%), Postives = 200/505 (39.60%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNG--NFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTP---------QCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVK-IYCQLPVCSPT-------------------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENV----------------------SRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G  Y GT + T  G TC  WS+ +     F+   FP   A    NYCRN P ++  GP+C+   P++    C +P C       +  G +Y G  A + SG  C  W + S       P+ FP++++    NYCR+P        P+C+T+      E C+I  CT          QC    T  +Y G V  T SG  C  W++  P   N R P+      LE+  NYCRNP+ +   PWCY   S+V+  YC +P C  +                   Q CY   N  +Y G  + T  G  C  WS   P     +       +  P+A  T   NYCR P        SPWCY ++P+V       + +CN+  C+   T E V                        Y G   TT  G PC  W+            P+  S   P+    +    NYCR P  D+   N PWCY       +    + F +C +  C
Sbjct:  115 GQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFP--LAGLEENYCRN-PDNDENGPWCYTTDPDKRYDYCDIPECEDKCMHCS--GENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL--KMNYCRNPDGEPR---PWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKG-TGKNYGGTVAVTESGHTCQRWSEQTPHKHN-RTPENFPCKNLEE--NYCRNPNGE-KAPWCYTTNSEVRWEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCY-HGNGQSYRGTSSTTITGRKCQSWSSMTPHRHLKT------PENYPNAGLT--MNYCRNPDADK----SPWCYTTDPRVR------WEFCNLKKCSE--TPEQVPAAPQAPGVENPPEADCMIGTGKSYRGKKATTVAGVPCQEWAAQE---------PHQHSIFTPETNPQSGLERNYCRNPDGDV---NGPWCY-------TMNPRKPFDYCDVPQC 564          

HSP 5 Score: 112.849 bits (281), Expect = 7.779e-24
Identity = 116/398 (29.15%), Postives = 166/398 (41.71%), Query Frame = 1
Query: 1168 TVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCS---PTQGCYTQ---NNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS----------------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGP-NYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            T  G +Y GT A +KSG+ C  W+  S  V    P  FP   +   +NYCR+P N    +GP+CYT+      + C+I  C  +C +  +  +Y G + +T SG  C  W    P    +   +  N        NYCRNPD +P  PWC+     K   +C +P C+   P+ G   Q        Y G + VT++G +C +WS+  P   + +   +F  + L        +NYCR P  + A    PWCY +  +V       + YC +  C S                      CY   N   Y G ++TT  G  C  WS+  MT    L  P NY ++ L         NYCR P  D      PWCY +   V        + FC +  C
Sbjct:  112 TGNGQTYRGTTAETKSGVTCQKWSATSPHVPKFSPEKFPLAGL--EENYCRNPDN--DENGPWCYTTDPDKRYDYCDIPECEDKCMHC-SGENYEGKIAKTMSGRDCQAWDSQSPHAHGYIPSKFPNKNL---KMNYCRNPDGEPR-PWCFTTDPQKRWEFCDIPRCTTPPPSSGPKYQCLKGTGKNYGGTVAVTESGHTCQRWSEQTPHKHNRTPE-NFPCKNL-------EENYCRNPNGEKA----PWCYTTNSEVR------WEYCTIPSCESSPLSTERMDVPVPPEQTPVPQDCY-HGNGQSYRGTSSTTITGRKCQSWSS--MTPHRHLKTPENYPNAGL-------TMNYCRNPDAD----KSPWCYTTDPRV-------RWEFCNLKKC 461          
BLAST of Plasminogen vs. TrEMBL
Match: I1ZIL4 (Plasminogen-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 9.988e-122
Identity = 198/287 (68.99%), Postives = 241/287 (83.97%), Query Frame = 1
Query:   16 KSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKC 876
            KST+ CVNGVTNYLFKSQT+TEQ+L+SCVPW ++PLQY+N ++ P++   S+ VNPIFHPA+LPD S +DASNYCRN DNDTVG WCYV NG  ++KKYCKT CSGIWACL+DR GSYYQG V++T+ N+ CA W+ KGS+YT++NFPENSIANA+NYCRNPTNN GGPWCWLQS++ +FGFC IP CQQ+ PL PLT T+GNATC+ST  G EY G I+ITTN+N CA W  TT+FYNPY+N+P+LF T+TMAEV NYCRNP+ D  GPWCYT +G QEYC +P+C
Sbjct:    5 KSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSN-VNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQC 289          

HSP 2 Score: 106.686 bits (265), Expect = 2.604e-21
Identity = 88/293 (30.03%), Postives = 130/293 (44.37%), Query Frame = 1
Query:  892 ATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSV------------------TNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTA-----TCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCY--TSLTTTETCNISYCTPQ--------------CRNSQTATDYAGIVN-RTNSGVCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCS 1644
            A  + +NC   V    +    ST    ++C  W SV                   N  F+ +  PD S A+A NYCRNL    + G +C+V  N  + +   C T       C     G  Y GT  I+ S   C  W N+  +    + FP+ SI  A NYCR+P+N  +  GP+C+  +++T    C I +C                 C+++    +Y G ++  TN+  C  W  T   N  +  P L N + + +  NYCRNP +D +GPWCY  S V+ YC +P CS
Sbjct:    3 AGKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTV-GAWCYVR-NGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTN--NPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQCS 290          

HSP 3 Score: 88.9669 bits (219), Expect = 2.700e-15
Identity = 69/242 (28.51%), Postives = 104/242 (42.98%), Query Frame = 1
Query: 1510 NPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQ---VKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC---------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA-ANNYCRVPTRDIGYINQPWCY 2178
            +P +L      DA+NYCRN D+D +G WCY+ +    +K YC+   CS    C        Y G +N+T +  +C  W+       D++          P+ S  +A NYCR PTN     G PWC+        S ++ FG+C +  C                +C +      Y G  + T+N   C +W+T      +    P Y   +L + + +A   NYCR P+ D      PWCY
Sbjct:   62 HPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQ-CSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSN---------FPENSIANASNYCRNPTNN---PGGPWCWLQ------SNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNT------TSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTM---GPWCY 275          

HSP 4 Score: 70.8626 bits (172), Expect = 2.878e-9
Identity = 62/198 (31.31%), Postives = 84/198 (42.42%), Query Frame = 1
Query: 1720 SCLKWSDYP---------PALFDAS-ISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT---SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPI 2274
            SC+ W   P         P+L   S ++P F   +LPD S  DA NYCR   N +      WCY     V    L    YC  T C+   +C      S Y G  N T +   C  W+         L G  Y  S  P+N++  A+NYCR PT + G    PWC++       Q+    FGFC I  C  ++ + P+
Sbjct:   31 SCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTV---GAWCY-----VRNGDLYIKKYCK-TQCSGIWACLYDRIGSYYQGTVNITDSNQACANWN---------LKGSLYTDSNFPENSIANASNYCRNPTNNPG---GPWCWL-------QSNITRFGFCRIPFCQQSSPLAPL 200          
BLAST of Plasminogen vs. TrEMBL
Match: A0A1I8H6I2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.998e-50
Identity = 177/566 (31.27%), Postives = 245/566 (43.29%), Query Frame = 1
Query:  631 CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YC-TIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCN---TATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGI-VNRTNSG---------------VCMFWTDPRNINFRNPQLLNAAKLEDA-----ANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            C    +G+ Y GT  +T +   C  W+       P+     LF   ++A   NYCRNP    S  WCYT   + E  YC T+P C TT         CR T AG EY G  +    G +C  W+SV N   ++    D S ++A  YCRN+P +        V   R  C +P C+    + CR+   G  Y GT +IS SG  CLLW +  V +        ++I AA++ CR+P+N  S  G +C+ S T  E C +  C P+        DY    +N+T SG                      P +    NP L + A L DA     A+YCRNPD DP GPWC   S  K+YC  P  + T  C + +    Y G I+VT+ G +C KW    P       +  F     PD S   A+N+CR P         PWC  +    +G    F+ +C+     S Y F     Y G  +TT NG  C  W + +         P Y+  +    T+  A NYCR P  D    N PWC+ +  ++        F +C I+ C
Sbjct: 1515 CLINRAGLNYVGTQVVTKSLKTCVSWS-----LTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFDYCETVPICQTT---------CRQTEAGQEYNGATNKDRNGTSCLSWASV-NLIGSEYFLYDRSLSDANAYCRNVPPN--------VSVMRSSCSIPFCSQLSVSGCRSDKLGLLYRGTVSISVSGRSCLLWNSTGVYTAANWPVSGETIEAAESSCRNPNN--STVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQTKSGCQSWSSAYSASAASWYSFTQLPPGSSAVLNPPLFHPAHLPDASWTAAASYCRNPDDDPTGPWCPSPSGGKLYCSDPCNTVT--CKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDF-----PDLSLAAAENFCRNPNGNPF---GPWCIKAGNFTDGD---FWDFCDCI--DSSYGFT----YAGRRSTTGNGRTCQRWDSQH-----PHPHPYYLPQMFNSLTISQAENYCRNPNND---TNGPWCFTTDPNI-------RFEYCNISLC 2021          

HSP 2 Score: 171.014 bits (432), Expect = 6.480e-39
Identity = 187/659 (28.38%), Postives = 271/659 (41.12%), Query Frame = 1
Query:  352 DRTGSYYQGIVSVTEKNETCAIWSSK-GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXF-YNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG----SAANAVNYCRNLPRSNLPGPFCFVG-PNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTN----------------------ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC-NISYCTPQ-CRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKW-SDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS--------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV 2181
            +R G +Y+G +S T    TC  W+    + Y ++ FP+ S A A N CRNP  +T  PWC++ +                           + TC+ T +G EY G I+ +T+ +PC  W++     Y P F        +    +A    NP++    PWC T  G       C+IP C    P       CRT   GT Y G  ST+  G TC  W S   G +  +++P      SAAN  NYCRN P ++  G +C V   +   CVVP+C       + +  SY     I+ SG  C  W++                      IS     P   PD ++ AA +YCR+P N   + GP+C T   T + C N  Y T + CR  + + ++   + R       F T P          +N  K+  A+N  +                       P  +    C T      Y G ++VT+  V C  W S +P +       P   S   PD S   A+NYCRTP +Q+ +   PWCY S     GST   + YCNV  CT               C    + + Y G  +T+++G  C+ W++   T+L       Y+  +    T+ AA+NYCR P    G    PWCYV
Sbjct:  404 NRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAG---------SCGVAANYDFCDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPG-----GCRTDRLGTSYRGNQSTSVTGKTCIRWDSAP-GVYTAATWPVSGETISAAN--NYCRN-PNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSG--CARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDN--DITGPWCPTVAGTKQYCANPCYLTGKLCR--KISNEFLKFLRREFV-FLKFHTGPMEF-----IQINLIKIYSASNLTK-----------------------PSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVS------HPYSTSGWFPDGSAELAKNYCRTP-DQNKW--GPWCYKSNYNGTGST---WDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTS--NTALHTY----YLPQMFNAATMSAASNYCRNPD---GSTTGPWCYV 988          

HSP 3 Score: 170.244 bits (430), Expect = 1.269e-38
Identity = 154/576 (26.74%), Postives = 241/576 (41.84%), Query Frame = 1
Query:  340 ACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRN--PNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFP-DGSAANAV-NYCRNLPRSNLPGPFCFVGPNRVM-CVVPMCNTATC--RTTVEGYSYAGTQAISKSG--------------------LPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWC-----YLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYT 1962
             CL +R G  Y G   VT+  +TC  WS      ++A FPE S+A ANNYCRNP  +    WC+  +   +F +C                     TC+ T +G EY G      N   C  W +     + YF         ++++   YCRN  PN           +  +  C+IP C     + ++ + CR+   G  Y GT+S +  G +C LW+S   G +  +++P  G    A  + CRN P ++  G +CFV   +   C+V +C   T     T + Y Y   Q  +KSG                    LP      ++     P + PD S  AA +YCR+P +     GP+C +       C+    T  C+++    +Y G+++ T  G  C  W    P    F          L  A N+CRNP+ +P GPWC     + +     +C          C   +  + Y G  + T NG +C +W    P        P ++ Q+    + + A+NYCR P N    +  PWC+ ++P +       F YCN+++C+  Y+
Sbjct: 1514 GCLINRAGLNYVGTQVVTKSLKTCVSWSLTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFDYCETVPIC-------------QTTCRQTEAGQEYNGATNKDRNGTSCLSWASVNLIGSEYF-----LYDRSLSDANAYCRNVPPN----------VSVMRSSCSIPFC-----SQLSVSGCRSDKLGLLYRGTVSISVSGRSCLLWNST--GVYTAANWPVSGETIEAAESSCRN-PNNSTVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQ--TKSGCQSWSSAYSASAASWYSFTQLPPGSSAVLNPPLFHPAHLPDASWTAAASYCRNPDD--DPTGPWCPSPSGGKLYCSDPCNTVTCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDFPDLSLAAAENFCRNPNGNPFGPWCIKAGNFTDGDFWDFCD---------CIDSSYGFTYAGRRSTTGNGRTCQRWDSQHP-----HPHPYYLPQMFNSLTISQAENYCRNPNND---TNGPWCFTTDPNIR------FEYCNISLCSPQYS 2026          

HSP 4 Score: 154.066 bits (388), Expect = 1.027e-33
Identity = 157/568 (27.64%), Postives = 241/568 (42.43%), Query Frame = 1
Query:   28 GCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGG-------PWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKC--FTTTPATIT---RNNCRTTVAGTEYTGTISTTAKGDTCTLW------SSVTNGN-FNDSSFPDGSAANAVNYCRNLPRSNLPGPFC-FVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNI---SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSP 1647
            GC+       +       + L++CV W+  P              TSD        AL P+ S++ A+NYCRNP       WCY TN T     YC+T       C     G  Y G  +      +C  W+S   I +     + S+++AN YCRN   N          P+C   S L+  G                        C+S   G+ Y GT++I+ +   C  W +T  +     N P+  +T   AE +  CRNPN    G WC+ +    E C +  C   T+ P+      R     T +G +   +  + +     +        S+V N   F+ +  PD S   A +YCRN P  +  GP+C      ++ C  P CNT TC++T +  +Y G  ++++ G  C  W        T      FPD S+ AA+N+CR+P+   +  GP+C  +   T+     +C   C +S     YAG  + T +G  C  W    P    +  PQ+ N+  +  A NYCRNP++D  GPWC+  +  ++  YC + +CSP
Sbjct: 1514 GCLINRAGLNYVGTQVVTKSLKTCVSWSLTPF------------ATSD--------ALFPEKSVALANNYCRNPGYSKSAIWCY-TNATSLEFDYCETVPICQTTCRQTEAGQEYNGATNKDRNGTSCLSWASVNLIGSEYFLYDRSLSDANAYCRNVPPNVSVMRSSCSIPFC---SQLSVSG------------------------CRSDKLGLLYRGTVSISVSGRSCLLWNSTGVYTAA--NWPVSGETIEAAESS--CRNPNNSTVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQTKSGCQSWSSAYSASAASWYSFTQLPPGSSAVLNPPLFHPAHLPDASWTAAASYCRN-PDDDPTGPWCPSPSGGKLYCSDP-CNTVTCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDFPDLSLAAAENFCRNPNG--NPFGPWCIKAGNFTDGDFWDFC--DCIDSSYGFTYAGRRSTTGNGRTCQRWDSQHPHPHPYYLPQMFNSLTISQAENYCRNPNNDTNGPWCFTTDPNIRFEYCNISLCSP 2023          

HSP 5 Score: 149.443 bits (376), Expect = 2.414e-32
Identity = 159/594 (26.77%), Postives = 240/594 (40.40%), Query Frame = 1
Query:  166 SDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGI----WACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY---------TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTT----TPAT--------ITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFC-----------------------------------FV------GPNRVMCV------------VPMCNTAT-CRTTVEGYSYAGTQAISKSGLPCLLWTN---ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS-----LTTTETCNISYCT-------------PQCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNIN-FRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVC 1641
            +D +N  +  +  PD S + A N CRNP  DT   WCY+  G+  +       C GI      C    TG+ Y G +S +     C  WSS   IY          +A  P +   N      NP++    PWC     +   G     T   +    P  +      C++   G  Y G  + +     C  W +    Y      P+  +T + A   NYCRNPN  P G WC  +T + E C +P C       +P +        IT + C    +      +    +K    T  + ++   F+    PD +   A +YCRN P +++ GP+C                                   FV      GP   + +             P  N A+ C T  +G  YAGT ++++  +PC  W +   +S       +FPD S   AKNYCR+P    +  GP+CY S      +T + CN+ YCT               C  S + T+YAG ++ + SG  C+ WT    ++ +  PQ+ NAA +  A+NYCRNPD    GPWCY+++  +  C +P+C
Sbjct:  427 TDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSS---IYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWC-----VTNVG----GTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAA-TWPVSGETISAAN--NYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSGCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRN-PDNDITGPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQ--NKWGPWCYKSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYLPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMC 1001          

HSP 6 Score: 146.747 bits (369), Expect = 1.864e-31
Identity = 151/538 (28.07%), Postives = 223/538 (41.45%), Query Frame = 1
Query:  919 TTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-------VGPNRVMC-VVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVD-GPFCYTSLTTTET---CNISYCTP----QCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYT-QNNAWAYTGNINVTKNGVSCLKW-------------SDYPPALFDASIS-PSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWC--------YYSEP---------QVNGSTLSFFGYCNVTI-------------CTSCYTFENVSR-----------------YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQT 2289
            T  AG  Y G ISTT  G TC  W+   N  + DS+FPDGS A A N CRN P ++   P+C+       V  N   C  +P+C + TCR TV G  Y G  + S SG PCL W++I   +  P +  D +I  +  +N     SN  S++  P+C T++  T T   C+I +C+      CR  +  T Y G  + + +G  C+ W     +       ++   +  A NYCRNP++ P+G WC + +     C +PVC P  GC + Q++++ Y   I  +     C +W             S   P    A IS P F   ++PD +   A +YCR P N       PWC        Y + P         +++   L F     V +                 Y+  N+++                 Y G  + T    PC  W      S   +S P   S   PD +   A NYCR P ++      PWCY S  +     TG  + +C +  C     + P  +  T
Sbjct:  403 TNRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRN-PGADTDRPWCYIVAGSCGVAANYDFCDGIPVC-SKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPVSGETISAANNYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYS----GCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDIT---GPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSW-----VSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKW---GPWCYKSNYN----GTGSTWDYCNVPYCTGVTTVAPTASAST 919          

HSP 7 Score: 146.747 bits (369), Expect = 2.064e-31
Identity = 102/315 (32.38%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  127 YSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGT--------------------HFLK---------KYCKTPCSGIW---------------------ACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY----TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNAT---CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATI 900
            Y+++   PT  +++ I  P+FHP ++PD +L  A++YCRNPDND  G WC    GT                     FLK         K+   P   I                       C+ D  G YY G VSVT  N  C  W SK  +     T+  FP+ S   A NYCR P  N  GPWC+ +S+ N  G                     +A+   C  +TSG EYAGT++ + +   C PWT+ T  +  Y   P +F  ATM+  +NYCRNP+   +GPWCY     +E C IP C       I
Sbjct:  700 YNSKVVPPT--SSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCY-KSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYL--PQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCLVILTGII 1009          

HSP 8 Score: 93.9745 bits (232), Expect = 2.486e-15
Identity = 101/379 (26.65%), Postives = 160/379 (42.22%), Query Frame = 1
Query: 1105 FVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTET--CN-ISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCS--PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC---TSCYTF-ENVSRYNGFANTTSNG------------TPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWC 2175
            FV P R      +C    C     G +Y GTQ ++KS   C+ W+ ++  +     FP++S+  A NYCR+P    S    +CYT+ T+ E   C  +  C   CR ++   +Y G  N+  +G  C+ W     I   +   L    L DA  YCRN   +         S ++  C +P CS     GC +      Y G ++++ +G SCL W+     ++ A+  P      +   +   A++ CR P N +      WC+ S  Q        +  C V +C   TSC +  ++  RY    N T +G                 ++ +   S + L+ P +  + LPD +  AA +YCR P  D      PWC
Sbjct: 1497 FVLPRRPGPYKAICCAVGCLINRAGLNYVGTQVVTKSLKTCVSWS-LTPFATSDALFPEKSVALANNYCRNPG--YSKSAIWCYTNATSLEFDYCETVPICQTTCRQTEAGQEYNGATNKDRNGTSCLSWASVNLIG--SEYFLYDRSLSDANAYCRNVPPN--------VSVMRSSCSIPFCSQLSVSGCRSDKLGLLYRGTVSISVSGRSCLLWNS--TGVYTAANWP------VSGETIEAAESSCRNPNNSTV---GLWCFVSATQ--------WEPCMVQVCEPKTSCPSATQDYYRYR--LNQTKSGCQSWSSAYSASAASWYSFTQLPPGSSAVLNPPLFHPAHLPDASWTAAASYCRNPDDD---PTGPWC 1838          

HSP 9 Score: 89.3521 bits (220), Expect = 5.850e-14
Identity = 96/368 (26.09%), Postives = 147/368 (39.95%), Query Frame = 1
Query:  214 SLSDASNYCRNPDNDTVGGWCYVTNGTHFL---------KKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GS-------IYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWC-----YTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT---NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATC----RTTVEGY-SYAGTQAISKSGL 1221
            ++  A + CRNP+N TVG WC+V+  T +          K  C +     +    ++T S  Q   S    +       ++   GS       ++  A+ P+ S   A +YCRNP ++  GPWC   S    +                 +      TC+ST     Y G I++T     C  W     +++  F+    F   ++A   N+CRNPN +P GPWC     +T     ++C                +C  +  G  Y G  STT  G TC  W S     +  +    F   + + A NYCRN P ++  GP+CF     +      CN + C       VEG+ ++ G  AI  S L
Sbjct: 1716 TIEAAESSCRNPNNSTVGLWCFVS-ATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQTKSGCQSWSSAYSASAASWYSFTQLPPGSSAVLNPPLFHPAHLPDASWTAAASYCRNPDDDPTGPWCPSPSGGKLY----------------CSDPCNTVTCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHT-FDTTGDFPDLSLAAAENFCRNPNGNPFGPWCIKAGNFTDGDFWDFC----------------DCIDSSYGFTYAGRRSTTGNGRTCQRWDSQHPHPHPYYLPQMFNSLTISQAENYCRN-PNNDTNGPWCFTTDPNIR--FEYCNISLCSPQYSAGVEGFLAFFGVFAIHSSSL 2046          
BLAST of Plasminogen vs. TrEMBL
Match: A0A1I8H5D3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 2.058e-49
Identity = 186/612 (30.39%), Postives = 259/612 (42.32%), Query Frame = 1
Query:  631 CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YC-TIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLP-RSNLP-----GPFCFVGPN-----RVMCVVPMCN---TATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGI-VNRTNSG---------------VCMFWTDPRNINFRNPQLLNAAKLEDA-----ANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC---------TSCYTFENVSR-----YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQTFFMAILM 2310
            C    +G+ Y GT  +T +   C  W+       P+     LF   ++A   NYCRNP    S  WCYT   + E  YC T+P C TT         CR T  G EY G  +    G +C  W+SV N   ++    D S ++A  YCRN+P    +P      P+CFV  N     R  C +P C+    + CRT   G  Y GT +IS SG  C LW +  V +        ++I AA + CR+P+N  S  G +C+ S T  E C +  C P+        DY    +N+T SG                      P +    NP L + A L DA     A+YCRNPD DP GPWC   S  K+YC  P  + T  C + +    Y G I+VT+ G +C KW    P       +  F     PD S   A+N+CR P         PWC  +    +G    F+ +C+V  C         +S   FE +       Y G  +TT NG  C  W + +         P Y+  +    T+  A NYCR P  D    N PWC+ +  ++        F +C I+ C +      +  F  FF   ++
Sbjct: 1015 CLINRAGLNYIGTQVVTKSLKTCISWS-----LTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFDYCETVPICQTT---------CRQTETGQEYNGATNKDRNGTSCLSWASV-NLIGSEYFLYDRSLSDANAYCRNVPPNVTVPYQLNSEPWCFVTFNASSVMRSSCSIPFCSQLSVSGCRTDKLGLLYRGTVSISVSGRSCQLWNSTGVYTATNWPVSGETIEAAGSSCRNPNN--STVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQTKSGCQSWSSAYSASATSWYSFTQLPPGSSAVLNPPLFHPAHLPDASLTAAASYCRNPDDDPTGPWCPSPSGGKLYCSDPCNTVT--CKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDF-----PDLSLAAAENFCRNPNGNPF---GPWCIKAGNFTDGD---FWDFCDVPACAGVTLPGPFSSKNIFECIDSSYGFTYAGRRSTTGNGRTCQRWDSQH-----PHPHPYYLPQMFNSLTISQAENYCRNPNND---TNGPWCFTTDPNI-------RFEYCNISLC-SPQYSAGVEGFLAFFGVFVI 1580          

HSP 2 Score: 183.726 bits (465), Expect = 7.781e-43
Identity = 161/595 (27.06%), Postives = 251/595 (42.18%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRN-------PNADPSGPWCYTT----TGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFP-DGSAANAV-NYCRNLPRSNLPGPFCFVGPNRVM-CVVPMCNTATC--RTTVEGYSYAGTQAISKSG--------------------LPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWC-----YLESQVKIYCQLPVCSPTQ-----------GCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYT 1962
            CL +R G  Y G   VT+  +TC  WS      ++A FPE S+A ANNYCRNP  +    WC+  +   +F +C                     TC+ T +G EY G      N   C  W +     + YF         ++++   YCRN       P    S PWC+ T    +  +  C+IP C     + ++ + CRT   G  Y GT+S +  G +C LW+S   G +  +++P  G    A  + CRN P ++  G +CFV   +   C+V +C   T     T + Y Y   Q  +KSG                    LP      ++     P + PD S+ AA +YCR+P +     GP+C +       C+    T  C+++    +Y G+++ T  G  C  W    P    F          L  A N+CRNP+ +P GPWC     + +     +C +P C+               C   +  + Y G  + T NG +C +W    P        P ++ Q+    + + A+NYCR P N    +  PWC+ ++P +       F YCN+++C+  Y+
Sbjct: 1015 CLINRAGLNYIGTQVVTKSLKTCISWSLTPFATSDALFPEKSVALANNYCRNPGYSKSAIWCYTNATSLEFDYCETVPIC-------------QTTCRQTETGQEYNGATNKDRNGTSCLSWASVNLIGSEYF-----LYDRSLSDANAYCRNVPPNVTVPYQLNSEPWCFVTFNASSVMRSSCSIPFC-----SQLSVSGCRTDKLGLLYRGTVSISVSGRSCQLWNST--GVYTATNWPVSGETIEAAGSSCRN-PNNSTVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQ--TKSGCQSWSSAYSASATSWYSFTQLPPGSSAVLNPPLFHPAHLPDASLTAAASYCRNPDD--DPTGPWCPSPSGGKLYCSDPCNTVTCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDFPDLSLAAAENFCRNPNGNPFGPWCIKAGNFTDGDFWDFCDVPACAGVTLPGPFSSKNIFECIDSSYGFTYAGRRSTTGNGRTCQRWDSQHP-----HPHPYYLPQMFNSLTISQAENYCRNPNND---TNGPWCFTTDPNIR------FEYCNISLCSPQYS 1565          

HSP 3 Score: 171.785 bits (434), Expect = 3.667e-39
Identity = 187/659 (28.38%), Postives = 272/659 (41.27%), Query Frame = 1
Query:  352 DRTGSYYQGIVSVTEKNETCAIWSSK-GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXF-YNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG----SAANAVNYCRNLPRSNLPGPFCFVG-PNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTN----------------------ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC-NISYCTPQ-CRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKW-SDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS--------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYV 2181
            +R G +Y+G +S T    TC  W+    + Y ++ FP+ S A A N CRNP  +T  PWC++ +                           + TC+ T +G EY G I+ +T+ +PC  W++     Y P F        +    +A    NP++    PWC T  G       C+IP C    P       CRT   GT Y G  ST+  G TC  W S   G +  +++P      SAAN  NYCRN P ++  G +C V   +   CVVP+C       + +  SY     I+ SG  C  W++                      IS     P   PD ++ AA +YCR+P N   + GP+C T   T + C N  Y T + CR  + + ++   + R    +  F T P          +N  K+  A+N  +                       P  +    C T      Y G ++VT+  V C  W S +P +       P   S   PD S   A+NYCRTP +Q+ +   PWCY S     GST   + YCNV  CT               C    + + Y G  +T+++G  C+ W++   T+L       Y+  +    T+ AA+NYCR P    G    PWCYV
Sbjct:    2 NRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAG---------SCGVAANYDFCDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPG-----GCRTDRLGTSYRGNQSTSVTGKTCIRWDSAP-GVYTAATWPVSGETISAAN--NYCRN-PNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSG--CARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDN--DITGPWCPTVAGTKQYCANPCYLTGKLCR--KISNEFLKFLRREFVFL-KFHTGPMEF-----IQINLIKIYSASNLTK-----------------------PSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVS------HPYSTSGWFPDGSAELAKNYCRTP-DQNKW--GPWCYKSNYNGTGST---WDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTS--NTALHTY----YLPQMFNAATMSAASNYCRNPD---GSTTGPWCYV 586          

HSP 4 Score: 154.066 bits (388), Expect = 8.944e-34
Identity = 154/566 (27.21%), Postives = 244/566 (43.11%), Query Frame = 1
Query:   88 LQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRN-------PTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKC--FTTTPATIT---RNNCRTTVAGTEYTGTISTTAKGDTCTLW------SSVTNGN-FNDSSFPDGSAANAVNYCRNLPRSNLPGPFC-FVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNI---SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFC-----YTSLTTTETCNISYCTP-------------QCRNSQTATDYAGIVNRTNSG-VCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSP 1647
            L++C+ W+  P              TSD        AL P+ S++ A+NYCRNP       WCY TN T     YC+T       C    TG  Y G  +      +C  W+S   I +     + S+++AN YCRN       P      PWC++      F   ++     + P     + +G   C++   G+ Y GT++I+ +   C  W +T  +     N P+     T+    + CRNPN    G WC+ +    E C +  C   T+ P+      R     T +G +   +  + +     +        S+V N   F+ +  PD S   A +YCRN P  +  GP+C      ++ C  P CNT TC++T +  +Y G  ++++ G  C  W        T      FPD S+ AA+N+CR+P+   +  GP+C     +T     + C++  C               +C +S     YAG  + T +G  C  W    P    +  PQ+ N+  +  A NYCRNP++D  GPWC+  +  ++  YC + +CSP
Sbjct: 1034 LKTCISWSLTPF------------ATSD--------ALFPEKSVALANNYCRNPGYSKSAIWCY-TNATSLEFDYCETVPICQTTCRQTETGQEYNGATNKDRNGTSCLSWASVNLIGSEYFLYDRSLSDANAYCRNVPPNVTVPYQLNSEPWCFV-----TFNASSVMRSSCSIPFCSQLSVSG---CRTDKLGLLYRGTVSISVSGRSCQLWNSTGVYTAT--NWPV--SGETIEAAGSSCRNPNNSTVGLWCFVSATQWEPCMVQVCEPKTSCPSATQDYYRYRLNQTKSGCQSWSSAYSASATSWYSFTQLPPGSSAVLNPPLFHPAHLPDASLTAAASYCRN-PDDDPTGPWCPSPSGGKLYCSDP-CNTVTCKSTHKTQNYIGVISVTRRGTTCQKWLARFPWFHTFDTTGDFPDLSLAAAENFCRNPNG--NPFGPWCIKAGNFTDGDFWDFCDVPACAGVTLPGPFSSKNIFECIDSSYGFTYAGRRSTTGNGRTCQRWDSQHPHPHPYYLPQMFNSLTISQAENYCRNPNNDTNGPWCFTTDPNIRFEYCNISLCSP 1562          

HSP 5 Score: 150.984 bits (380), Expect = 7.427e-33
Identity = 159/594 (26.77%), Postives = 240/594 (40.40%), Query Frame = 1
Query:  166 SDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGI----WACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY---------TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTT----TPAT--------ITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFC-----------------------------------FV------GPNRVMCV------------VPMCNTAT-CRTTVEGYSYAGTQAISKSGLPCLLWTN---ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS-----LTTTETCNISYCT-------------PQCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNIN-FRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVC 1641
            +D +N  +  +  PD S + A N CRNP  DT   WCY+  G+  +       C GI      C    TG+ Y G +S +     C  WSS   IY          +A  P +   N      NP++    PWC     +   G     T   +    P  +      C++   G  Y G  + +     C  W +    Y      P+  +T + A   NYCRNPN  P G WC  +T + E C +P C       +P +        IT + C    +      +    +K    T  + ++   F+    PD +   A +YCRN P +++ GP+C                                   FV      GP   + +             P  N A+ C T  +G  YAGT ++++  +PC  W +   +S       +FPD S   AKNYCR+P    +  GP+CY S      +T + CN+ YCT               C  S + T+YAG ++ + SG  C+ WT    ++ +  PQ+ NAA +  A+NYCRNPD    GPWCY+++  +  C +P+C
Sbjct:   25 TDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSS---IYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWC-----VTNVG----GTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAA-TWPVSGETISAAN--NYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSGCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRN-PDNDITGPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQ--NKWGPWCYKSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYLPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMC 599          

HSP 6 Score: 147.132 bits (370), Expect = 1.206e-31
Identity = 150/532 (28.20%), Postives = 221/532 (41.54%), Query Frame = 1
Query:  919 TTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-------VGPNRVMC-VVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVD-GPFCYTSLTTTET---CNISYCTP----QCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYT-QNNAWAYTGNINVTKNGVSCLKW-------------SDYPPALFDASIS-PSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWC--------YYSEP---------QVNGSTLSFFGYCNVTI-------------CTSCYTFENVSR-----------------YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINP 2271
            T  AG  Y G ISTT  G TC  W+   N  + DS+FPDGS A A N CRN P ++   P+C+       V  N   C  +P+C + TCR TV G  Y G  + S SG PCL W++I   +  P +  D +I  +  +N     SN  S++  P+C T++  T T   C+I +C+      CR  +  T Y G  + + +G  C+ W     +       ++   +  A NYCRNP++ P+G WC + +     C +PVC P  GC + Q++++ Y   I  +     C +W             S   P    A IS P F   ++PD +   A +YCR P N       PWC        Y + P         +++   L F     V +                 Y+  N+++                 Y G  + T    PC  W      S   +S P   S   PD +   A NYCR P ++      PWCY S  +     TG  + +C +  C     + P
Sbjct:    1 TNRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRN-PGADTDRPWCYIVAGSCGVAANYDFCDGIPVC-SKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPVSGETISAANNYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYS----GCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDIT---GPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSW-----VSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKW---GPWCYKSNYN----GTGSTWDYCNVPYCTGVTTVAP 511          

HSP 7 Score: 146.747 bits (369), Expect = 1.813e-31
Identity = 102/315 (32.38%), Postives = 137/315 (43.49%), Query Frame = 1
Query:  127 YSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGT--------------------HFLK---------KYCKTPCSGIW---------------------ACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY----TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNAT---CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATI 900
            Y+++   PT  +++ I  P+FHP ++PD +L  A++YCRNPDND  G WC    GT                     FLK         K+   P   I                       C+ D  G YY G VSVT  N  C  W SK  +     T+  FP+ S   A NYCR P  N  GPWC+ +S+ N  G                     +A+   C  +TSG EYAGT++ + +   C PWT+ T  +  Y   P +F  ATM+  +NYCRNP+   +GPWCY     +E C IP C       I
Sbjct:  298 YNSKVVPPT--SSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANPCYLTGKLCRKISNEFLKFLRREFVFLKFHTGPMEFIQINLIKIYSASNLTKPSLNRASVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCY-KSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYL--PQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCLVILTGII 607          
BLAST of Plasminogen vs. TrEMBL
Match: C3Y3G8 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_90679 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.498e-46
Identity = 222/782 (28.39%), Postives = 317/782 (40.54%), Query Frame = 1
Query:   25 TGCVNGVTNYLFKSQTATEQYLQSCVPW-ANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTN-GTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQS---TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKC-------FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQTATD---------------YAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC----------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVS 2184
            T CV G       +Q+ TE  L +C  W +  P ++S  S                     P+A L    NYCRNPD +    WCY T+ G  +  +YC  P C G   C +   G  Y+G   VT     C  W S+ + + + N P +       N+YCRNP +  G PWC+      ++ +                   G   C +      G +Y GT+A+T++   C  W + +   + +   P  +  A +    NYCRNP+ D S PWCYT   N   EYC +  C         +   T+   +C    AG  Y GT+S T  G TC  W S T    N+  S +PD  A    NYCRN      P  +CF     V    C +P C   +      G SY G++ ++ SG  C  W + +    S  P+ FP  S    +N+CR+P        P+CYT    T  E C ++ C      +    D               Y G V++T SG+ C  W          P     A L+   N+CRNPD +P+  WCY  +S V+  YC +P C P + CY+ N A  Y G++N+T++GV+C +W    P    +    +F S  L        +N+CR P  ++     PWCY  +P         +  C +  C                T CY F N   Y G    T +G  C  W +      +           +PD    A   NNYCR P +  G    PWCY +
Sbjct:   35 TSCVYGSGESYRGTQSTTESGL-TCQAWDSQTPHEHSRNSTN------------------YPNAGLE--GNYCRNPDGEPRT-WCYTTDPGVRW--QYCSIPSCYGQDNC-YTGNGQDYRGNAMVTASGRRCQRWDSQ-APHPHGNTPASKPDAGLQNDYCRNP-DGEGQPWCYTMDPGQRWEY------------------CGLPVCANECYVPDGADYRGTVAVTSSGRRCQAWNSQSP--HQHDRTPQNYPQAGLTN--NYCRNPDDDTS-PWCYTIDPNVRVEYCPLDLCTGWTGDYILSGDFTVQTTHC-AIGAGASYRGTLSRTESGLTCQRWDSQTPQQHNYQPSRYPD--AGLDENYCRNP--DGEPRTWCFTTDPNVYWEYCNIPSCFDESECYNGNGESYRGSRNVTSSGRACQRWDSQTPHPHSRTPDNFP--SAGLDENFCRNPDGEAE---PWCYTQDPNTRWERCALNPCDDTAGGAILGPDGIVYSTNCAFGDGSTYRGTVSQTQSGIPCQRWDSQSPHQHNYPSTYPDAGLD--WNFCRNPDGEPMT-WCYTTDSNVRWQYCNVPSCFPNE-CYSGNGA-DYRGSVNITRSGVACQRWDSQTPHPH-SRTPDNFPSAGL-------DENFCRNPDGEA----EPWCYTQDPNTR------WDVCVIESCDPSATPPPSAQYQLFPTDCY-FGNGETYRGQQARTKSGISCQSWDSQTPHQHN-----------IPDRYPNAGLENNYCRNPDQHDG---GPWCYTA 718          

HSP 2 Score: 169.474 bits (428), Expect = 1.165e-38
Identity = 209/746 (28.02%), Postives = 305/746 (40.88%), Query Frame = 1
Query:  193 PALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWA--------------CLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTN--ANFPENSIANANNYCRNPTNNTGGP--WCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCF-TTTPATITRNNCRTTVA----GTEYTGTISTTAKGDTCTLWSSVTNGNFN-DSSFPDGSAANAVNYCRNLPRSNLPGPFCFVG-PNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCT--------------PQCRNSQTATDYAGIVNRTNSGV-CMFWT----DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVC------SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCY-VSPSSVLSQTTGQNFGFCTINTC 2247
            P   P A L +  N+CRNPD +    WCY  +     ++    PC                   C F   GS Y+G VS T+    C  W S+     N  + +P+  +    N+CRNP    G P  WC+      ++ +C +P+C            +GN        G +Y G++ IT +   C  W + T   +P+   P  F +A + E  N+CRNP+ + + PWCYT   N  +  C I  C  + TP    +     T      G  Y G  + T  G +C  W S T    N    +P+    N  NYCRN P  +  GP+C+   PN     C VP C          G  Y G   ++ SG  C  W   +    S  P  +P+  ++   NYCR+P N      P+CYT   T+  E C I+ C                 C     AT Y G V+ T++G+ C  W      P +   R+P     A L+   NYCRNPD +P+ PWCY  ++ V+  YC +P C           CY  +   +Y G +N+T +G +C +W    P     + + ++ S  L        +N+CR P  ++     PWCY  +P V   +       N  +   CY    VS Y G  N TS+G  C  W +         +   +  + L D       NYCR P  D+    +PWCY V P + +         FC +  C
Sbjct:  417 PDNFPSAGLDE--NFCRNPDGE-AEPWCYTQDPNTRWERCALNPCDDTAGGAILGPDGIVYSTNCAFG-DGSTYRGTVSQTQSGIPCQRWDSQSPHQHNYPSTYPDAGLDW--NFCRNPD---GEPMTWCYTTDSNVRWQYCNVPSCFPNECY------SGN--------GADYRGSVNITRSGVACQRWDSQTP--HPHSRTPDNFPSAGLDE--NFCRNPDGE-AEPWCYTQDPNTRWDVCVIESCDPSATPPPSAQYQLFPTDCYFGNGETYRGQQARTKSGISCQSWDSQTPHQHNIPDRYPNAGLEN--NYCRN-PDQHDGGPWCYTANPNTRWEECDVPKCYDDC--YLGNGRDYRGRMDVTSSGRICQRWDTQTPHAHSRTPENYPNSGLI--NNYCRNPDNDTR---PWCYTIDPTSRVEYCPITTCVWTEDVIGLESKVYPKHCYFGDGAT-YRGTVSMTSAGLTCQRWDSQTPHPHDQTVRHPD----AGLD--GNYCRNPDGEPM-PWCYTTDANVRWQYCTVPQCFVFFSNDVVNDCYNGDGT-SYRGTVNITSSGRACQRWDSQTPHPHTRTPT-TYPSAGL-------DENFCRNPDGEA----EPWCYTKDPYVRWESCVIS---NCDVPGECYNDRGVS-YRGKVNVTSSGRACQRWDSQTPHQHLSTTADTFPQAGLQD-------NYCRNPNNDV----KPWCYTVDPLARIE--------FCVVPNC 1080          

HSP 3 Score: 157.918 bits (398), Expect = 3.645e-35
Identity = 184/645 (28.53%), Postives = 272/645 (42.17%), Query Frame = 1
Query:  136 QSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPEN--SIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRVMCVVPMCNTATCRTTV-----------------EGYSYAGTQAISKSGLPCLLWTNISVTSIEPN-YFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT-PQCR-----------NSQTATDYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            QS  P     S   +   +P+  PDA L    N+CRNPD + +  WCY T+ ++   +YC  P      C +   G+ Y+G V++T     C  W S+ + + ++  P+N  S     N+CRNP +    PWC+ Q    ++  C I +C  +   PP        T     +G  Y G  A T +   C  W + T   +   N P  +  A +    NYCRNP+    GPWCYT   N   E C +PKC+         ++C     G +Y G +  T+ G  C  W + T    + +  ++P+    N  NYCRN    N   P+C+ + P      V  C   TC  T                  +G +Y GT +++ +GL C  W + +    +     PD  +    NYCR+P        P+CY   TT       YCT PQC             +   T Y G VN T+SG  C  W +   + + R P    +A L++  N+CRNPD +   PWCY +     +  C +  C     CY      +Y G +NVT +G +C +W    P    ++ + +F    L D       NYCR P N       PWCY  +P      L+   +C V  C
Sbjct:  494 QSGIPCQRWDSQSPHQHNYPSTYPDAGLD--WNFCRNPDGEPMT-WCYTTD-SNVRWQYCNVPSCFPNEC-YSGNGADYRGSVNITRSGVACQRWDSQ-TPHPHSRTPDNFPSAGLDENFCRNP-DGEAEPWCYTQDPNTRWDVCVIESCDPSATPPPSAQYQLFPTDCYFGNGETYRGQQARTKSGISCQSWDSQTPHQH---NIPDRYPNAGLEN--NYCRNPDQHDGGPWCYTANPNTRWEECDVPKCY---------DDCYLG-NGRDYRGRMDVTSSGRICQRWDTQTPHAHSRTPENYPNSGLIN--NYCRNP--DNDTRPWCYTIDP---TSRVEYCPITTCVWTEDVIGLESKVYPKHCYFGDGATYRGTVSMTSAGLTCQRWDSQTPHPHDQTVRHPDAGLDG--NYCRNPDGEPM---PWCY---TTDANVRWQYCTVPQCFVFFSNDVVNDCYNGDGTSYRGTVNITSSGRACQRWDSQTPHPHTRTPTTYPSAGLDE--NFCRNPDGE-AEPWCYTKDPYVRWESCVISNCDVPGECYNDRGV-SYRGKVNVTSSGRACQRWDSQTPHQHLSTTADTFPQAGLQD-------NYCRNPNNDV----KPWCYTVDP------LARIEFCVVPNC 1080          

HSP 4 Score: 127.102 bits (318), Expect = 1.474e-25
Identity = 139/482 (28.84%), Postives = 197/482 (40.87%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSI--EPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFW-TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCSPTQGCYTQNNAW-------------AYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSP--WCYYSEPQVNGSTLSFFGYCNVTIC---TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAA--NNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPT---AAIINP 2271
            +G  Y GT STT  G TC  W S T    + +S    +A    NYCRN      P  +C+    G     C +P C       T  G  Y G   ++ SG  C  W + +       P   PD  +    +YCR+P        P+CYT       E C +  C  +C     A DY G V  T+SG  C  W +   + + R PQ    A L +  NYCRNPD D   PWCY ++  V++ YC L +C+   G Y  +  +             +Y G ++ T++G++C +W    P   +      +     PDA     +NYCR P       G P  WC+ ++P V      ++ YCN+  C   + CY   N   Y G  N TS+G  C  W +             +  S  PDN   A    N+CR P  +     +PWCY       +Q     +  C +N C      AI+ P
Sbjct:   41 SGESYRGTQSTTESGLTCQAWDSQTPHEHSRNSTNYPNAGLEGNYCRNP--DGEPRTWCYTTDPGVRWQYCSIPSCYGQDNCYTGNGQDYRGNAMVTASGRRCQRWDSQAPHPHGNTPASKPDAGL--QNDYCRNPDGEGQ---PWCYTMDPGQRWEYCGLPVCANECYVPDGA-DYRGTVAVTSSGRRCQAWNSQSPHQHDRTPQNYPQAGLTN--NYCRNPDDD-TSPWCYTIDPNVRVEYCPLDLCTGWTGDYILSGDFTVQTTHCAIGAGASYRGTLSRTESGLTCQRWDSQTPQQHN------YQPSRYPDAGLD--ENYCRNP------DGEPRTWCFTTDPNV------YWEYCNIPSCFDESECYN-GNGESYRGSRNVTSSGRACQRWDSQTP----------HPHSRTPDNFPSAGLDENFCRNPDGEA----EPWCY-------TQDPNTRWERCALNPCDDTAGGAILGP 469          
BLAST of Plasminogen vs. TrEMBL
Match: A0A267EUC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018513g1 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 6.005e-46
Identity = 193/624 (30.93%), Postives = 270/624 (43.27%), Query Frame = 1
Query:  631 CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG------NQEYCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNL------PRSNLPGPFCF--VG--PNRVMCVVPMC---NTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNY-FPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTP--QCRNSQTAT-DYAGIVNRTNSGVCMF----------WTDPRNI----------NFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKW-SDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS--------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAII------NPINTFQTFFMAIL 2307
            C++  +G  Y G I+ TT+   C PWT        Y +    F   + A   N CRNP AD   PWCY   G      N ++C  IP C  T         CR TV GTEY G IS +  G  C  WSS+   N+      D +   +V  CRN+      P S    P+C   VG  P    C +P C   N   CRT   G SY G Q+ S +G  C+ W +         +    ++I AA NYCR+P+N  S  G +C  S T  E C +  C P   C + Q+ +  Y  ++  T SG   +          W + + +             +P ++    L+ AA+YCRNPD+D  GPWC   +  K YC  P C  T  C T      Y G ++VT+  V C  W S +P +       P   S   PD S   A+NYCRTP +Q+ +   PWCY S     GST   + YCNV  CT               C    + + Y G  +T+++G  C+ W++   T+L       Y+  +    T+ AA+NYCR P    G    PWCYV        TT +N   C I  C +  ++      +P+    T  + ++
Sbjct:   30 CRTNRAGFFYKGNISTTTSGCTCRPWTDA--INTRYADS--TFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDFCDGIPVCSKT---------CRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSV--CRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPVSGETISAANNYCRNPNN--SPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLI--TYSGCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANP-CYLTV-CMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVS------HPYSTSGWFPDGSAELAKNYCRTP-DQNKW--GPWCYKSNYNGTGST---WDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTS--NTALHTY----YLPQMFNAATMSAASNYCRNPD---GSTTGPWCYV------DATTREN---CNIPMCSSPTVVTAPGTTDPVMVILTGIIGMI 602          

HSP 2 Score: 174.096 bits (440), Expect = 2.542e-40
Identity = 163/587 (27.77%), Postives = 246/587 (41.91%), Query Frame = 1
Query:   31 CVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGI----WACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY---------TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTT----TPAT--------ITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFC-FVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTN---ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS-----LTTTETCNISYC-------------TPQCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNIN-FRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCS 1644
            C      + +K   +T     +C PW                   +D +N  +  +  PD S + A N CRNP  DT   WCY+  G+  +       C GI      C    TG+ Y G +S +     C  WS   SIY          +A  P +   N      NP++    PWC     +   G     T   +    P  +      C++   G  Y G  + +     C  W +    Y      P+  +T + A   NYCRNPN  P G WC  +T + E C +P C       +P +        IT + C    +      +    +K    T  + ++   F+    PD +   A +YCRN P +++ GP+C  V   +  C  P C    C T  +G  YAGT ++++  +PC  W +   +S       +FPD S   AKNYCR+P    +  GP+CY S      +T + CN+ YC             T  C  S + T+YAG ++ + SG  C+ WT    ++ +  PQ+ NAA +  A+NYCRNPD    GPWCY+++  +  C +P+CS
Sbjct:   30 CRTNRAGFFYKGNISTTTSGCTCRPW-------------------TDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAGSCGVAANYDF-CDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWS---SIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWC-----VTNVG----GTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTA-ATWPVSGETISAAN--NYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSGCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRN-PDNDITGPWCPTVAGTKQYCANP-CYLTVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQ--NKWGPWCYKSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYLPQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCS 577          

HSP 3 Score: 173.711 bits (439), Expect = 3.390e-40
Identity = 167/589 (28.35%), Postives = 244/589 (41.43%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSSK-GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXF-YNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ---EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDG----SAANAVNYCRNLPRSNLPGPFCFVG-PNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTN----------------------ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC-NISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLE-----SQVKIYCQLPVC-----------SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            C  +R G +Y+G +S T    TC  W+    + Y ++ FP+ S A A N CRNP  +T  PWC++ +                           + TC+ T +G EY G I+ +T+ +PC  W++     Y P F        +    +A    NP++    PWC T  G       C+IP C    P       CRT   GT Y G  ST+  G TC  W S   G +  +++P      SAAN  NYCRN P ++  G +C V   +   CVVP+C       + +  SY     I+ SG  C  W++                      IS     P   PD ++ AA +YCR+P N   + GP+C T   T + C N  Y T  C        YAG V+ T   V C  W    P +  +           E A NYCR PD +  GPWCY            YC +P C           + T  C    +   Y G ++ + +G +C+ W+       + ++   ++ Q+   A+ + A NYCR P   +     PWCY     V+ +T      CN+ +C+S
Sbjct:   30 CRTNRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRNPGADTDRPWCYIVAG---------SCGVAANYDFCDGIPVCSKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPG-----GCRTDRLGTSYRGNQSTSVTGKTCIRWDSAP-GVYTAATWPVSGETISAAN--NYCRN-PNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYSG--CARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDN--DITGPWCPTVAGTKQYCANPCYLT-VCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCYKSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTS------NTALHTYYLPQMFNAATMSAASNYCRNPDGSTT---GPWCY-----VDATTRE---NCNIPMCSS 578          

HSP 4 Score: 172.17 bits (435), Expect = 9.915e-40
Identity = 154/497 (30.99%), Postives = 221/497 (44.47%), Query Frame = 1
Query:  901 TRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-------VGPNRVMC-VVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVD-GPFCYTSLTTTET---CNISYCTP----QCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYT-QNNAWAYTGNINVTKNGVSCLKW-------------SDYPPALFDASIS-PSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQT 2289
            T  +CRT  AG  Y G ISTT  G TC  W+   N  + DS+FPDGS A A N CRN P ++   P+C+       V  N   C  +P+C + TCR TV G  Y G  + S SG PCL W++I   +  P +  D +I  +  +N     SN  S++  P+C T++  T T   C+I +C+      CR  +  T Y G  + + +G  C+ W     +       ++   +  A NYCRNP++ P+G WC + +     C +PVC P  GC + Q++++ Y   I  +     C +W             S   P    A IS P F   ++PD +   A +YCR P N       PWC    P V G+       C +T+   C T      Y G  + T    PC  W      S   +S P   S   PD +   A NYCR P ++      PWCY S  +     TG  + +C +  C     + P  +  T
Sbjct:   26 TAQDCRTNRAGFFYKGNISTTTSGCTCRPWTDAINTRYADSTFPDGSKAAAGNKCRN-PGADTDRPWCYIVAGSCGVAANYDFCDGIPVC-SKTCRETVTGTEYNGAISQSTSGSPCLSWSSIYPANYTPLFTADATIPGSVCRNIAVDVSNPSSINFVPWCVTNVGGTPTPSNCSIPFCSQVNPGGCRTDRLGTSYRGNQSTSVTGKTCIRWDSAPGVYTAATWPVSGETISAANNYCRNPNNSPVGLWCLVSTTDWEPCVVPVCVPINGCPSPQSDSYRYKDLITYS----GCARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDIT---GPWC----PTVAGTKQYCANPCYLTV---CMTDTQGLYYAGTVSVTRLNVPCQSW-----VSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKW---GPWCYKSNYN----GTGSTWDYCNVPYCTGVTTVAPTASAST 494          

HSP 5 Score: 169.474 bits (428), Expect = 6.238e-39
Identity = 102/264 (38.64%), Postives = 139/264 (52.65%), Query Frame = 1
Query:  127 YSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIY----TNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNAT---CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPAT 897
            Y+++   PT  +++ I  P+FHP ++PD +L  A++YCRNPDND  G WC    GT   K+YC  PC  +  C+ D  G YY G VSVT  N  C  W SK  +     T+  FP+ S   A NYCR P  N  GPWC+ +S+ N  G                     +A+   C  +TSG EYAGT++ + +   C PWT+ T  +  Y   P +F  ATM+  +NYCRNP+   +GPWCY     +E C IP C + T  T
Sbjct:  329 YNSKVVPPT--SSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGT---KQYCANPCY-LTVCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPYSTSGWFPDGSAELAKNYCRTPDQNKWGPWCY-KSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYL--PQMFNAATMSAASNYCRNPDGSTTGPWCYVDATTRENCNIPMCSSPTVVT 583          

HSP 6 Score: 127.487 bits (319), Expect = 8.201e-26
Identity = 107/355 (30.14%), Postives = 163/355 (45.92%), Query Frame = 1
Query:  214 SLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSY-YQGIVSVTEKNETCAIWSSKGS-----------------------IYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ-----EYCTIPKCFTTT----PATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVMCVVPMCNTATCRT 1167
            ++S A+NYCRNP+N  VG WC V+       + C  P C  I  C   ++ SY Y+ +++ +     CA WSS  S                       ++     P+ ++  A +YCRNP N+  GPWC   +   ++                         C + T G+ YAGT+++T  + PC  W +     +PY +    F   +     NYCR P+ +  GPWCY +  N      +YC +P C   T     A+ + +NC  + +GTEY GT+ST+A G TC  W+S T  +  +    F   + + A NYCRN P  +  GP+C+V    R  C +PMC++ T  T
Sbjct:  254 TISAANNYCRNPNNSPVGLWCLVSTTDW---EPCVVPVCVPINGCPSPQSDSYRYKDLITYSG----CARWSSVYSSRSSDWYNSKVVPPTSSAIISQPLFHPGVMPDLTLDAAADYCRNPDNDITGPWCPTVAGTKQYCANPCYLT----------------VCMTDTQGLYYAGTVSVTRLNVPCQSWVSKFPVSHPY-STSGWFPDGSAELAKNYCRTPDQNKWGPWCYKSNYNGTGSTWDYCNVPYCTGVTTVAPTASASTDNCLKSTSGTEYAGTMSTSASGKTCIPWTSNTALHTYYLPQMFNAATMSAASNYCRN-PDGSTTGPWCYVDATTRENCNIPMCSSPTVVT 583          
BLAST of Plasminogen vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 126.716 bits (317), Expect = 4.401e-29
Identity = 146/498 (29.32%), Postives = 207/498 (41.57%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRP-ILFKTATMAEV-ANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQ------------TATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQL-----------------PVCSPT----------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            G +Y GT + T +   C  W +T      + ++P I  ++   A++ +N+CRNP+ D  GPWCYTT   + +  C I  C      T    +C    +G  Y G ISTT  G TC  W S    N  +  S FP+       NYCRN      P P+CF          C V  C +          C TT +G +Y GT ++++SG  C  W +      S  P+ +P + +   +NYCR+P N      P+CYT+   T  E CN+  C  + R  +              + Y G++  T SG  C  W   +P + + + PQ    A L    N CRNPD D   PWCY  +  V+  YC++                 PV  PT            C T +   +Y G+++ T  GV+C  WS   P L       SF  Q  PD       N CR P         PWCY ++P         + YC +  C
Sbjct:  116 GTDYRGTKSKTKSGTLCQRWEST------FPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDC------TEECMHC----SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNP--DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNC-TTGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGL--DQNYCRNPDNERK---PWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYEDNGSSYRGVMTETISGKKCQAWASMEPHS-HVKTPQNFPTADLR--RNLCRNPDGD-RAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGI-SYRGSVSKTVAGVTCQAWSASTPHL------SSFTPQAHPDKGLD--SNKCRNPDGD---VNGPWCYTTDPNKK------WDYCQIPEC 565          

HSP 2 Score: 121.324 bits (303), Expect = 1.639e-27
Identity = 118/396 (29.80%), Postives = 166/396 (41.92%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCS-------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDA--QNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC--------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDN--TVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            G  Y GT++ +KSG  C  W +      +I P   P   + +  N+CR+P       GP+CYT+      E C+I  CT +C +  +  +Y G ++ T SG+ C  W    P N  +  P +     LE+  NYCRNPD +P  PWC+ ES  K   +C +  C+       P   C T +    Y G ++VT++G +C  W         AS  P   S+  PD        QNYCR P N+      PWCY ++P+        + YCNV  C                CY  +N S Y G    T +G  C  W++M   S  K           P N  T     N CR P  D      PWCY +  SV        + +C I  C +  +
Sbjct:  116 GTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLES--NFCRNPDG--DKGGPWCYTTDPAKRWENCDIQDCTEECMHC-SGENYRGKISTTESGLTCQRWDSQKPHNHGYM-PSVFPEKYLEE--NYCRNPDGEP-KPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGN-TYRGTVSVTESGKTCQSW---------ASQLPHKHSRT-PDNYPCKGLDQNYCRNPDNER----KPWCYTTDPETR------WEYCNVESCGNEPRPDEPVIAPNEDCYE-DNGSSYRGVMTETISGKKCQAWASMEPHSHVK----------TPQNFPTADLRRNLCRNPDGD----RAPWCYTTDPSV-------RWEYCRIERCGSTTV 459          

HSP 3 Score: 110.153 bits (274), Expect = 4.907e-24
Identity = 121/439 (27.56%), Postives = 185/439 (42.14%), Query Frame = 1
Query:  178 NPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTT----TPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTAT----------------------------CRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS 1362
             P   P   P A L   SN+CRNPD D  G WCY T+     +      C+    C+   +G  Y+G +S TE   TC  W S+      Y  + FPE  +    NYCRNP +    PWC+ +S   ++ FC++  C   PP              +T  G  Y GT+++T +   C  W   +   + +   P  +    + +  NYCRNP+ +   PWCYTT      EYC +  C        P      +C     G+ Y G ++ T  G  C  W+S+   +   +  +FP  +A    N CRN P  +   P+C+     V    C +  C + T                            C+T   G SY G+ + + +G+ C  W+  +  ++S  P   PD+ + +  N CR+P     V+GP+CYT+
Sbjct:  142 KPNITPRSHPKADLE--SNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTE--ECMH-CSGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYL--EENYCRNP-DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNC------TTGDGNTYRGTVSVTESGKTCQSW--ASQLPHKHSRTPDNYPCKGLDQ--NYCRNPDNE-RKPWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYED-NGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFP--TADLRRNLCRN-PDGDR-APWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTG-SGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDS--NKCRNPDG--DVNGPWCYTT 551          

HSP 4 Score: 107.842 bits (268), Expect = 2.829e-23
Identity = 137/501 (27.35%), Postives = 198/501 (39.52%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVT--SIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCT-------PQCR-NSQTATDYAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL---ESQVKIYCQL-----------PVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTD-AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS------------------------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            GT+Y GT S T  G  C  W S      N +      A    N+CRN P  +  GP+C+   P +    C +  C T  C     G +Y G  + ++SGL C  W +         P+ FP++ +   +NYCR+P        P+C+T       E C++S CT       PQ    +     Y G V+ T SG  C  W     + + R P       L+   NYCRNPD++   PWCY    E++ + YC +           PV +P + CY ++N  +Y G +  T +G  C  W         AS+ P    +   +  T D  +N CR P    A    PWCY ++P V       + YC +  C S                              C T   +S Y G  + T  G  C  WS     S   LS  ++     PD  +   +N CR P  D+   N PWCY +  +       + + +C I  C
Sbjct:  116 GTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLESNFCRN-PDGDKGGPWCYTTDPAKRWENCDIQDC-TEEC-MHCSGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYL--EENYCRNPDGEPK---PWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGLDQ--NYCRNPDNE-RKPWCYTTDPETRWE-YCNVESCGNEPRPDEPVIAPNEDCY-EDNGSSYRGVMTETISGKKCQAW---------ASMEPHSHVKTPQNFPTADLRRNLCRNPDGDRA----PWCYTTDPSVR------WEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGIS-YRGSVSKTVAGVTCQAWSA----STPHLS--SFTPQAHPDKGL--DSNKCRNPDGDV---NGPWCYTTDPN-------KKWDYCQIPEC 565          

HSP 5 Score: 73.9442 bits (180), Expect = 8.488e-13
Identity = 71/250 (28.40%), Postives = 105/250 (42.00%), Query Frame = 1
Query:  232 NYCRNPDNDTVGGWCYVTNGTHFLKKYC-----------KTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWC--------WLQSDLNKFGFXXXXXX-------XXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTT 888
            NYCRNPDN+    WCY T+      +YC             P        ++  GS Y+G+++ T   + C  W+S      + T  NFP   +    N CRNP  +   PWC        W    + + G  T+             P L   +  +  A C+ T SG+ Y G+++ T     C  W+ +     P+ +             +N CRNP+ D +GPWCYTT  N+  +YC IP+C   T
Sbjct:  330 NYCRNPDNER-KPWCYTTD-PETRWEYCNVESCGNEPRPDEPVIAPNEDCYEDNGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRR--NLCRNPDGDRA-PWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCK-TGSGISYRGSVSKTVAGVTCQAWSAS----TPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECALDT 569          
BLAST of Plasminogen vs. Ensembl Cavefish
Match: ENSAMXT00000018419.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 126.331 bits (316), Expect = 5.115e-29
Identity = 146/498 (29.32%), Postives = 207/498 (41.57%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRP-ILFKTATMAEV-ANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCNT--------ATCRTTVEGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNSQ------------TATDYAGIVNRTNSGV-CMFWT--DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQL-----------------PVCSPT----------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            G +Y GT + T +   C  W +T      + ++P I  ++   A++ +N+CRNP+ D  GPWCYTT   + +  C I  C      T    +C    +G  Y G ISTT  G TC  W S    N  +  S FP+       NYCRN      P P+CF          C V  C +          C TT +G +Y GT ++++SG  C  W +      S  P+ +P + +   +NYCR+P N      P+CYT+   T  E CN+  C  + R  +              + Y G++  T SG  C  W   +P + + + PQ    A L    N CRNPD D   PWCY  +  V+  YC++                 PV  PT            C T +   +Y G+++ T  GV+C  WS   P L       SF  Q  PD       N CR P         PWCY ++P         + YC +  C
Sbjct:  105 GTDYRGTKSKTKSGTLCQRWEST------FPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDC------TEECMHC----SGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEE--NYCRNP--DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNC-TTGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGL--DQNYCRNPDNERK---PWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYEDNGSSYRGVMTETISGKKCQAWASMEPHS-HVKTPQNFPTADLR--RNLCRNPDGD-RAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGI-SYRGSVSKTVAGVTCQAWSASTPHLS------SFTPQAHPDKGLD--SNKCRNPDGD---VNGPWCYTTDPNKK------WDYCQIPEC 554          

HSP 2 Score: 121.324 bits (303), Expect = 1.963e-27
Identity = 118/396 (29.80%), Postives = 166/396 (41.92%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCS-------PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDA--QNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC--------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDN--TVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            G  Y GT++ +KSG  C  W +      +I P   P   + +  N+CR+P       GP+CYT+      E C+I  CT +C +  +  +Y G ++ T SG+ C  W    P N  +  P +     LE+  NYCRNPD +P  PWC+ ES  K   +C +  C+       P   C T +    Y G ++VT++G +C  W         AS  P   S+  PD        QNYCR P N+      PWCY ++P+        + YCNV  C                CY  +N S Y G    T +G  C  W++M   S  K           P N  T     N CR P  D      PWCY +  SV        + +C I  C +  +
Sbjct:  105 GTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLES--NFCRNPDG--DKGGPWCYTTDPAKRWENCDIQDCTEECMHC-SGENYRGKISTTESGLTCQRWDSQKPHNHGYM-PSVFPEKYLEE--NYCRNPDGEP-KPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGN-TYRGTVSVTESGKTCQSW---------ASQLPHKHSRT-PDNYPCKGLDQNYCRNPDNER----KPWCYTTDPETR------WEYCNVESCGNEPRPDEPVIAPNEDCYE-DNGSSYRGVMTETISGKKCQAWASMEPHSHVK----------TPQNFPTADLRRNLCRNPDGD----RAPWCYTTDPSV-------RWEYCRIERCGSTTV 448          

HSP 3 Score: 110.538 bits (275), Expect = 4.575e-24
Identity = 121/439 (27.56%), Postives = 185/439 (42.14%), Query Frame = 1
Query:  178 NPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTT----TPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS--SFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT----------------------------ATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS 1362
             P   P   P A L   SN+CRNPD D  G WCY T+     +      C+    C+   +G  Y+G +S TE   TC  W S+      Y  + FPE  +    NYCRNP +    PWC+ +S   ++ FC++  C   PP              +T  G  Y GT+++T +   C  W   +   + +   P  +    + +  NYCRNP+ +   PWCYTT      EYC +  C        P      +C     G+ Y G ++ T  G  C  W+S+   +   +  +FP  +A    N CRN P  +   P+C+     V    C +  C +                            A C+T   G SY G+ + + +G+ C  W+  +  ++S  P   PD+ + +  N CR+P     V+GP+CYT+
Sbjct:  131 KPNITPRSHPKADLE--SNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTE--ECMH-CSGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYL--EENYCRNP-DGEPKPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNC------TTGDGNTYRGTVSVTESGKTCQSW--ASQLPHKHSRTPDNYPCKGLDQ--NYCRNPDNE-RKPWCYTTDPETRWEYCNVESCGNEPRPDEPVIAPNEDCYED-NGSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFP--TADLRRNLCRN-PDGDR-APWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTG-SGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDS--NKCRNPDG--DVNGPWCYTT 540          

HSP 4 Score: 108.227 bits (269), Expect = 2.342e-23
Identity = 140/521 (26.87%), Postives = 203/521 (38.96%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVT--SIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCT-------PQCR-NSQTATDYAGIVNRTNSG-VCMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL---ESQVKIYCQL-----------PVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTD-AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS------------------------------CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQTFFMAIL 2307
            GT+Y GT S T  G  C  W S      N +      A    N+CRN P  +  GP+C+   P +    C +  C T  C     G +Y G  + ++SGL C  W +         P+ FP++ +   +NYCR+P        P+C+T       E C++S CT       PQ    +     Y G V+ T SG  C  W     + + R P       L+   NYCRNPD++   PWCY    E++ + YC +           PV +P + CY ++N  +Y G +  T +G  C  W         AS+ P    +   +  T D  +N CR P    A    PWCY ++P V       + YC +  C S                              C T   +S Y G  + T  G  C  WS     S   LS  ++     PD  +   +N CR P  D+   N PWCY +  +       + + +C I  C       P    +  F  I+
Sbjct:  105 GTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLESNFCRN-PDGDKGGPWCYTTDPAKRWENCDIQDC-TEEC-MHCSGENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYL--EENYCRNPDGEPK---PWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGLDQ--NYCRNPDNE-RKPWCYTTDPETRWE-YCNVESCGNEPRPDEPVIAPNEDCY-EDNGSSYRGVMTETISGKKCQAW---------ASMEPHSHVKTPQNFPTADLRRNLCRNPDGDRA----PWCYTTDPSVR------WEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTGSGIS-YRGSVSKTVAGVTCQAWSA----STPHLS--SFTPQAHPDKGL--DSNKCRNPDGDV---NGPWCYTTDPN-------KKWDYCQIPECEYLKCGQPAVKPRRCFGRIV 574          

HSP 5 Score: 104.76 bits (260), Expect = 2.778e-22
Identity = 108/360 (30.00%), Postives = 162/360 (45.00%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLK----KYCKTPCSGIWACLFDRTGS--YYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA--NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTTT--------------PATITRN------NCRTTVAGTEYTGTISTTAKGDTCTLWSSVTN--GNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF-VGPNRVM--CVVPMCNTATC 1161
            + P++ P+  L +  NYCRNPD +    WC+  +     +      C +P   I   L   TG    Y+G VSVTE  +TC  W+S+   + ++  P+N        NYCRNP +N   PWC+      ++ +C + +C   P        A N  C    +G  Y G +  T +   C  W +     + +   P  F TA +    N CRNP+ D   PWCYTT  +   EYC I +C +TT              P  +T++      +C+T  +G  Y G++S T  G TC  WS+ T    +F   + PD    +  N CRN P  ++ GP+C+   PN+    C +P C    C
Sbjct:  216 YMPSVFPEKYLEE--NYCRNPDGEP-KPWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGNTYRGTVSVTESGKTCQSWASQLP-HKHSRTPDNYPCKGLDQNYCRNP-DNERKPWCYTTDPETRWEYCNVESCGNEPRPDEPVI-APNEDCYED-NGSSYRGVMTETISGKKCQAWASMEP--HSHVKTPQNFPTADLRR--NLCRNPDGD-RAPWCYTTDPSVRWEYCRIERCGSTTVSLTPPPALKPVVPPTLLTQSVPSEFADCKTG-SGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDS--NKCRN-PDGDVNGPWCYTTDPNKKWDYCQIPECEYLKC 559          
BLAST of Plasminogen vs. Ensembl Cavefish
Match: hgfa (hepatocyte growth factor-like [Source:NCBI gene;Acc:103045938])

HSP 1 Score: 119.783 bits (299), Expect = 4.051e-27
Identity = 111/384 (28.91%), Postives = 171/384 (44.53%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFP--DQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFWTDPRNINFR-NPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCSP--------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPS-FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT-SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            G +Y G +++++SG+ C  W N+SV   E NY P   +     +N+CR+P     V GP+C+T  S T  + C +    PQC   Q        Y G ++ T SG  C  W   R    +  P   +   L+D  NYCRNP++D + PWCY   +     YC + +C          T  C+ +     Y G +NVT +G +C +W    P   + + +P  +  + L        +NYCR P      S  PWC+ ++P+V  +  +    C+ T     CY  +N   Y G  + T +G PC +WS    +  ++ SG       L         N CR P RD    + PWCY S SS+        + +C +  C T+ +
Sbjct:  118 GVNYKGRRSVTRSGVSCQAW-NVSVPH-EHNYKPAKHKKFDLRENFCRNPDK--DVSGPWCFTNSSETRYQECGL----PQCSEVQCMQCNGEAYRGPMDHTESGKECQRWDSQRPHKHKYQPHRHSGKGLDD--NYCRNPNND-VRPWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACF-RGQGERYRGRVNVTPSGATCQRWDSQFP--HNHTYTPHNYKCKDL-------RENYCRNPDG----SEIPWCFTTDPKVRKALCTSIPRCSETQEKPECYE-DNGESYRGNVSKTRSGIPCGLWSDHTYSRDTR-SGTASAGLQL---------NLCRNPDRD---KHGPWCYTSNSSI-------PWDYCGLERCKTSKL 455          

HSP 2 Score: 109.768 bits (273), Expect = 5.581e-24
Identity = 108/368 (29.35%), Postives = 151/368 (41.03%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC----------TPQCRNSQTATDYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL---ESQVKIYCQLPVCSPTQG---CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            +G  Y G  S T  G +C  W+       N             N+CRN P  ++ GP+CF   +      C +P C+   C     G +Y G    ++SG  C  W   S    +  Y P +        NYCR+P+N +    P+CYT+   T  E CNIS C          T  C   Q    Y G VN T SG  C  W    P N  +  P       L +  NYCRNPD   + PWC+    + +  +   +P CS TQ    CY ++N  +Y GN++ T++G+ C  WSD+  +    S + S   QL          N CR P         PWCY S   +       + YC +  C +
Sbjct:  117 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNYKPAKHKKFDLRENFCRN-PDKDVSGPWCFTNSSETRYQECGLPQCSEVQC-MQCNGEAYRGPMDHTESGKECQRWD--SQRPHKHKYQPHRHSGKGLDDNYCRNPNNDVR---PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQ-GERYRGRVNVTPSGATCQRWDSQFPHNHTY-TPHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQEKPECY-EDNGESYRGNVSKTRSGIPCGLWSDHTYSRDTRSGTASAGLQL----------NLCRNPDRDKH---GPWCYTSNSSIP------WDYCGLERCKT 452          

HSP 3 Score: 101.679 bits (252), Expect = 1.664e-21
Identity = 99/365 (27.12%), Postives = 149/365 (40.82%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT-ATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQTATD--------YAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPTQ 1653
            SGV Y G  ++T +   C  W  +    + Y  +P   K   + E  N+CRNP+ D SGPWC+T +    Y  C +P+C     + +    C     G  Y G +  T  G  C  W S                    NYCRN P +++  P+C+          C + +C++  T    V       +G  Y G   ++ SG  C  W +      +  P+ +  + +   +NYCR+P      + P+C+   TT      + CT  P+C  +Q   +        Y G V++T SG+ C  W+D     +        A      N CRNPD D  GPWCY  S   I   YC L  C  ++
Sbjct:  117 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNY--KPAKHKKFDLRE--NFCRNPDKDVSGPWCFTNSSETRYQECGLPQC-----SEVQCMQCN----GEAYRGPMDHTESGKECQRWDSQRPHKHKYQPHRHSGKGLDDNYCRN-PNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYTPHNYKCKDL--RENYCRNPD---GSEIPWCF---TTDPKVRKALCTSIPRCSETQEKPECYEDNGESYRGNVSKTRSGIPCGLWSDH---TYSRDTRSGTASAGLQLNLCRNPDRDKHGPWCYT-SNSSIPWDYCGLERCKTSK 454          

HSP 4 Score: 97.4413 bits (241), Expect = 4.111e-20
Identity = 95/365 (26.03%), Postives = 140/365 (38.36%), Query Frame = 1
Query:  358 TGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFP---ENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTT----SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCV-VPMCNTATCRTTV---EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC 1398
            +G  Y+G  SVT    +C  W+   S+    N+            N+CRNP  +  GPWC+  S   ++                     G   C        +G  Y G +  T +   C  W +      P+ ++    + +      NYCRNPN D   PWCYTT  N   EYC I  C +                G  Y G ++ T  G TC  W S    N   +           NYCRN   S +  P+CF    +V   +C  +P C+    +       G SY G  + ++SG+PC LW++ + +          S     N CR+P       GP+CYTS ++   + C +  C
Sbjct:  117 SGVNYKGRRSVTRSGVSCQAWNV--SVPHEHNYKPAKHKKFDLRENFCRNPDKDVSGPWCFTNSSETRY------------------QECGLPQCSEVQCMQCNGEAYRGPMDHTESGKECQRWDSQ----RPHKHKYQPHRHSGKGLDDNYCRNPNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYTPHNYKCKDLRENYCRNPDGSEI--PWCFTTDPKVRKALCTSIPRCSETQEKPECYEDNGESYRGNVSKTRSGIPCGLWSDHTYS--RDTRSGTASAGLQLNLCRNPDR--DKHGPWCYTSNSSIPWDYCGLERC 450          

HSP 5 Score: 90.1225 bits (222), Expect = 8.080e-18
Identity = 83/273 (30.40%), Postives = 113/273 (41.39%), Query Frame = 1
Query: 1423 TATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTF-ENVS---------RYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            +  +Y G  + T SGV C  W  + P   N++  +     K +   N+CRNPD D  GPWC+  S    Y  C LP CS  Q    Q N  AY G ++ T++G  C +W    P        P   S    D       NYCR P N       PWCY ++          + YCN+++C S +T  E+V+         RY G  N T +G  C  W +         +  NY    L +       NYCR P  D   I  PWC+ +   V
Sbjct:  117 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNYKPAK---HKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEVQ--CMQCNGEAYRGPMDHTESGKECQRWDSQRP--HKHKYQPHRHSGKGLD------DNYCRNPNNDV----RPWCYTTDKNTR------WEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQ-FPHNHTYTPHNYKCKDLRE-------NYCRNP--DGSEI--PWCFTTDPKV 354          
BLAST of Plasminogen vs. Ensembl Cavefish
Match: hgfa (hepatocyte growth factor-like [Source:NCBI gene;Acc:103045938])

HSP 1 Score: 119.013 bits (297), Expect = 7.663e-27
Identity = 111/384 (28.91%), Postives = 171/384 (44.53%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFP--DQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFWTDPRNINFR-NPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI--YCQLPVCSP--------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPS-FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT-SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            G +Y G +++++SG+ C  W N+SV   E NY P   +     +N+CR+P     V GP+C+T  S T  + C +    PQC   Q        Y G ++ T SG  C  W   R    +  P   +   L+D  NYCRNP++D + PWCY   +     YC + +C          T  C+ +     Y G +NVT +G +C +W    P   + + +P  +  + L        +NYCR P      S  PWC+ ++P+V  +  +    C+ T     CY  +N   Y G  + T +G PC +WS    +  ++ SG       L         N CR P RD    + PWCY S SS+        + +C +  C T+ +
Sbjct:  116 GVNYKGRRSVTRSGVSCQAW-NVSVPH-EHNYKPAKHKKFDLRENFCRNPDK--DVSGPWCFTNSSETRYQECGL----PQCSEVQCMQCNGEAYRGPMDHTESGKECQRWDSQRPHKHKYQPHRHSGKGLDD--NYCRNPNND-VRPWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACF-RGQGERYRGRVNVTPSGATCQRWDSQFP--HNHTYTPHNYKCKDL-------RENYCRNPDG----SEIPWCFTTDPKVRKALCTSIPRCSETQEKPECYE-DNGESYRGNVSKTRSGIPCGLWSDHTYSRDTR-SGTASAGLQL---------NLCRNPDRD---KHGPWCYTSNSSI-------PWDYCGLERCKTSKL 453          

HSP 2 Score: 108.997 bits (271), Expect = 9.745e-24
Identity = 108/368 (29.35%), Postives = 151/368 (41.03%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAA--KNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC----------TPQCRNSQTATDYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL---ESQVKIYCQLPVCSPTQG---CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS 1953
            +G  Y G  S T  G +C  W+       N             N+CRN P  ++ GP+CF   +      C +P C+   C     G +Y G    ++SG  C  W   S    +  Y P +        NYCR+P+N +    P+CYT+   T  E CNIS C          T  C   Q    Y G VN T SG  C  W    P N  +  P       L +  NYCRNPD   + PWC+    + +  +   +P CS TQ    CY ++N  +Y GN++ T++G+ C  WSD+  +    S + S   QL          N CR P         PWCY S   +       + YC +  C +
Sbjct:  115 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNYKPAKHKKFDLRENFCRN-PDKDVSGPWCFTNSSETRYQECGLPQCSEVQC-MQCNGEAYRGPMDHTESGKECQRWD--SQRPHKHKYQPHRHSGKGLDDNYCRNPNNDVR---PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQ-GERYRGRVNVTPSGATCQRWDSQFPHNHTY-TPHNYKCKDLRE--NYCRNPDGSEI-PWCFTTDPKVRKALCTSIPRCSETQEKPECY-EDNGESYRGNVSKTRSGIPCGLWSDHTYSRDTRSGTASAGLQL----------NLCRNPDRDKH---GPWCYTSNSSIP------WDYCGLERCKT 450          

HSP 3 Score: 100.908 bits (250), Expect = 2.853e-21
Identity = 98/365 (26.85%), Postives = 146/365 (40.00%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNT-ATCRTTV-------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCT--PQCRNSQTATD--------YAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCSPTQ 1653
            SGV Y G  ++T +   C  W  +    + Y  +P   K   + E  N+CRNP+ D SGPWC+T +    Y  C +P+C                  G  Y G +  T  G  C  W S                    NYCRN P +++  P+C+          C + +C++  T    V       +G  Y G   ++ SG  C  W +      +  P+ +  + +   +NYCR+P      + P+C+   TT      + CT  P+C  +Q   +        Y G V++T SG+ C  W+D     +        A      N CRNPD D  GPWCY  S   I   YC L  C  ++
Sbjct:  115 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNY--KPAKHKKFDLRE--NFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEVQCMQCN---------GEAYRGPMDHTESGKECQRWDSQRPHKHKYQPHRHSGKGLDDNYCRN-PNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYTPHNYKCKDL--RENYCRNPD---GSEIPWCF---TTDPKVRKALCTSIPRCSETQEKPECYEDNGESYRGNVSKTRSGIPCGLWSDH---TYSRDTRSGTASAGLQLNLCRNPDRDKHGPWCYT-SNSSIPWDYCGLERCKTSK 452          

HSP 4 Score: 97.0561 bits (240), Expect = 5.679e-20
Identity = 95/365 (26.03%), Postives = 140/365 (38.36%), Query Frame = 1
Query:  358 TGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFP---ENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTT----SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCV-VPMCNTATCRTTV---EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC 1398
            +G  Y+G  SVT    +C  W+   S+    N+            N+CRNP  +  GPWC+  S   ++                     G   C        +G  Y G +  T +   C  W +      P+ ++    + +      NYCRNPN D   PWCYTT  N   EYC I  C +                G  Y G ++ T  G TC  W S    N   +           NYCRN   S +  P+CF    +V   +C  +P C+    +       G SY G  + ++SG+PC LW++ + +          S     N CR+P       GP+CYTS ++   + C +  C
Sbjct:  115 SGVNYKGRRSVTRSGVSCQAWNV--SVPHEHNYKPAKHKKFDLRENFCRNPDKDVSGPWCFTNSSETRY------------------QECGLPQCSEVQCMQCNGEAYRGPMDHTESGKECQRWDSQ----RPHKHKYQPHRHSGKGLDDNYCRNPNNDVR-PWCYTTDKNTRWEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQFPHNHTYTPHNYKCKDLRENYCRNPDGSEI--PWCFTTDPKVRKALCTSIPRCSETQEKPECYEDNGESYRGNVSKTRSGIPCGLWSDHTYS--RDTRSGTASAGLQLNLCRNPDR--DKHGPWCYTSNSSIPWDYCGLERC 448          

HSP 5 Score: 89.3521 bits (220), Expect = 1.165e-17
Identity = 83/273 (30.40%), Postives = 113/273 (41.39%), Query Frame = 1
Query: 1423 TATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTF-ENVS---------RYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            +  +Y G  + T SGV C  W  + P   N++  +     K +   N+CRNPD D  GPWC+  S    Y  C LP CS  Q    Q N  AY G ++ T++G  C +W    P        P   S    D       NYCR P N       PWCY ++          + YCN+++C S +T  E+V+         RY G  N T +G  C  W +         +  NY    L +       NYCR P  D   I  PWC+ +   V
Sbjct:  115 SGVNYKGRRSVTRSGVSCQAWNVSVPHEHNYKPAK---HKKFDLRENFCRNPDKDVSGPWCFTNSSETRYQECGLPQCSEVQ--CMQCNGEAYRGPMDHTESGKECQRWDSQRP--HKHKYQPHRHSGKGLD------DNYCRNPNNDV----RPWCYTTDKNTR------WEYCNISLCDSDHTVDEDVTTACFRGQGERYRGRVNVTPSGATCQRWDSQ-FPHNHTYTPHNYKCKDLRE-------NYCRNP--DGSEI--PWCFTTDPKV 352          
BLAST of Plasminogen vs. Ensembl Cavefish
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:103033838])

HSP 1 Score: 112.464 bits (280), Expect = 7.807e-25
Identity = 102/363 (28.10%), Postives = 141/363 (38.84%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCN---------TATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTS--------LTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSP 1647
            +G+ Y G I+ T     C  W   T   + +   P   K   + +  N CRNP+   +GPWC+T   N  Y  C IP+C      T           G  Y G +  T  G  C  W         F+   +PD    +  NYCRN        P+CF     V    C +  C+         T TC     G  Y GT A+ + GL C  W      S   +Y P +      ++N+CR+P      D P+C+T+              C  +   P+     +   Y G   +T SG+ C  W D    N R    L+    E   N+CRNPD D  GPWCY  S +    YC + +C P
Sbjct:  116 TGLNYKGKISKTETGEECQKWDLNTPHEHHFL--PRRHKKKDLRD--NLCRNPDNSTTGPWCFTKNPNIRYQNCNIPQCSEVECMTCN---------GESYRGPMDHTESGRECQRWDLDEPHKHLFHPKRYPDNGLKD--NYCRNP--DGRQRPWCFTTDPDVPWEYCSIKQCDSDNQSNIETTTTCFRD-NGAGYRGTVAVPREGLTCQRWDAQFPHS--HSYMPQKYRCKDLSENFCRNPD---GRDAPWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSEETYRGKQMKTRSGILCAPWRDHSERNKREVVTLSE---ELEGNFCRNPDKDKHGPWCYTNSSLVPWDYCTVKLCDP 452          

HSP 2 Score: 92.4337 bits (228), Expect = 1.582e-18
Identity = 96/373 (25.74%), Postives = 145/373 (38.87%), Query Frame = 1
Query:  358 TGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAAN---------AVNYCRNLPRSNLPGPFCF-VGPN--RVMCV-VPMCNTAT-----CRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTP 1404
            TG  Y+G +S TE  E C  W    + + +   P         +N CRNP N+T GPWC+ ++   ++                         C  T +G  Y G +  T +   C  W       + +   P  +    + +  NYCRNP+     PWC+TT  +   EYC+I +C +   + I          G  Y GT++   +G TC  W         D+ FP   +           + N+CRN        P+CF   PN     C  +P C  A      C    E  +Y G Q  ++SG+ C  W + S  +        + +    N+CR+P       GP+CYT  SL   + C +  C P
Sbjct:  116 TGLNYKGKISKTETGEECQKWDL-NTPHEHHFLPRRHKKKDLRDNLCRNPDNSTTGPWCFTKNPNIRY-------------QNCNIPQCSEVECM-TCNGESYRGPMDHTESGRECQRWDLDEP--HKHLFHPKRYPDNGLKD--NYCRNPDGRQR-PWCFTTDPDVPWEYCSIKQCDSDNQSNIETTTTCFRDNGAGYRGTVAVPREGLTCQRW---------DAQFPHSHSYMPQKYRCKDLSENFCRNP--DGRDAPWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSE-ETYRGKQMKTRSGILCAPWRDHSERNKREVVTLSEELEG--NFCRNPDK--DKHGPWCYTNSSLVPWDYCTVKLCDP 452          

HSP 3 Score: 88.9669 bits (219), Expect = 1.737e-17
Identity = 108/412 (26.21%), Postives = 162/412 (39.32%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVA--AKNYCRSPSNVLSVDGPFCYTSL--TTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSGV-CMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL-ESQVKI-YCQLPVCSP--------TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCN--VTICTSCYTFENVSRYNGFANTTSNGTPCLVW---STMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC-------PTAAIINPINTFQTFFMAILMAG 2316
            G +Y G  + +++G  C  W     T  E ++ P +        N CR+P N  S  GP+C+T       + CNI    PQC   +  T     Y G ++ T SG  C  W  D  + +  +P+      L+D  NYCRNPD     PWC+  +  V   YC +  C          T  C+  N A  Y G + V + G++C +W    P       S S+M Q         ++N+CR P  + A    PWC+ ++P +  +       C    T    CY     + Y G    T +G  C  W   S  N   +  LS                  N+CR P +D    + PWCY + S V        + +CT+  C       P  A ++  + F    + I+  G
Sbjct:  117 GLNYKGKISKTETGEECQKWD--LNTPHEHHFLPRRHKKKDLRDNLCRNPDN--STTGPWCFTKNPNIRYQNCNI----PQCSEVECMTCNGESYRGPMDHTESGRECQRWDLDEPHKHLFHPKRYPDNGLKD--NYCRNPDGRQR-PWCFTTDPDVPWEYCSIKQCDSDNQSNIETTTTCFRDNGA-GYRGTVAVPREGLTCQRWDAQFPH------SHSYMPQKY--RCKDLSENFCRNPDGRDA----PWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSEET-YRGKQMKTRSGILCAPWRDHSERNKREVVTLSEE-------------LEGNFCRNPDKD---KHGPWCYTNSSLV-------PWDYCTVKLCDPLPNALPQKAEVSQASCFVHKQVRIVGGG 480          

HSP 4 Score: 84.7297 bits (208), Expect = 3.650e-16
Identity = 92/338 (27.22%), Postives = 133/338 (39.35%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIW---SSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTS-----GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCT-IPKC--FTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCN 1149
            F P       L D  N CRNPDN T G WC+  N  +   + C  P CS +  C+    G  Y+G +  TE    C  W        ++    +P+N +   +NYCRNP +    PWC          F T P             +   +  ++TT+     G  Y GT+A+      C  W       + Y   P  ++   ++E  N+CRNP+     PWC+TT  N    +C  IP+C    T P    + +  T      Y G    T  G  C  W    +   N       S     N+CRN P  +  GP+C+   + V    C V +C+
Sbjct:  146 FLPRRHKKKDLRD--NLCRNPDNSTTGPWCFTKN-PNIRYQNCNIPQCSEV-ECMTC-NGESYRGPMDHTESGRECQRWDLDEPHKHLFHPKRYPDNGL--KDNYCRNP-DGRQRPWC----------FTTDPDVPWEYCSIKQCDSDNQSNIETTTTCFRDNGAGYRGTVAVPREGLTCQRWDAQFPHSHSYM--PQKYRCKDLSE--NFCRNPDGR-DAPWCFTTDPNIPWAFCKNIPRCGAAATEPEECYKGSEET------YRGKQMKTRSGILCAPWRD--HSERNKREVVTLSEELEGNFCRN-PDKDKHGPWCYTNSSLVPWDYCTVKLCD 451          
BLAST of Plasminogen vs. Ensembl Sea Lamprey
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 100.523 bits (249), Expect = 2.879e-22
Identity = 104/350 (29.71%), Postives = 139/350 (39.71%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV----GPNRVMCVVP-MCNTATCRTTVEGY--------SYAGTQAISKSGLPCLLWTN---ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT---SLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY 1599
            T +G  Y G    T +  PC  W  +    + Y   P  +    +    N CRNP  +P  PWCYT   N+  E C IP+C    P    R        G  Y G +  T     C  W      N N+    FP+    +  NYCRN P   +  P+CF      P     + P  C +   R  +EG          Y G    +K G+PC  W        T +E NY P   +   +NYCR+P      + P+C+T   S+      +I  C      SQ    + T Y G V  T  G+ C  W  T P    +  P+    A LE   + CRNPD DP GPWC+
Sbjct:   53 TGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYL--PSFYPAFDLE--GNSCRNPAQEPGEPWCYTMDSNRRRERCGIPRC-DEVPCVECR--------GEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFPNAGLDD--NYCRN-PNGRM-RPWCFTTDPHQPWEYCSIKPGCCASKATRPAMEGRPCLEERGEDYRGRANHTKGGIPCQHWAAQQPHRHTYLEHNY-PCSGL--DRNYCRNPDG--REEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGTAYRGGVATTRHGLQCQAWNATSPHKPWY-TPKSHPGAGLE--GHSCRNPDGDPWGPWCF 377          

HSP 2 Score: 94.3597 bits (233), Expect = 2.957e-20
Identity = 108/395 (27.34%), Postives = 159/395 (40.25%), Query Frame = 1
Query: 1168 TVEGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTP----QCRNSQTATDYAGIVNRTNSGV-CMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL--ESQVKIYCQL-PVCSPTQG---------CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYC-NVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC----PTAAIIN 2268
            T  G  Y G +  ++SGLPC  W +         P+++P  +     N CR+P+       P+CYT  S    E C I  C      +CR       Y G+V+ T+S   C  W    P N N+  P     A L+D  NYCRNP+   + PWC+     Q   YC + P C  ++          C  +     Y G  N TK G+ C  W+   P         +++    P  S  D +NYCR P  +     +PWC+  +P V     S    C   T  + CY+    + Y G   TT +G  C  W   N TS  K   P Y     P   +   +  CR P  D      PWC+ S   +        + +C++  C    P +++++
Sbjct:   53 TGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYP--AFDLEGNSCRNPAQEPGE--PWCYTMDSNRRRERCGIPRCDEVPCVECRGEH----YRGLVDHTDSQRECQRWDLQHPHNHNY-TPDRFPNAGLDD--NYCRNPNGR-MRPWCFTTDPHQPWEYCSIKPGCCASKATRPAMEGRPCLEERGE-DYRGRANHTKGGIPCQHWAAQQPHRH------TYLEHNYP-CSGLD-RNYCRNPDGREE---APWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGTA-YRGGVATTRHGLQCQAW---NATSPHK---PWYTPKSHPGAGLEGHS--CRNPDGDPW---GPWCFTSDPHLP-------WDYCSVEACGDNFPLSSLLD 404          

HSP 3 Score: 81.2629 bits (199), Expect = 4.592e-16
Identity = 99/375 (26.40%), Postives = 148/375 (39.47%), Query Frame = 1
Query:  922 TVAGTEYTGTISTTAKGDTCTLW--SSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV---GPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLW--TNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQCRNS--------------QTATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLN---AAKLEDAANYCRNPDSDPLGPWCY-LESQVK--IYCQLPVCS-PTQG--CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
            T  G+ Y G  + T  G  C  W  S   +  +  S +P        N CRN P      P+C+       R  C +P C+   C     G  Y G    + S   C  W   +    +  P+ FP+  +    NYCR+P+  +    P+C+T+      E C+I    P C  S              +   DY G  N T  G+ C  W        R+  L +    + L+   NYCRNPD     PWC+ L+  V+  +   +P C+ PT G  CY+ +   AY G +  T++G+ C  W+   P        P +  +  P A      + CR P         PWC+ S+P +       + YC+V  C
Sbjct:   53 TGNGSGYRGDKNYTESGLPCQAWGDSEPHDSRYLPSFYPAFDLEG--NSCRN-PAQEPGEPWCYTMDSNRRRERCGIPRCDEVPC-VECRGEHYRGLVDHTDSQRECQRWDLQHPHNHNYTPDRFPNAGL--DDNYCRNPNGRMR---PWCFTTDPHQPWEYCSIK---PGCCASKATRPAMEGRPCLEERGEDYRGRANHTKGGIPCQHWAA--QQPHRHTYLEHNYPCSGLD--RNYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQCYSGSGT-AYRGGVATTRHGLQCQAWNATSPH------KPWYTPKSHPGAGLEG--HSCRNPDGDPW---GPWCFTSDPHLP------WDYCSVEAC 393          

HSP 4 Score: 80.8777 bits (198), Expect = 5.824e-16
Identity = 82/318 (25.79%), Postives = 125/318 (39.31%), Query Frame = 1
Query:  181 PIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANA---NNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGN--FNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV 1110
            P F+PA   +       N CRNP  +    WCY  + ++  ++ C  P      C+  R G +Y+G+V  T+    C  W  +     N N+  +   NA   +NYCRNP N    PWC   +D ++                      G    +    G +Y G    T    PC  W       + Y    +           NYCRNP+     PWC+T   +  ++ C+ IP+C   T  +        + +GT Y G ++TT  G  C  W++ +     +   S P   A    + CRN P  +  GP+CF 
Sbjct:   87 PSFYPAFDLEG------NSCRNPAQEPGEPWCYTMD-SNRRRERCGIPRCDEVPCVECR-GEHYRGLVDHTDSQRECQRWDLQHP--HNHNYTPDRFPNAGLDDNYCRNP-NGRMRPWC-FTTDPHQPWEYCSIKPGCCASKATRPAMEGRPCLEE--RGEDYRGRANHTKGGIPCQHWAAQQPHRHTY----LEHNYPCSGLDRNYCRNPDGREEAPWCFTLDPSVRRQLCSHIPRCAQPTAGSQC-----YSGSGTAYRGGVATTRHGLQCQAWNATSPHKPWYTPKSHP--GAGLEGHSCRN-PDGDPWGPWCFT 378          

HSP 5 Score: 77.411 bits (189), Expect = 6.651e-15
Identity = 77/262 (29.39%), Postives = 112/262 (42.75%), Query Frame = 1
Query:  169 DIVNPIFH---PALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYC--KTPCSGIWA---------CLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPAT 897
            D+ +P  H   P   P+A L D  NYCRNP N  +  WC+ T+  H   +YC  K  C    A         CL +R G  Y+G  + T+    C  W+++      Y   N+P + +    NYCRNP      PWC        F        Q    +P        + C S  SG  Y G +A T +   C  W  T+  + P++  P     A +    + CRNP+ DP GPWC+T+  +   +YC++  C    P +
Sbjct:  159 DLQHPHNHNYTPDRFPNAGLDD--NYCRNP-NGRMRPWCFTTD-PHQPWEYCSIKPGCCASKATRPAMEGRPCLEER-GEDYRGRANHTKGGIPCQHWAAQQPHRHTYLEHNYPCSGLDR--NYCRNPDGREEAPWC--------FTLDPSVRRQLCSHIPRCAQPTAGSQCYSG-SGTAYRGGVATTRHGLQCQAWNATSP-HKPWYT-PKSHPGAGLE--GHSCRNPDGDPWGPWCFTSDPHLPWDYCSVEACGDNFPLS 400          

HSP 6 Score: 56.225 bits (134), Expect = 3.496e-8
Identity = 47/179 (26.26%), Postives = 67/179 (37.43%), Query Frame = 1
Query: 1648 TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVS 2184
             +GCYT N +  Y G+ N T++G+ C  W D  P   D+   PSF      +       N CR P  +    G PWCY  +             C+   C  C        Y G  + T +   C  W       L      NY     P+  +   +NYCR P   +    +PWC+ +
Sbjct:   48 VRGCYTGNGS-GYRGDKNYTESGLPCQAWGDSEP--HDSRYLPSFYPAFDLEG------NSCRNPAQE---PGEPWCYTMDSNRRRERCG-IPRCDEVPCVEC----RGEHYRGLVDHTDSQRECQRW------DLQHPHNHNYTPDRFPNAGL--DDNYCRNPNGRM----RPWCFTT 197          
BLAST of Plasminogen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003778.1 (pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 gene:ENSPMAG00000003419.1 transcript:ENSPMAT00000003778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 3.877e-12
Identity = 65/202 (32.18%), Postives = 91/202 (45.05%), Query Frame = 1
Query: 1129 CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTN--ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC----------TPQCRNSQTA------------TDYAGIVNRTNSGV-CMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-LESQVKI-YCQLPVCS 1644
            C+  +C T        G  Y G  + +KSG  C LWT+        +P   P++ +V  +N+CR+P    S DGP+CYT   L   E C++  C          +P+   ++ A             DY G VN T SG  C  W+    +++  +P    AA LE AA  CRNPD D  G WCY  +  + I YC L  C 
Sbjct:  102 CLKGLCMTGN------GEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVDHPEKQLV--ENFCRNPD--ASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCVPGAGEDYRGPVNVTRSGRHCQAWSAQTPHVSRYSPLTHRAAGLEGAA--CRNPDGDEEGAWCYTTDPGLTIDYCALHYCD 291          

HSP 2 Score: 62.003 bits (149), Expect = 5.782e-10
Identity = 51/175 (29.14%), Postives = 72/175 (41.14%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAE---VANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFT--------------TTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            T +G +Y G ++ T +   C  WT+        F   + FK     E   V N+CRNP+A   GPWCYT      +E C++P C                T PA   +  C    AG +Y G ++ T  G  C  WS+ T      S     +A      CRN P  +  G +C+
Sbjct:  109 TGNGEQYIGNVSFTKSGRQCQLWTSN-------FPHQVRFKPVDHPEKQLVENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPC-VPGAGEDYRGPVNVTRSGRHCQAWSAQTPHVSRYSPLTHRAAGLEGAACRN-PDGDEEGAWCY 274          

HSP 3 Score: 60.077 bits (144), Expect = 2.456e-9
Identity = 59/221 (26.70%), Postives = 88/221 (39.82%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSS---KGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDL-----------NKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNR--PILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKC-----FTTTPATITRNNCRTTVAGTEYTGTI 954
            G  Y G VS T+    C +W+S       +   + PE  +    N+CRNP  +  GPWC+ +  L           +K     +P   +  P  P     G        +G +Y G + +T +   C  W+       P+ +R  P+  + A +   A  CRNP+ D  G WCYTT      +YC +  C     F   P        RTT  GT+   T+
Sbjct:  112 GEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVDHPEKQLVE--NFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCV---PGAGEDYRGPVNVTRSGRHCQAWSAQ----TPHVSRYSPLTHRAAGLEGAA--CRNPDGDEEGAWCYTTDPGLTIDYCALHYCDEDDIFMEAPKE-EGGRGRTTATGTDPKMTL 320          

HSP 4 Score: 58.9214 bits (141), Expect = 5.730e-9
Identity = 62/220 (28.18%), Postives = 86/220 (39.09%), Query Frame = 1
Query: 1435 YAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQV--KIYCQLPVC--------------SPT------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTF-ENVSRYNGFANTTSNGT 2016
            Y G V+ T SG  C  WT   P  + F+    ++  + +   N+CRNPD+   GPWCY    +  +  C +P C              +PT      QG         Y G +NVT++G  C  WS   P +       S  S L   A+  +    CR P          WCY ++P   G T+    YC +  C     F E      G   TT+ GT
Sbjct:  115 YIGNVSFTKSGRQCQLWTSNFPHQVRFKP---VDHPEKQLVENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKDPNQHVPVSPRVTPTKPAPRPQGPCVPGAGEDYRGPVNVTRSGRHCQAWSAQTPHV-------SRYSPLTHRAAGLEGA-ACRNPDGDEE---GAWCYTTDP---GLTID---YCALHYCDEDDIFMEAPKEEGGRGRTTATGT 314          
BLAST of Plasminogen vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001728.1 (pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 gene:ENSPMAG00000001561.1 transcript:ENSPMAT00000001728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 4.499e-10
Identity = 75/295 (25.42%), Postives = 114/295 (38.64%), Query Frame = 1
Query:  640 TTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN--QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTG-TISTT-----------------------------------AKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIE--PNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYC 1398
            T SG  Y G   +T + + C  W + T   + Y   P  F  A +    NYCRNP++DP+GPWC T   N   EYC + +C +    T      R T++  E  G ++ +T                                    +     LW +  N +F  +S+      +   YC +  ++N      F  PN             C     GY   G QA++  G  C  W + S    +  P  + D  +  +  YCR+P   L+  GP+CYT  S T  + C I++C
Sbjct:   13 TGSGTGYRGLQTLTASGHQCQTWASKTPHLHAY--TPEGFPEAGLEN--NYCRNPDSDPNGPWCITQDPNVLWEYCALQRCASGPSPTGAEQ--RATLSRGEKNGLSVRSTNPAPNVPHYRRAIPHSRSYNPDNGPCLSLQTSYCYTQQQPPGLWCNSANNHFRRNSW-----EHCDIYCDSFIQTNP-----FARPNADTLPSTALFGQDCVFGSRGYR--GAQAVTSGGKTCQAWASQSPHRHQFVPANYTDADL--SLGYCRNPDGDLA--GPWCYTTDSATRWQYCGIAHC 285          

HSP 2 Score: 56.9954 bits (136), Expect = 8.623e-9
Identity = 76/278 (27.34%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  358 TGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXX----XXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWC-----YTTTGNQEYCTI-------------PKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVT--NGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV 1110
            +G+ Y+G+ ++T     C  W+SK      YT   FPE  + N  NYCRNP ++  GPWC  Q     + +C +  C   P           A  ++T S  E  G    +TN  P  P        +  YNP  N P L      +   +YC      P G WC     +    + E+C I             P   T     +   +C     G  Y G  + T+ G TC  W+S +     F  +++ D  A  ++ YCRN P  +L GP+C+ 
Sbjct:   15 SGTGYRGLQTLTASGHQCQTWASKTPHLHAYTPEGFPEAGLEN--NYCRNPDSDPNGPWCITQDPNVLWEYCALQRCASGPSPT-------GAEQRATLSRGEKNGLSVRSTNPAPNVPHYRRAIPHSRSYNP-DNGPCL------SLQTSYCYT-QQQPPGLWCNSANNHFRRNSWEHCDIYCDSFIQTNPFARPNADTLPSTALFGQDCVFGSRG--YRGAQAVTSGGKTCQAWASQSPHRHQFVPANYTD--ADLSLGYCRN-PDGDLAGPWCYT 270          
BLAST of Plasminogen vs. Ensembl Nematostella
Match: EDO28926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T536])

HSP 1 Score: 50.8322 bits (120), Expect = 4.937e-8
Identity = 29/80 (36.25%), Postives = 40/80 (50.00%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNA-DPSGPWCYTTTG--NQEYCTIPKC 876
             GV Y G I +T +   C PW++      P+ +     +   +   +N+CRNP    P GPWCYTT      EYC +PKC
Sbjct:    6 EGVGYHGNINVTKSGISCQPWSSQC----PHHHYHNSTQYPELINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          
BLAST of Plasminogen vs. Ensembl Nematostella
Match: EDO39763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S935])

HSP 1 Score: 50.0618 bits (118), Expect = 1.980e-7
Identity = 32/91 (35.16%), Postives = 44/91 (48.35%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNA-DPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRN 909
             GV Y G I +T +   C PW++      P+ +     +   +   +N+CRNP    P GPWCYTT      EYC +PKC    P T+  N
Sbjct:   15 EGVGYHGNINVTKSGISCQPWSSQC----PHRHYHNSTQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC--PPPGTVVIN 99          
BLAST of Plasminogen vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 51.9878 bits (123), Expect = 1.279e-6
Identity = 27/86 (31.40%), Postives = 38/86 (44.19%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATIT 903
            +G +Y G + +T    PC  W +         N P+ +K +      N+CRNP      PWCY      EYC IPKC   + A + 
Sbjct:  136 TGEDYIGRLNVTKYGMPCLSWKS---------NDPV-YKLS-----HNFCRNPRGQHEAPWCYVDKNTYEYCVIPKCSEASDAIMA 206          
BLAST of Plasminogen vs. Ensembl Nematostella
Match: EDO30193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H4])

HSP 1 Score: 45.4394 bits (106), Expect = 4.651e-6
Identity = 26/81 (32.10%), Postives = 34/81 (41.98%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQ--EYCTIPKCFTT 885
            G +Y GT+  T     C PW       +     P++     + +  NYCRNP      PWCYTT      +YC I  C  T
Sbjct:    2 GRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADPLVAAREGLGK-HNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRKT 81          
BLAST of Plasminogen vs. Ensembl Medaka
Match: mst1 (hepatocyte growth factor-like protein [Source:NCBI gene;Acc:101168450])

HSP 1 Score: 121.324 bits (303), Expect = 1.402e-27
Identity = 116/370 (31.35%), Postives = 158/370 (42.70%), Query Frame = 1
Query:  928 AGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSF--PDGSAANAVNYCRNLPRSNLPGPFCFV-GPNRVM--CVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS--IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC-----TPQCRNSQT-------ATDYAGIVNRTNSGV-CMFWTD--PRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYL---ESQVKIYCQLPVCS---PTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC 1947
             G +Y G + TT  G  C  W S     F    +  P  S    +NYCRN    N+ GP+C+   P R    C +P C    C  T  G  Y G    + +G  C  W          +P  +PD+S+    NYCR+P    +   P+CYT+  L   E CNIS C       + R+S T         DY G VN T SG+ C  W    P    F +P +     LE+  NYCRNPD     PWC+    E +  +  Q+  C      + CY Q N   Y G +  T+ GV+C +W+   P      I+P       P+A+ T  +NYCR P         PWCY ++P+        F YC +  C
Sbjct:  113 KGEDYRGKVFTTKSGLNCQQWWS----KFPHDHWWTPTASNGLELNYCRNPDGDNI-GPWCYTTDPERRYESCNIPQCKDEVC-ITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSL--DDNYCRNPD---ASPVPWCYTTDPLVERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPF-HPNIYECKGLEE--NYCRNPDGSE-APWCFTSAPEMRTALCLQIKRCEDDIEAEDCY-QENGKNYRGIVRKTRKGVTCQRWNVNTP--HRTKINPLTH----PEANLT--ENYCRNPDGDQH---GPWCYTTDPKTE------FDYCAIKQC 449          

HSP 2 Score: 114.39 bits (285), Expect = 2.072e-25
Identity = 102/350 (29.14%), Postives = 141/350 (40.29%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEY--CTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGN--FNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGP---NRVMCVVPMCNTATCRTTV-----------EGYSYAGTQAISKSGLPCLLWTNI--SVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATD--------YAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDA---ANYCRNPDSDPLGPWCY 1599
             G +Y G +  T +   C  W +   F + ++  P    TA+     NYCRNP+ D  GPWCYTT   + Y  C IP+C         ++    T  G +Y G +  TA G  C  W         +    +PD S  +  NYCRN   S  P P+C+       R  C +  C                     G  Y G    + SG+PC  W           PN +  + +   +NYCR+P      + P+C+TS     T  +     +C +   A D        Y GIV +T  GV C  W    N+N  +   +N     +A    NYCRNPD D  GPWCY
Sbjct:  113 KGEDYRGKVFTTKSGLNCQQWWSK--FPHDHWWTP----TASNGLELNYCRNPDGDNIGPWCYTTDPERRYESCNIPQC---------KDEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSLDD--NYCRNPDAS--PVPWCYTTDPLVERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFHPNIYECKGL--EENYCRNPD---GSEAPWCFTSAPEMRTA-LCLQIKRCEDDIEAEDCYQENGKNYRGIVRKTRKGVTCQRW----NVNTPHRTKINPLTHPEANLTENYCRNPDGDQHGPWCY 433          

HSP 3 Score: 105.531 bits (262), Expect = 1.305e-22
Identity = 108/386 (27.98%), Postives = 154/386 (39.90%), Query Frame = 1
Query: 1174 EGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYCTPQCRNSQTAT----DYAGIVNRTNSGV-CMFWTDPR-NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCY-----LESQ---VKIYCQLPVCSPTQGCYTQN----NAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTI-CTSCYTFENVSRYNGFANTTSNGTPCLVW--STMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAI 2262
            +G  Y G    +KSGL C  W   S    +  + P  S     NYCR+P       GP+CYT+      E+CNI    PQC++    T    DY G V+ T +G  C  W     + +   P+      L+D  NYCRNPD+ P+ PWCY     +E +   +    ++PV    +  +T N        Y G +N T +G+ C +W+   P   +    P+              +NYCR P    A    PWC+ S P++  +       C   I    CY  EN   Y G    T  G  C  W  +T + T ++ L+ P                NYCR P    G  + PWCY +            F +C I  C    +
Sbjct:  113 KGEDYRGKVFTTKSGLNCQQW--WSKFPHDHWWTPTASNGLELNYCRNPDG--DNIGPWCYTTDPERRYESCNI----PQCKDEVCITCNGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSLDD--NYCRNPDASPV-PWCYTTDPLVERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFP--HEHPFHPNIYE------CKGLEENYCRNPDGSEA----PWCFTSAPEMRTALCLQIKRCEDDIEAEDCYQ-ENGKNYRGIVRKTRKGVTCQRWNVNTPHRTKINPLTHPE----------ANLTENYCRNPD---GDQHGPWCYTTDPKT-------EFDYCAIKQCAGEKV 454          

HSP 4 Score: 95.5153 bits (236), Expect = 1.474e-19
Identity = 86/312 (27.56%), Postives = 122/312 (39.10%), Query Frame = 1
Query:  205 PDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVA--------GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
            P AS     NYCRNPD D +G WCY T+     +  C  P      C+    G  Y+G V  T   + C  W  +     IY    +P+ S+   +NYCRNP + +  PWC+    L           +           +   T      G +Y G +  T +  PC  W       +P+   P +++   + E  NYCRNP+     PWC+T+         P+  T     I R  C   +         G  Y G +  T KG TC  W+  T      +      A    NYCRN P  +  GP+C+
Sbjct:  145 PTASNGLELNYCRNPDGDNIGPWCYTTDPERRYES-CNIPQCKDEVCITC-NGEDYRGQVDHTATGKECQRWDQQHPHQHIYQPEKYPDKSL--DDNYCRNP-DASPVPWCYTTDPL--VERENCNISKCPEVPVEKRQRSSFTTNCFRGRGEDYRGKVNETLSGIPCQRWNAQFPHEHPFH--PNIYECKGLEE--NYCRNPDGS-EAPWCFTSA--------PEMRTALCLQIKR--CEDDIEAEDCYQENGKNYRGIVRKTRKGVTCQRWNVNTPHRTKINPLTHPEANLTENYCRN-PDGDQHGPWCY 433          

HSP 5 Score: 55.8398 bits (133), Expect = 2.574e-7
Identity = 40/131 (30.53%), Postives = 54/131 (41.22%), Query Frame = 1
Query:  187 FHPALLPDASLSDASNYCRNPDNDTVGGWCY-----VTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN-ANNYCRNPTNNTGGPWCWLQSDLNKFGF 561
            FHP +     L +  NYCRNPD  +   WC+     +        K C+          +   G  Y+GIV  T K  TC  W+      T  N   +  AN   NYCRNP  +  GPWC+      +F +
Sbjct:  318 FHPNIYECKGLEE--NYCRNPDG-SEAPWCFTSAPEMRTALCLQIKRCEDDIEA--EDCYQENGKNYRGIVRKTRKGVTCQRWNVNTPHRTKINPLTHPEANLTENYCRNPDGDQHGPWCYTTDPKTEFDY 443          
BLAST of Plasminogen vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 100.523 bits (249), Expect = 4.384e-21
Identity = 105/372 (28.23%), Postives = 151/372 (40.59%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNR--VMCVVPMCNTATCRTTVE--------GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC---NISYCTPQCRNSQT-----ATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSPTQGCYTQN 1671
            +G  Y G  ++T N   C  W +      P+ ++ +  K        NYCRNP+    GPWC+TT        + C IP+C     + +   NC     G +Y G +  T  G  C  W         F+   +PD    +  NYCRN   +    P+CF   PN     C + +C T      VE        G  Y G   ++ +GL C  W   S      ++ P+  +     +NYCR+P      D P+C+T+     T    NI  C  Q R +         +Y G  +RT S + C  W +  N   R   ++    LE   NYCRNPD D  GPWCY  +      YC +  C  +Q    Q+
Sbjct:  116 TGQSYRGRRSVTVNGILCQAWASPI----PHEHKFMSKKFKKSDLRENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQC-----SEVECINCN----GEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNP--NGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGKGEGYRGVVDMTPTGLTCQRWD--SQYPHNHSFIPEAYRCKDLRENYCRNPD---GQDFPWCFTTDPRVRTMFCTNIPQCGTQNRLANECYESLGENYRGQQSRTRSNLPCGPWREHSNSGERGMLMVG---LE--GNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNTIPQD 460          

HSP 2 Score: 94.3597 bits (233), Expect = 3.249e-19
Identity = 94/377 (24.93%), Postives = 153/377 (40.58%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCS--------PTQGCYTQNNAWAYTGNINVTKNGVSCLKW-SDYPPALFDASISPSFMSQLLPDASTTD--AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSR-YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G SY G ++++ +G+ C  W +      +      +     +NYCR+P N  S  GP+C+T+    +  +     PQC   +       DY G ++ T SG  C  W  D  + +  +P+      L+D  NYCRNP+     PWC+         YC + VC          T  C+ Q     Y G +++T  G++C +W S YP                +P+A       +NYCR P  Q      PWC+ ++P+V     +    C      +   +E++   Y G  + T +  PC  W   + +    +              V    NYCR P  D    + PWCY + S++       ++ +C+I  C
Sbjct:  117 GQSYRGRRSVTVNGILCQAWASPIPHEHKFMSKKFKKSDLRENYCRNPDN--STVGPWCFTTDPRPQLRHQECGIPQCSEVECINCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNPNGRHR-PWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECF-QGKGEGYRGVVDMTPTGLTCQRWDSQYP-----------HNHSFIPEAYRCKDLRENYCRNPDGQDF----PWCFTTDPRVRTMFCTNIPQCGTQNRLANECYESLGENYRGQQSRTRSNLPCGPWREHSNSGERGML------------MVGLEGNYCRNPDGD---KHGPWCYTNNSAI-------SWDYCSIKPC 450          

HSP 3 Score: 82.4185 bits (202), Expect = 1.751e-15
Identity = 88/306 (28.76%), Postives = 125/306 (40.85%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLK-KYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIW---SSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTS-----GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
             NYCRNPDN TVG WC+ T+    L+ + C  P CS +  C+ +  G  Y+G +  TE  + C  W        ++    +P+  +   +NYCRNP N    PWC          F T P          +  T  ++    TT      G  Y G + +T     C  W +     + +   P  ++   + E  NYCRNP+     PWC+TT       +CT IP+C T        N C  ++ G  Y G  S T     C  W   +N                 NYCRN P  +  GP+C+
Sbjct:  158 ENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQCSEV-ECI-NCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGL--DDNYCRNP-NGRHRPWC----------FTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGKGEGYRGVVDMTPTGLTCQRWDSQYPHNHSFI--PEAYRCKDLRE--NYCRNPDGQ-DFPWCFTTDPRVRTMFCTNIPQCGTQNRLA---NECYESL-GENYRGQQSRTRSNLPCGPWREHSNSGERGMLM----VGLEGNYCRN-PDGDKHGPWCY 434          

HSP 4 Score: 77.411 bits (189), Expect = 5.518e-14
Identity = 74/243 (30.45%), Postives = 101/243 (41.56%), Query Frame = 1
Query:  184 IFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTN----GTHFLKKYCKTP----CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKC 876
            +FHP   PD  L D  NYCRNP N     WC+ T+      +   K C+TP          C F   G  Y+G+V +T    TC  W S+   + ++  PE         NYCRNP +    PWC+      +  F          P         N   +S   G  Y G  + T ++ PC PW      ++    R +L     +    NYCRNP+ D  GPWCYT     + +YC+I  C
Sbjct:  230 LFHPKRYPDKGLDD--NYCRNP-NGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTEC-FQGKGEGYRGVVDMTPTGLTCQRWDSQ-YPHNHSFIPEAYRCKDLRENYCRNP-DGQDFPWCFTTDPRVRTMF------CTNIPQCGTQNRLANECYESL--GENYRGQQSRTRSNLPCGPWRE----HSNSGERGMLM----VGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPC 450          

HSP 5 Score: 51.9878 bits (123), Expect = 4.146e-6
Identity = 54/208 (25.96%), Postives = 79/208 (37.98%), Query Frame = 1
Query: 1681 AYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEP--QVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQN--FGFCTINTCPTAAIINPINTFQTF 2292
            +Y G  +VT NG+ C  W+   P            S L         +NYCR P N +     PWC+ ++P  Q+          C+   C +C    N   Y G  + T +G  C  W       L +     +     PD  +   +NYCR P       ++PWC+         TT  N  + +CTI  C T    N + T + F
Sbjct:  119 SYRGRRSVTVNGILCQAWASPIPHEHKFMSKKFKKSDL--------RENYCRNPDNSTV---GPWCFTTDPRPQLRHQECGI-PQCSEVECINC----NGEDYRGPMDHTESGKECQRWD------LDEPHKHLFHPKRYPDKGL--DDNYCRNPNGR----HRPWCF---------TTDPNTPWEYCTIKVCETPPDSNVVETTECF 289          
BLAST of Plasminogen vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 100.138 bits (248), Expect = 4.827e-21
Identity = 105/372 (28.23%), Postives = 151/372 (40.59%), Query Frame = 1
Query:  646 SGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN----QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWS--SVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV-GPNR--VMCVVPMCNTATCRTTVE--------GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPD--QSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETC---NISYCTPQCRNSQT-----ATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSPTQGCYTQN 1671
            +G  Y G  ++T N   C  W +      P+ ++ +  K        NYCRNP+    GPWC+TT        + C IP+C     + +   NC     G +Y G +  T  G  C  W         F+   +PD    +  NYCRN   +    P+CF   PN     C + +C T      VE        G  Y G   ++ +GL C  W   S      ++ P+  +     +NYCR+P      D P+C+T+     T    NI  C  Q R +         +Y G  +RT S + C  W +  N   R   ++    LE   NYCRNPD D  GPWCY  +      YC +  C  +Q    Q+
Sbjct:  110 TGQSYRGRRSVTVNGILCQAWASPI----PHEHKFMSKKFKKSDLRENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQC-----SEVECINCN----GEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNP--NGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGKGEGYRGVVDMTPTGLTCQRWD--SQYPHNHSFIPEAYRCKDLRENYCRNPD---GQDFPWCFTTDPRVRTMFCTNIPQCGTQNRLANECYESLGENYRGQQSRTRSNLPCGPWREHSNSGERGMLMVG---LE--GNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPCDASQNTIPQD 454          

HSP 2 Score: 94.3597 bits (233), Expect = 3.242e-19
Identity = 94/377 (24.93%), Postives = 153/377 (40.58%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQ----TATDYAGIVNRTNSGV-CMFWT-DPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCS--------PTQGCYTQNNAWAYTGNINVTKNGVSCLKW-SDYPPALFDASISPSFMSQLLPDASTTD--AQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSR-YNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            G SY G ++++ +G+ C  W +      +      +     +NYCR+P N  S  GP+C+T+    +  +     PQC   +       DY G ++ T SG  C  W  D  + +  +P+      L+D  NYCRNP+     PWC+         YC + VC          T  C+ Q     Y G +++T  G++C +W S YP                +P+A       +NYCR P  Q      PWC+ ++P+V     +    C      +   +E++   Y G  + T +  PC  W   + +    +              V    NYCR P  D    + PWCY + S++       ++ +C+I  C
Sbjct:  111 GQSYRGRRSVTVNGILCQAWASPIPHEHKFMSKKFKKSDLRENYCRNPDN--STVGPWCFTTDPRPQLRHQECGIPQCSEVECINCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDD--NYCRNPNGRHR-PWCFTTDPNTPWEYCTIKVCETPPDSNVVETTECF-QGKGEGYRGVVDMTPTGLTCQRWDSQYP-----------HNHSFIPEAYRCKDLRENYCRNPDGQDF----PWCFTTDPRVRTMFCTNIPQCGTQNRLANECYESLGENYRGQQSRTRSNLPCGPWREHSNSGERGML------------MVGLEGNYCRNPDGD---KHGPWCYTNNSAI-------SWDYCSIKPC 444          

HSP 3 Score: 82.4185 bits (202), Expect = 1.865e-15
Identity = 88/306 (28.76%), Postives = 125/306 (40.85%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLK-KYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIW---SSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTS-----GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQE--YCT-IPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCF 1107
             NYCRNPDN TVG WC+ T+    L+ + C  P CS +  C+ +  G  Y+G +  TE  + C  W        ++    +P+  +   +NYCRNP N    PWC          F T P          +  T  ++    TT      G  Y G + +T     C  W +     + +   P  ++   + E  NYCRNP+     PWC+TT       +CT IP+C T        N C  ++ G  Y G  S T     C  W   +N                 NYCRN P  +  GP+C+
Sbjct:  152 ENYCRNPDNSTVGPWCFTTDPRPQLRHQECGIPQCSEV-ECI-NCNGEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGL--DDNYCRNP-NGRHRPWC----------FTTDPNTPWEYCTIKVCETPPDSNVVETTECFQGKGEGYRGVVDMTPTGLTCQRWDSQYPHNHSFI--PEAYRCKDLRE--NYCRNPDGQ-DFPWCFTTDPRVRTMFCTNIPQCGTQNRLA---NECYESL-GENYRGQQSRTRSNLPCGPWREHSNSGERGMLM----VGLEGNYCRN-PDGDKHGPWCY 428          

HSP 4 Score: 77.7962 bits (190), Expect = 4.736e-14
Identity = 74/243 (30.45%), Postives = 101/243 (41.56%), Query Frame = 1
Query:  184 IFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTN----GTHFLKKYCKTP----CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIAN--ANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKC 876
            +FHP   PD  L D  NYCRNP N     WC+ T+      +   K C+TP          C F   G  Y+G+V +T    TC  W S+   + ++  PE         NYCRNP +    PWC+      +  F          P         N   +S   G  Y G  + T ++ PC PW      ++    R +L     +    NYCRNP+ D  GPWCYT     + +YC+I  C
Sbjct:  224 LFHPKRYPDKGLDD--NYCRNP-NGRHRPWCFTTDPNTPWEYCTIKVCETPPDSNVVETTEC-FQGKGEGYRGVVDMTPTGLTCQRWDSQ-YPHNHSFIPEAYRCKDLRENYCRNP-DGQDFPWCFTTDPRVRTMF------CTNIPQCGTQNRLANECYESL--GENYRGQQSRTRSNLPCGPWRE----HSNSGERGMLM----VGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPC 444          

HSP 5 Score: 51.9878 bits (123), Expect = 3.783e-6
Identity = 54/208 (25.96%), Postives = 79/208 (37.98%), Query Frame = 1
Query: 1681 AYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEP--QVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQN--FGFCTINTCPTAAIINPINTFQTF 2292
            +Y G  +VT NG+ C  W+   P            S L         +NYCR P N +     PWC+ ++P  Q+          C+   C +C    N   Y G  + T +G  C  W       L +     +     PD  +   +NYCR P       ++PWC+         TT  N  + +CTI  C T    N + T + F
Sbjct:  113 SYRGRRSVTVNGILCQAWASPIPHEHKFMSKKFKKSDL--------RENYCRNPDNSTV---GPWCFTTDPRPQLRHQECGI-PQCSEVECINC----NGEDYRGPMDHTESGKECQRWD------LDEPHKHLFHPKRYPDKGL--DDNYCRNPNGR----HRPWCF---------TTDPNTPWEYCTIKVCETPPDSNVVETTECF 283          
BLAST of Plasminogen vs. Ensembl Medaka
Match: f2 (prothrombin [Source:NCBI gene;Acc:101170246])

HSP 1 Score: 74.3294 bits (181), Expect = 4.213e-13
Identity = 51/161 (31.68%), Postives = 75/161 (46.58%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTT-TPATITRNNCRTTVA----GTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFV 1110
            G  Y G I IT +   C  W+ +  F +P F      +  ++ +  N+CRNP+    GPWC+T   +  +E C +PKC     P T+     +TT+     G +YTG +S T  G TC  WSS      +             N CRN P ++  GP+C+V
Sbjct:   89 GHNYNGNIHITKSGRVCQHWSHS--FPHPIFREFNASEPNSILQ-ENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQLTGNKCRN-PDNDPEGPWCYV 245          

HSP 2 Score: 67.781 bits (164), Expect = 5.433e-11
Identity = 52/184 (28.26%), Postives = 81/184 (44.02%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTN-------ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC---------TPQCRNSQT-----ATDYAGIVNRTNSG-VCMFWTDPRNINF-RNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCS 1644
            G++Y G   I+KSG  C  W++           + EPN       +  +N+CR+P      +GP+C+T       ETC +  C          P+   +         DY G ++ T  G  C+ W+ P+     ++ + +   +L    N CRNPD+DP GPWCY+     I   YC L +C 
Sbjct:   89 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNS------ILQENFCRNPDK--RSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQL--TGNKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCE 262          

HSP 3 Score: 62.003 bits (149), Expect = 3.429e-9
Identity = 54/202 (26.73%), Postives = 83/202 (41.09%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSK--GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEV---ANYCRNPNADPSGPWCYT-TTGN--QEYCTIPKC----FTTTPATITRNNCRTTVA 930
            G  Y G + +T+    C  WS      I+   N  E +     N+CRNP   + GPWC+ +    +   C +P C +    P +       T      GV+Y G +++T   + C  W++          + +      + EV    N CRNP+ DP GPWCY   +GN   +YC +  C          T T    R+ +A
Sbjct:   89 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQA-------KALSKDKEFIPEVQLTGNKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCEDPLLAQEQETETEGRERSVLA 283          

HSP 4 Score: 61.2326 bits (147), Expect = 5.784e-9
Identity = 58/219 (26.48%), Postives = 82/219 (37.44%), Query Frame = 1
Query: 1636 VCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVS---------------RYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
            VCS   G     N   Y GNI++TK+G  C  WS   P        P F      + ++   +N+CR P  +S     PWC+  +P V   T      C V  C   +    V+                Y G  + T  G  C+ WS+    +LSK          +P+  V    N CR P  D      PWCYV  S  ++        +C ++ C
Sbjct:   79 VCS---GHCVSGNGHNYNGNIHITKSGRVCQHWSHSFP-------HPIFREFNASEPNSILQENFCRNPDKRSE---GPWCFTKDPSVQKET------CRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSK------DKEFIPE--VQLTGNKCRNPDND---PEGPWCYVHISGNIT------VDYCDLDLC 261          

HSP 5 Score: 55.8398 bits (133), Expect = 2.484e-7
Identity = 46/139 (33.09%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  178 NPIFHP--ALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSG--------------IWACLFDRTGSYYQGIVSVTEKNETCAIWSS--KGSIYTNANF-PENSIANANNYCRNPTNNTGGPWCWLQ 537
            +PIF    A  P++ L +  N+CRNPD  + G WC+ T      K+ C+ P  G                 CL +  G  Y G +SVT    TC  WSS    ++  +  F PE  +    N CRNP N+  GPWC++ 
Sbjct:  114 HPIFREFNASEPNSILQE--NFCRNPDKRSEGPWCF-TKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPN-YGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPE--VQLTGNKCRNPDNDPEGPWCYVH 246          
BLAST of Plasminogen vs. Ensembl Medaka
Match: f2 (prothrombin [Source:NCBI gene;Acc:101170246])

HSP 1 Score: 74.3294 bits (181), Expect = 4.533e-13
Identity = 54/163 (33.13%), Postives = 78/163 (47.85%), Query Frame = 1
Query:  649 GVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTT--TGNQEYCTIPKCFTT-TPATITRNNCRTTVA----GTEYTGTISTTAKGDTCTLWSSVTNGNF-NDSSF-PDGSAANAVNYCRNLPRSNLPGPFCFV 1110
            G  Y G I IT +   C  W+ +  F +P F      +  ++ +  N+CRNP+    GPWC+T   +  +E C +PKC     P T+     +TT+     G +YTG +S T  G TC  WSS        D  F P+       N CRN P ++  GP+C+V
Sbjct:  116 GHNYNGNIHITKSGRVCQHWSHS--FPHPIFREFNASEPNSILQ-ENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQLTG--NKCRN-PDNDPEGPWCYV 272          

HSP 2 Score: 67.781 bits (164), Expect = 5.316e-11
Identity = 52/184 (28.26%), Postives = 81/184 (44.02%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTN-------ISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTS--LTTTETCNISYC---------TPQCRNSQT-----ATDYAGIVNRTNSG-VCMFWTDPRNINF-RNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI---YCQLPVCS 1644
            G++Y G   I+KSG  C  W++           + EPN       +  +N+CR+P      +GP+C+T       ETC +  C          P+   +         DY G ++ T  G  C+ W+ P+     ++ + +   +L    N CRNPD+DP GPWCY+     I   YC L +C 
Sbjct:  116 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNS------ILQENFCRNPDK--RSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQL--TGNKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCE 289          

HSP 3 Score: 61.6178 bits (148), Expect = 4.236e-9
Identity = 54/202 (26.73%), Postives = 83/202 (41.09%), Query Frame = 1
Query:  361 GSYYQGIVSVTEKNETCAIWSSK--GSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEV---ANYCRNPNADPSGPWCYT-TTGN--QEYCTIPKC----FTTTPATITRNNCRTTVA 930
            G  Y G + +T+    C  WS      I+   N  E +     N+CRNP   + GPWC+ +    +   C +P C +    P +       T      GV+Y G +++T   + C  W++          + +      + EV    N CRNP+ DP GPWCY   +GN   +YC +  C          T T    R+ +A
Sbjct:  116 GHNYNGNIHITKSGRVCQHWSHSFPHPIFREFNASEPNSILQENFCRNPDKRSEGPWCFTKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQA-------KALSKDKEFIPEVQLTGNKCRNPDNDPEGPWCYVHISGNITVDYCDLDLCEDPLLAQEQETETEGRERSVLA 310          

HSP 4 Score: 61.2326 bits (147), Expect = 5.667e-9
Identity = 55/215 (25.58%), Postives = 80/215 (37.21%), Query Frame = 1
Query: 1648 TQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVS---------------RYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTC 2247
             +G     N   Y GNI++TK+G  C  WS   P        P F      + ++   +N+CR P  +S     PWC+  +P V   T      C V  C   +    V+                Y G  + T  G  C+ WS+    +LSK          +P+  V    N CR P  D      PWCYV  S  ++        +C ++ C
Sbjct:  107 VEGHCVSGNGHNYNGNIHITKSGRVCQHWSHSFP-------HPIFREFNASEPNSILQENFCRNPDKRSE---GPWCFTKDPSVQKET------CRVPKCGEKFVPPTVAPEVVKTTICLPNYGVDYTGDLSVTLGGHTCIQWSSPQAKALSK------DKEFIPE--VQLTGNKCRNPDND---PEGPWCYVHISGNIT------VDYCDLDLC 288          

HSP 5 Score: 55.4546 bits (132), Expect = 2.973e-7
Identity = 46/139 (33.09%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  178 NPIFHP--ALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSG--------------IWACLFDRTGSYYQGIVSVTEKNETCAIWSS--KGSIYTNANF-PENSIANANNYCRNPTNNTGGPWCWLQ 537
            +PIF    A  P++ L +  N+CRNPD  + G WC+ T      K+ C+ P  G                 CL +  G  Y G +SVT    TC  WSS    ++  +  F PE  +    N CRNP N+  GPWC++ 
Sbjct:  141 HPIFREFNASEPNSILQE--NFCRNPDKRSEGPWCF-TKDPSVQKETCRVPKCGEKFVPPTVAPEVVKTTICLPN-YGVDYTGDLSVTLGGHTCIQWSSPQAKALSKDKEFIPEVQL--TGNKCRNPDNDPEGPWCYVH 273          
BLAST of Plasminogen vs. Planmine SMEST
Match: SMESG000018456.1 (SMESG000018456.1)

HSP 1 Score: 1855.88 bits (4806), Expect = 0.000e+0
Identity = 958/972 (98.56%), Postives = 959/972 (98.66%), Query Frame = 1
Query:    1 MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQTFFMAILMAGFXXXXXXXXXXXXXXIFEMNMNIFSESKEIILSNESRPLPPEPFYEAIEPQTASSQVYNSAPVQYQNPNIANSGQEFSGSTQMVNAPKVIGTVSDGMSYVTVSDNQNQSSQQMTSKYRPVQLGYDNYSNIMISGNEIIVPMNANTVYGAPKIIGTETSNEYSLAVSSNMDNDQNTTIPGVVKVNSSSIGGSLNAGNVMMM 2916
            MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCY             TPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFCTIPTCQQTPPLPPLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISP+FMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQTFFMAILMAGFVTVATLSLTSTTMAIFEMNMNIFSESKEIILSNESRPLPPEPFYEAIEPQTASSQVYNSAPVQYQNPNIANSGQEFSGSTQMVNAPKVIGTVSDGMSYVTVSDNQNQSSQQMTSKYRPVQLGYDNYSNIMISGNEIIVPMNANTVYGAPKIIGTETSNEYSLAVSSNMDNDQNTTIPGVVKVNSSSIGGSLNAGNVMMM
Sbjct:  195 MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCY-------------TPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFCTIPTCQQTPPLPPLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGVCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPTFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPINTFQTFFMAILMAGFVTVATLSLTSTTMAIFEMNMNIFSESKEIILSNESRPLPPEPFYEAIEPQTASSQVYNSAPVQYQNPNIANSGQEFSGSTQMVNAPKVIGTVSDGMSYVTVSDNQNQSSQQMTSKYRPVQLGYDNYSNIMISGNEIIVPMNANTVYGAPKIIGTETSNEYSLAVSSNMDNDQNTTIPGVVKVNSSSIGGSLNAGNVMMM 1153          

HSP 2 Score: 246.128 bits (627), Expect = 3.651e-66
Identity = 218/708 (30.79%), Postives = 322/708 (45.48%), Query Frame = 1
Query:  202 LPDASLSDASNYCRNPDNDTVG-----GWCYVTNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSK---GSIYTNANFP--ENSIANANNYCRNPTNNTGGPWCWLQSDLNKF----GFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNR---VMCVVPMCN-------------TATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTS----IEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYC---TP------QCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRN-PDSDPLGPWCYLESQVKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT-SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRD-IGYINQPWCYV 2181
             PD S+ +A NYCRNP +  +G      WC++   T     YC  P C+GI  C     G  +QG  S T    TC  WSS+      Y + N+P    +I  A N CRNP N++ G WC+  S    +          T      +      +  AT Q   S V +A      +N +      TT+   NP F  P L   A++++ +NYCRNP+ D  G WCYT       C   +                   G+ Y G +S T K +TC +WSS     + +++FP+ S ANA NYCRN P +N  GP+C++  +      C +P C               ATC++T  G  YAGT AI+ +  PC  WT  +         P  F   ++    NYCR+P+      GP+CYT+    E C I  C   TP       CR +   T+Y G ++ T  G  C  W+   N NF +    + +   +A NYCRN P S+  GP+C++    ++ C +P+C+ T  C T    ++Y G   ++K+G+ CL W++    +   SI P++     PD S   A+NYCR+P+N  +  G P+CY        ++L+    CN++ CT  C   +  + Y G  N T++G  C+ W+     +            LL    +  A NYCR P  D +G    PWCY+
Sbjct:   67 FPDISIQNAQNYCRNPSSP-IGIYEPRPWCWLQADTKSF-GYCTIPSCAGI--CRTTSFGEIFQGTGSKTISGLTCQNWSSQSPHAHSYNSGNWPITGETIVQAGNNCRNPNNSSFGLWCYTTSAFPVWEPCMAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIF-HPALLPDASLSDASNYCRNPDNDTVGGWCYTPCSGIWACLFDR------------------TGSYYQGIVSVTEKNETCAIWSS-KGSIYTNANFPENSIANANNYCRN-PTNNTGGPWCWLQSDLNKFGFCTIPTCQQTPPLPPLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRPILFKTATMAEVANYCRNPN--ADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSA-ANAVNYCRNLPRSNLPGPFCFVGPN-RVMCVVPMCN-TATCRTTVEGYSYAGTQAISKSGLPCLLWTN----ISVTSIEPNY----FPDQSIVAAKNYCRSPSNVLSVDG-PFCY--------TSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGV-CMFWTDPRNINFRN-------PQLLNAAKLEDAANYCRNPDSDPLG----PWCYL 715          

HSP 3 Score: 231.106 bits (588), Expect = 1.808e-61
Identity = 212/683 (31.04%), Postives = 305/683 (44.66%), Query Frame = 1
Query:  352 DRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFPENSIANANNYCRNPTNNTG----GPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLW-------------------SSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCY--TSLTTTETCNISYC--------------TPQCRNSQTATDYAG-IVNRTNSGVCMFWTDPR---NINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPT-------QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCT 2235
            D  G  Y G  S T  N TCA+W++     +   ++ FP+ SI NA NYCRNP++  G     PWCWLQ+D   FG+CTIP+C                 C++T+ G  + GT + T +   C  W++ +   + Y +        T+ +  N CRNPN    G WCYTT+     E C  P C +TT        C   V    +    +T     +C  W                   S + N  F+ +  PD S ++A NYCRN P ++  G +C+          P      C     G  Y G  ++++    C +W++        N FP+ SI  A NYCR+P+N  +  GP+C+  + L     C I  C                 C+++ +  +YAG I   TNS  C  WT      N  F  P L   A + + ANYCRNP++DP GPWCY  +  + YC +P C  T         C T      YTG I+ T  G +C  WS      F+ S   SF     PD S  +A NYCR    +S   G P+C+    +V    +     CN   C +  T E  S Y G    + +G PCL+W+ +++TS+     PNY     PD ++VAA NYCR P+ ++  ++ P+CY S    L+ T   N  +CT
Sbjct:   31 DPLGIEYIGTQS-TSDNGTCAVWTTAAGNVNYLLSSQFPDISIQNAQNYCRNPSSPIGIYEPRPWCWLQADTKSFGYCTIPSCA--------------GICRTTSFGEIFQGTGSKTISGLTCQNWSSQSPHAHSYNSGNWPITGETIVQAGNNCRNPNNSSFGLWCYTTSAFPVWEPCMAPVCKSTT-------GCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRN-PDNDTVGGWCY---------TPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNAN-FPENSIANANNYCRNPTN--NTGGPWCWLQSDLNKFGFCTIPTCQQTPPLPPLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDS---SF-----PDGSAANAVNYCRN-LPRSNLPG-PFCFVGPNRV----MCVVPMCNTATCRT--TVEGYS-YAGTQAISKSGLPCLLWTNISVTSIE----PNY----FPDQSIVAAKNYCRSPS-NVLSVDGPFCYTS----LTTTETCNISYCT 648          

HSP 4 Score: 114.39 bits (285), Expect = 2.766e-25
Identity = 54/57 (94.74%), Postives = 56/57 (98.25%), Query Frame = 2
Query: 3029 MEGSRVDLEGSQEDLEGNLVDLESSREDLEDNLVDWVDKQLDMEGSRVEDLVHLWNM 3199
            +EG+ VDLEGSQEDLEGNLVDLESSREDLEDNLVDWVDKQLDMEGSRVEDLVHLWNM
Sbjct: 1219 LEGNLVDLEGSQEDLEGNLVDLESSREDLEDNLVDWVDKQLDMEGSRVEDLVHLWNM 1275          
BLAST of Plasminogen vs. Planmine SMEST
Match: SMESG000018453.1 (SMESG000018453.1)

HSP 1 Score: 399.823 bits (1026), Expect = 3.229e-126
Identity = 205/304 (67.43%), Postives = 252/304 (82.89%), Query Frame = 1
Query:    1 MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATPTILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKC-FTTTPATITRN 909
            MAPVCKST+ CVNGVTNYLFKSQT+TEQ+L+SCVPW ++PLQY+N ++ P++   S+ VNPIFHPA+LPD S +DASNYCRN DNDTVG WCYV NG  ++KKYCKT CSGIWACL+DR GSYYQG V++T+ N+ CA W+ KGS+YT++NFPENSIANA+NYCRNPTNN GGPWCWLQS++ +FGFC IP CQQ+ PL PLT T+GNATC+ST  G EY G I+ITTN+N CA W  TT+FYNPY+N+P+LF T+TMAEV NYCRNP+ D  GPWCYT +G QEYC +P+C  + T  ++ +N
Sbjct:  195 MAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSN-VNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSNFPENSIANASNYCRNPTNNPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALW-NTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQCNISQTTGSLKKN 496          

HSP 2 Score: 175.252 bits (443), Expect = 3.610e-46
Identity = 152/485 (31.34%), Postives = 222/485 (45.77%), Query Frame = 1
Query:  352 DRTGSYYQGIVSVTEKNETCAIW---SSKGSIYTNANFPENSIANANNYCRNPTNNTG----GPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYT--TTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSV------------------TNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTA-----TCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCY--TSLTTTETCNISYCTPQ--------------CRNSQTATDYAG-IVNRTNSGVCMFW--TDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPTQ 1653
            D  G  Y G  SV++    CA+W   S   +  +++ FP+ SI NA NYCRNP +  G     PWCWLQ++ + FG+CTIP C                 C++T  G  + GTI+ T +   C  W + +   + Y +     +  T+ +  N CRNPN+ P G WC+T  +T   E C  P C +T+       NC   V    +    ST    ++C  W SV                   N  F+ +  PD S A+A NYCRNL    + G +C+V  N  + +   C T       C     G  Y GT  I+ S   C  W N+  +    + FP+ SI  A NYCR+P+N  +  GP+C+  +++T    C I +C                 C+++    +Y G I   TN+  C  W  T   N  +  P L N + + +  NYCRNP +D +GPWCY  S V+ YC +P C+ +Q
Sbjct:   31 DSIGIEYIGNQSVSDIGP-CAMWFNASGNLNYLSSSQFPDTSIQNAKNYCRNPKSPLGVYEPRPWCWLQTNPDTFGYCTIPLCT--------------GICRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPIQGETIDQAGNNCRNPNSSPYGLWCFTNISTPVWEPCMAPVCKSTS-------NCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTV-GAWCYVR-NGDLYIKKYCKTQCSGIWACLYDRIGSYYQGTVNITDSNQACANW-NLKGSLYTDSNFPENSIANASNYCRNPTN--NPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTMGPWCYTMSGVQEYCPVPQCNISQ 488          

HSP 3 Score: 147.517 bits (371), Expect = 6.635e-37
Identity = 122/391 (31.20%), Postives = 174/391 (44.50%), Query Frame = 1
Query: 1177 GYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQSIVAAKNYCRSPSNVLSV--DGPFCY--TSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSG-VCMFW--TDPRNINFRNPQL-LNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIY--CQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYP---------PALFDAS-ISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT---SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCPTAAIINPI 2274
            G  Y G Q++S  G PC +W N S  +  +  + FPD SI  AKNYCR+P + L V    P+C+  T+  T   C I  CT  CRN+     + G +++T SG  C  W    P   ++ +    +    ++ A N CRNP+S P G WC+      ++  C  PVC  T  C      + +    +  +   SC+ W   P         P+L   S ++P F   +LPD S  DA NYCR   N +      WCY     V    L    YC  T C+   +C      S Y G  N T +   C  W+         L G  Y  S  P+N++  A+NYCR PT + G    PWC++       Q+    FGFC I  C  ++ + P+
Sbjct:   34 GIEYIGNQSVSDIG-PCAMWFNASGNLNYLSSSQFPDTSIQNAKNYCRNPKSPLGVYEPRPWCWLQTNPDTFGYCTIPLCTGICRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPIQGETIDQAGNNCRNPNSSPYGLWCFTNISTPVWEPCMAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTV---GAWCY-----VRNGDLYIKKYCK-TQCSGIWACLYDRIGSYYQGTVNITDSNQACANWN---------LKGSLYTDSNFPENSIANASNYCRNPTNNPG---GPWCWL-------QSNITRFGFCRIPFCQQSSPLAPL 395          

HSP 4 Score: 136.732 bits (343), Expect = 2.341e-33
Identity = 131/456 (28.73%), Postives = 189/456 (41.45%), Query Frame = 1
Query:  202 LPDASLSDASNYCRNPDND----TVGGWCYV-TNGTHFLKKYCKTP-CSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKG---SIYTNANFP--ENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFY---------------NPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGN---QEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRV---MCVVPMCNT-------------ATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSI---EPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTTETCNISYCTPQCRNSQT 1425
             PD S+ +A NYCRNP +         WC++ TN   F   YC  P C+GI  C     G  ++G +S T   +TC  W+S+      Y + N+P    +I  A N CRNP ++  G WC+                               + C +  +   +    +       C PW +    Y               NP F  P +    + A+ +NYCRN + D  G WCY   G+   ++YC   +C         R        G+ Y GT++ T     C  W ++    + DS+FP+ S ANA NYCRN P +N  GP+C++  N      C +P C               ATC++T  G  Y G  +I+ +   C LW   S  +    +P  F   ++    NYCR+PSN     GP+CYT     E C +    PQC  SQT
Sbjct:   67 FPDTSIQNAKNYCRNPKSPLGVYEPRPWCWLQTNPDTF--GYCTIPLCTGI--CRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPIQGETIDQAGNNCRNPNSSPYGLWCF------------TNISTPVWEPCMAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIF-HPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKT-QCSGIWACLYDR-------IGSYYQGTVNITDSNQACANW-NLKGSLYTDSNFPENSIANASNYCRN-PTNNPGGPWCWLQSNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNTTSFYNPYYNQPVLFNTSTMAEVFNYCRNPSN--DTMGPWCYTMSGVQEYCPV----PQCNISQT 489          

HSP 5 Score: 135.576 bits (340), Expect = 5.529e-33
Identity = 148/492 (30.08%), Postives = 217/492 (44.11%), Query Frame = 1
Query:  931 GTEYTGTISTTAKGDTCTLWSSVTNGNFN---DSSFPDGSAANAVNYCRNLPRSNL----PGPFCFVGPN---RVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNIS--VTSIEPNYFPDQ--SIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYC--TPQCRN--------SQTATD--------YAGIVNRTNSGVCM-FWTDPRNIN-FRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQ---VKIYCQLPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTIC---------------TSCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVA-ANNYCRVPTRDIGYINQPWCYVS---------PSSVLSQTTG 2214
            G EY G  S +  G  C +W + + GN N    S FPD S  NA NYCRN P+S L    P P+C++  N      C +P+C T  CR T  G ++ GT + + SG  C  W + S    S     +P Q  +I  A N CR+P++  S  G +C+T+++T   E C    C  T  C N        SQT+T+        +  +  + N+   M   +   N+N   +P +L      DA+NYCRN D+D +G WCY+ +    +K YC+   CS    C        Y G +N+T +  +C  W+       D++          P+ S  +A NYCR PTN     G PWC+        S ++ FG+C +  C                +C +      Y G  + T+N   C +W+T      +    P Y   +L + + +A   NYCR P+ D      PWCY           P   +SQTTG
Sbjct:   34 GIEYIGNQSVSDIGP-CAMWFNAS-GNLNYLSSSQFPDTSIQNAKNYCRN-PKSPLGVYEPRPWCWLQTNPDTFGYCTIPLC-TGICRNTYIGETFRGTISKTISGQTCQNWNSQSPHTHSYNSGNWPIQGETIDQAGNNCRNPNS--SPYGLWCFTNISTPVWEPCMAPVCKSTSNCVNGVTNYLFKSQTSTEQFLESCVPWMSVPLQYNNLASMPSLSGGSNVNPIFHPAILPDESFADASNYCRNLDNDTVGAWCYVRNGDLYIKKYCKTQ-CSGIWACLYDRIGSYYQGTVNITDSNQACANWNLKGSLYTDSN---------FPENSIANASNYCRNPTNNP---GGPWCWLQ------SNITRFGFCRIPFCQQSSPLAPLTKTSGNATCKSTAIGGEYGGNISITTNNNTCALWNT------TSFYNPYYNQPVLFNTSTMAEVFNYCRNPSNDTM---GPWCYTMSGVQEYCPVPQCNISQTTG 491          
BLAST of Plasminogen vs. Planmine SMEST
Match: SMESG000026377.1 (SMESG000026377.1)

HSP 1 Score: 100.138 bits (248), Expect = 7.304e-21
Identity = 67/199 (33.67%), Postives = 89/199 (44.72%), Query Frame = 1
Query:  631 CQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPIL-----FKTATMAEVANYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPN--RVMCVVPMCNTATCRTT-VEGYSYAGT 1197
            C+ TT G EY G   ++ N  PC  W         Y N  I+     F T ++ E  NYCRNP   P+GPWC         E+C I  C         RN C+ T  GTEY G ++ T  G  C  W  +   N++++SFP+ S     N CRN   S   GP+CF   +  R  C VP C+    +     GY +  T
Sbjct:   27 CKITTHGREYVGYTNVSKNGRPCLSWK------KEYLNDIIMDDSIYFDTTSIIE-TNYCRNPTNFPNGPWCIVDESILEWEHCHIRSCIKE------RNWCKDTDKGTEYLGDLNFTKTGKICKPW--IIQSNYSENSFPEKSFQLVGNKCRNPDMS--AGPWCFYSDDYKREECEVPRCDEKFSQIEYFGGYDFLKT 208          

HSP 2 Score: 78.1814 bits (191), Expect = 3.601e-14
Identity = 55/172 (31.98%), Postives = 80/172 (46.51%), Query Frame = 1
Query: 1159 CRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSI---EPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYT--SLTTTETCNISYCTPQ---CRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKI-YCQLPVCS 1644
            C+ T  G  Y G   +SK+G PCL W    +  I   +  YF   SI+   NYCR+P+N    +GP+C    S+   E C+I  C  +   C+++   T+Y G +N T +G +C  W    N    +         +   N CRNPD    GPWC+     K   C++P C 
Sbjct:   27 CKITTHGREYVGYTNVSKNGRPCLSWKKEYLNDIIMDDSIYFDTTSIIET-NYCRNPTNF--PNGPWCIVDESILEWEHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPWIIQSN---YSENSFPEKSFQLVGNKCRNPDMSA-GPWCFYSDDYKREECEVPRCD 191          

HSP 3 Score: 68.1662 bits (165), Expect = 3.840e-11
Identity = 55/188 (29.26%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  907 NNCRTTVAGTEYTGTISTTAKGDTCTLWSS--VTNGNFNDSSFPDGSAANAVNYCRNLPRSNLP-GPFCFVGPNRV---MCVVPMCNTAT--CRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFC-YTSLTTTETCNISYCTPQCRNSQTATDYAG 1443
             NC+ T  G EY G  + +  G  C  W    + +   +DS + D ++    NYCRN   +N P GP+C V  + +    C +  C      C+ T +G  Y G    +K+G  C  W  I  ++   N FP++S     N CR+P   +S  GP+C Y+     E C +    P+C    +  +Y G
Sbjct:   25 ENCKITTHGREYVGYTNVSKNGRPCLSWKKEYLNDIIMDDSIYFDTTSIIETNYCRN--PTNFPNGPWCIVDESILEWEHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPW--IIQSNYSENSFPEKSFQLVGNKCRNPD--MSA-GPWCFYSDDYKREECEV----PRCDEKFSQIEYFG 201          

HSP 4 Score: 66.2402 bits (160), Expect = 1.609e-10
Identity = 49/185 (26.49%), Postives = 71/185 (38.38%), Query Frame = 1
Query:  343 CLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSI------ANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWC-YTTTGNQEYCTIPKC 876
            C     G  Y G  +V++    C  W  +   Y N    ++SI          NYCRNPTN   GPWC +   + ++                 +       C+ T  G EY G +  T     C PW   + +    F         +   V N CRNP+   +GPWC Y+    +E C +P+C
Sbjct:   27 CKITTHGREYVGYTNVSKNGRPCLSWKKE---YLNDIIMDDSIYFDTTSIIETNYCRNPTNFPNGPWCIVDESILEW-----------EHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPWIIQSNYSENSFPE------KSFQLVGNKCRNPDM-SAGPWCFYSDDYKREECEVPRC 190          

HSP 5 Score: 63.5438 bits (153), Expect = 9.954e-10
Identity = 51/197 (25.89%), Postives = 79/197 (40.10%), Query Frame = 1
Query: 1348 FCYTSLTTTETCNISYCTP--QCRNSQTATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNAAKLEDA----------ANYCRNPDSDPLGPWCYLESQVK--IYCQLPVCSPTQG-CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSE 1890
            F  T+L    +  +SY T    C+ +    +Y G  N + +G  C+ W           + LN   ++D+           NYCRNP + P GPWC ++  +    +C +  C   +  C   +    Y G++N TK G  C  W           I  ++     P+ S     N CR P      S  PWC+YS+
Sbjct:    5 FLATALLLQSSFILSYFTEIENCKITTHGREYVGYTNVSKNGRPCLSW---------KKEYLNDIIMDDSIYFDTTSIIETNYCRNPTNFPNGPWCIVDESILEWEHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPW----------IIQSNYSENSFPEKSFQLVGNKCRNPD----MSAGPWCFYSD 178          

HSP 6 Score: 58.9214 bits (141), Expect = 2.512e-8
Identity = 65/247 (26.32%), Postives = 95/247 (38.46%), Query Frame = 1
Query:  226 ASNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPCSGIWACLFDR-------TGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFXXXXXXXXXXXXXXXXXXAGNATCQSTTSGVEYAG----------TIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATITRNNC 915
             +NYCRNP N   G WC + + +    ++C      I +C+ +R        G+ Y G ++ T+  + C  W  + + Y+  +FPE S     N CRNP + + GPWC+   D  +                          C    S +EY G           I   T ++ C   T T TF     N  IL KT+  A   N           P C T     EYCTI +   T+ + I   +C
Sbjct:   75 ETNYCRNPTNFPNGPWC-IVDESILEWEHCH-----IRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPWIIQSN-YSENSFPEKSFQLVGNKCRNP-DMSAGPWCFYSDDYKR-------------------EECEVPRCDEKFSQIEYFGGYDFLKTISSLITTITLTDICQTVTVTVTFNLESLNSDILRKTSLWATDYN-----------PKCQTDLDEYEYCTIVESKNTSKSYIISYSC 283          

HSP 7 Score: 56.6102 bits (135), Expect = 1.235e-7
Identity = 51/189 (26.98%), Postives = 72/189 (38.10%), Query Frame = 1
Query: 1630 LPVCSPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS----CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVS 2184
            L   +  + C    +   Y G  NV+KNG  CL W      L D  +  S    +  D ++    NYCR PTN   +   PWC      V+ S L +  +C++  C      C   +  + Y G  N T  G  C  W          +   NY  +  P+ +     N CR P    G    PWC+ S
Sbjct:   18 LSYFTEIENCKITTHGREYVGYTNVSKNGRPCLSWK--KEYLNDIIMDDS----IYFDTTSIIETNYCRNPTN---FPNGPWCI-----VDESILEW-EHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPW----------IIQSNYSENSFPEKSFQLVGNKCRNPDMSAG----PWCFYS 177          
BLAST of Plasminogen vs. Planmine SMEST
Match: SMESG000026302.1 (SMESG000026302.1)

HSP 1 Score: 97.0561 bits (240), Expect = 4.989e-20
Identity = 76/265 (28.68%), Postives = 107/265 (40.38%), Query Frame = 1
Query:  625 ATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVANYCRNPNADPSGPWCYT--TTGNQEYCTIPKCFTTTPATITRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSI---VAAKNYCRSPSNVLSVDG----PFCYTSLTTTETCNIS 1392
            A C+ T+ G EY GT+  T +   C  WT           R +L     M    NYCRN N DP GPWC T   T   EYC IP C          N C+ ++ G EY G I+ T  G+ C LW+      + +S+ P+ S   A NYCR+L       P C +           C+   C   +    Y G     K      +   +++    PN +   SI   +  K +  +  + +++ G    P C   L   E C IS
Sbjct:   25 AKCKLTSHGSEYIGTVNKTLSGKLCTKWTADLVKNFKLNERNLL--DLNMVSPHNYCRNYNLDPKGPWCATGEETLKWEYCNIPSCKKEN------NWCKDSIIGREYLGIINVTISGEKCLLWTP--RNWYKESNLPEKSRELAKNYCRSLGNHK-EEPVCIIAKQPFW---EKCHVTLCEKELTQSEYFGGSDFLKH-----MAGELNIIRF-PNVYKYASIKISIEIKKWTLNNKSKMALWGTEYDPLCQRDLDEYEYCEIS 269          

HSP 2 Score: 83.5741 bits (205), Expect = 6.719e-16
Identity = 59/188 (31.38%), Postives = 89/188 (47.34%), Query Frame = 1
Query:  910 NCRTTVAGTEYTGTISTTAKGDTCTLWSS--VTNGNFNDSSFPDGSAANAVNYCRNLPRSNL--PGPFCFVGPNRVM---CVVPMCNTAT--CRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT-ETCNISYCTPQCRNSQTATDYAG 1443
             C+ T  G+EY GT++ T  G  CT W++  V N   N+ +  D +  +  NYCRN    NL   GP+C  G   +    C +P C      C+ ++ G  Y G   ++ SG  CLLWT       + +  P++S   AKNYCRS  N    + P C  +     E C+++ C  +     T ++Y G
Sbjct:   26 KCKLTSHGSEYIGTVNKTLSGKLCTKWTADLVKNFKLNERNLLDLNMVSPHNYCRNY---NLDPKGPWCATGEETLKWEYCNIPSCKKENNWCKDSIIGREYLGIINVTISGEKCLLWT--PRNWYKESNLPEKSRELAKNYCRSLGN--HKEEPVCIIAKQPFWEKCHVTLCEKEL----TQSEYFG 202          

HSP 3 Score: 74.7146 bits (182), Expect = 3.939e-13
Identity = 64/195 (32.82%), Postives = 85/195 (43.59%), Query Frame = 1
Query: 1405 QCRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDA-----ANYCRNPDSDPLGPWCYL-ESQVK-IYCQLPVCSPTQG-CYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTSCYT 1962
            +C+ +   ++Y G VN+T SG +C  WT     NF+    LN   L D       NYCRN + DP GPWC   E  +K  YC +P C      C        Y G INVT +G  CL W+  P   +  S         LP+ S   A+NYCR+  N             EP    +   F+  C+VT+C    T
Sbjct:   26 KCKLTSHGSEYIGTVNKTLSGKLCTKWTADLVKNFK----LNERNLLDLNMVSPHNYCRNYNLDPKGPWCATGEETLKWEYCNIPSCKKENNWCKDSIIGREYLGIINVTISGEKCLLWT--PRNWYKESN--------LPEKSRELAKNYCRSLGNHK----------EEPVCIIAKQPFWEKCHVTLCEKELT 196          

HSP 4 Score: 70.0922 bits (170), Expect = 1.006e-11
Identity = 56/161 (34.78%), Postives = 79/161 (49.07%), Query Frame = 1
Query: 1153 ATCRTTVEGYSYAGTQAISKSGLPCLLWTNISVTSIEPNY--FPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQ---CRNSQTATDYAGIVNRTNSG-VCMFWTDPRNINFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQ 1611
            A C+ T  G  Y GT   + SG  C  WT   V + + N     D ++V+  NYCR+ +  L   GP+C T   T   E CNI  C  +   C++S    +Y GI+N T SG  C+ WT PRN  ++   L   ++ E A NYCR+  +    P C +  Q
Sbjct:   25 AKCKLTSHGSEYIGTVNKTLSGKLCTKWTADLVKNFKLNERNLLDLNMVSPHNYCRNYN--LDPKGPWCATGEETLKWEYCNIPSCKKENNWCKDSIIGREYLGIINVTISGEKCLLWT-PRNW-YKESNLPEKSR-ELAKNYCRSLGNHKEEPVCIIAKQ 180          

HSP 5 Score: 60.4622 bits (145), Expect = 9.806e-9
Identity = 45/127 (35.43%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  163 TSDIV-NPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHFLK-KYCKTPC---SGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWC 528
            T+D+V N   +   L D ++    NYCRN + D  G WC    G   LK +YC  P       W C     G  Y GI++VT   E C +W+ + + Y  +N PE S   A NYCR+  N+   P C
Sbjct:   53 TADLVKNFKLNERNLLDLNMVSPHNYCRNYNLDPKGPWC--ATGEETLKWEYCNIPSCKKENNW-CKDSIIGREYLGIINVTISGEKCLLWTPR-NWYKESNLPEKSRELAKNYCRSLGNHKEEPVC 175          
BLAST of Plasminogen vs. Planmine SMEST
Match: SMESG000026283.1 (SMESG000026283.1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.184e-19
Identity = 63/203 (31.03%), Postives = 90/203 (44.33%), Query Frame = 1
Query:  625 ATCQSTTSGVEYAGTIAITTNSNPCAPWXXXXXFYNPYFNRPILFKTATMAEVA-----NYCRNPNADPSGPWCYTTTG--NQEYCTIPKCFTTTPATITRNN-CRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAANAVNYCRNLPRSNLPGPFCFVGPNRVM---CVVPMCNTATCRTT-VEGYSYAGT 1197
              C+ T+ G EY G +  T +   C  WT           R +  +     ++      N+CRNPN  P GPWC T       E+C IP C       +  NN C+ T  G EY G+++ T  G  C LWS      F  ++FP+ S  NA N+CR+ P     GP+C+V  + +    C VP C  +  +     GY +  T
Sbjct:   33 KKCKITSHGSEYVGNVEKTFSGKKCIKWTIELL-------RRLNLEEKHFLDLESVSPHNFCRNPNLYPKGPWCVTDEKALQWEHCDIPLC-------VKDNNWCKDTAEGQEYFGSLNLTESGKDCKLWS--LQNKFPANAFPEMSLQNAENHCRS-PDGYSKGPWCYVDDSNIKWDNCYVPQCEISFSQIEYFGGYDFLKT 218          

HSP 2 Score: 76.6406 bits (187), Expect = 9.112e-14
Identity = 56/177 (31.64%), Postives = 84/177 (47.46%), Query Frame = 1
Query: 1153 ATCRTTVEGYSYAGTQAISKSGLPCLLWT--NISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPFCYTSLTTT--ETCNISYCTPQ---CRNSQTATDYAGIVNRTNSGV-CMFWTDPRNINFRNPQLLNA---AKLEDAANYCRNPDSDPLGPWCYL-ESQVKIY-CQLPVCS 1644
              C+ T  G  Y G    + SG  C+ WT   +   ++E  +F D   V+  N+CR+P+  L   GP+C T       E C+I  C      C+++    +Y G +N T SG  C  W+       +N    NA     L++A N+CR+PD    GPWCY+ +S +K   C +P C 
Sbjct:   33 KKCKITSHGSEYVGNVEKTFSGKKCIKWTIELLRRLNLEEKHFLDLESVSPHNFCRNPN--LYPKGPWCVTDEKALQWEHCDIPLCVKDNNWCKDTAEGQEYFGSLNLTESGKDCKLWS------LQNKFPANAFPEMSLQNAENHCRSPDGYSKGPWCYVDDSNIKWDNCYVPQCE 201          

HSP 3 Score: 66.6254 bits (161), Expect = 1.083e-10
Identity = 45/189 (23.81%), Postives = 76/189 (40.21%), Query Frame = 1
Query: 1642 SPTQGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLPDASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICTS----CYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPDNTVVAANNYCRVPTRDIGYINQPWCYVSPSSV 2196
            +  + C   ++   Y GN+  T +G  C+KW+       +     +   +   D  +    N+CR P   + Y   PWC   E  +       + +C++ +C      C        Y G  N T +G  C +WS  N           + ++  P+ ++  A N+CR P    GY   PWCYV  S++
Sbjct:   30 TEIKKCKITSHGSEYVGNVEKTFSGKKCIKWT------IELLRRLNLEEKHFLDLESVSPHNFCRNP---NLYPKGPWCVTDEKALQ------WEHCDIPLCVKDNNWCKDTAEGQEYFGSLNLTESGKDCKLWSLQN----------KFPANAFPEMSLQNAENHCRSPD---GYSKGPWCYVDDSNI 190          

HSP 4 Score: 65.0846 bits (157), Expect = 3.073e-10
Identity = 38/107 (35.51%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  229 SNYCRNPDNDTVGGWCYVTNGTHFLKKYCKTPC---SGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNANFPENSIANANNYCRNPTNNTGGPWCWLQS 540
             N+CRNP+    G WC VT+      ++C  P       W C     G  Y G +++TE  + C +WS +     NA FPE S+ NA N+CR+P   + GPWC++  
Sbjct:   84 HNFCRNPNLYPKGPWC-VTDEKALQWEHCDIPLCVKDNNW-CKDTAEGQEYFGSLNLTESGKDCKLWSLQNKFPANA-FPEMSLQNAENHCRSPDGYSKGPWCYVDD 187          
The following BLAST results are available for this feature:
BLAST of Plasminogen vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPA2.315e-3225.31lipoprotein(a) [Source:HGNC Symbol;Acc:HGNC:6667][more]
PLG5.445e-2928.07plasminogen [Source:HGNC Symbol;Acc:HGNC:9071][more]
HGF6.952e-2630.36hepatocyte growth factor [Source:HGNC Symbol;Acc:H... [more]
HGF1.047e-2530.25hepatocyte growth factor [Source:HGNC Symbol;Acc:H... [more]
MST11.616e-2430.03macrophage stimulating 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Plasminogen vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cam-13.845e-939.74Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.020e-939.74Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-14.116e-939.74Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Plasminogen vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plasminogen vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plg1.327e-3329.74plasminogen [Source:ZFIN;Acc:ZDB-GENE-030131-1411][more]
mst14.030e-2830.46macrophage stimulating 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
hgfa2.492e-2529.17hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GE... [more]
hgfa3.153e-2529.17hepatocyte growth factor a [Source:ZFIN;Acc:ZDB-GE... [more]
hgfb1.075e-2227.70hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Plasminogen vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000037804.11.621e-3531.00plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000037863.12.021e-3330.37plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000025429.12.607e-3330.06plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000025361.16.386e-3330.00plasminogen [Source:NCBI gene;Acc:100496227][more]
ENSXETT00000025386.11.268e-3230.44plasminogen [Source:NCBI gene;Acc:100496227][more]
back to top
BLAST of Plasminogen vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plg1.896e-3028.52plasminogen [Source:MGI Symbol;Acc:MGI:97620][more]
Mst17.949e-2830.68macrophage stimulating 1 (hepatocyte growth factor... [more]
Hgf4.990e-2729.91hepatocyte growth factor [Source:MGI Symbol;Acc:MG... [more]
Hgf4.990e-2729.91hepatocyte growth factor [Source:MGI Symbol;Acc:MG... [more]
Hgf2.077e-2629.63hepatocyte growth factor [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Plasminogen vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18783|PLMN_MACEU1.008e-3828.85Plasminogen OS=Macropus eugenii OX=9315 GN=PLG PE=... [more]
sp|Q01177|PLMN_RAT4.331e-3629.59Plasminogen OS=Rattus norvegicus OX=10116 GN=Plg P... [more]
sp|P06867|PLMN_PIG1.942e-3429.86Plasminogen OS=Sus scrofa OX=9823 GN=PLG PE=1 SV=3[more]
sp|Q29485|PLMN_ERIEU5.468e-3428.51Plasminogen OS=Erinaceus europaeus OX=9365 GN=PLG ... [more]
sp|P06868|PLMN_BOVIN1.760e-3328.60Plasminogen OS=Bos taurus OX=9913 GN=PLG PE=1 SV=2[more]
back to top
BLAST of Plasminogen vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIL49.988e-12268.99Plasminogen-1 (Fragment) OS=Schmidtea mediterranea... [more]
A0A1I8H6I23.998e-5031.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H5D32.058e-4930.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
C3Y3G83.498e-4628.39Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A267EUC86.005e-4630.93Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Plasminogen vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000018418.24.401e-2929.32plasminogen [Source:NCBI gene;Acc:103036400][more]
ENSAMXT00000018419.25.115e-2929.32plasminogen [Source:NCBI gene;Acc:103036400][more]
hgfa4.051e-2728.91hepatocyte growth factor-like [Source:NCBI gene;Ac... [more]
hgfa7.663e-2728.91hepatocyte growth factor-like [Source:NCBI gene;Ac... [more]
hgfb7.807e-2528.10hepatocyte growth factor [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Plasminogen vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hgfb2.879e-2229.71hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000003778.13.877e-1232.18pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 g... [more]
ENSPMAT00000001728.14.499e-1025.42pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 ... [more]
back to top
BLAST of Plasminogen vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Plasminogen vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO289264.937e-836.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397631.980e-735.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439931.279e-631.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO301934.651e-632.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plasminogen vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mst11.402e-2731.35hepatocyte growth factor-like protein [Source:NCBI... [more]
hgfb4.384e-2128.23hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
hgfb4.827e-2128.23hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
f24.213e-1331.68prothrombin [Source:NCBI gene;Acc:101170246][more]
f24.533e-1333.13prothrombin [Source:NCBI gene;Acc:101170246][more]
back to top
BLAST of Plasminogen vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018456.13.651e-6698.56SMESG000018456.1[more]
SMESG000018453.13.229e-12667.43SMESG000018453.1[more]
SMESG000026377.17.304e-2133.67SMESG000026377.1[more]
SMESG000026302.14.989e-2028.68SMESG000026302.1[more]
SMESG000026283.11.184e-1931.03SMESG000026283.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033477 ID=SMED30033477|Name=Plasminogen|organism=Schmidtea mediterranea sexual|type=transcript|length=3746bp
ATGGCACCAGTTTGTAAATCAACAACTGGATGTGTAAATGGAGTTACAAA
TTATTTATTCAAATCGCAAACTGCAACTGAACAATACCTACAAAGTTGTG
TTCCATGGGCAAACATTCCTCTACAATATAGCAACCAGTCTGCAACACCA
ACCATTCTTACTACTTCGGATATTGTCAATCCAATTTTTCATCCAGCACT
ACTTCCAGATGCAAGTCTTTCCGATGCCAGCAATTATTGTAGAAATCCAG
ACAACGATACAGTCGGAGGATGGTGCTATGTAACGAACGGAACACATTTT
TTAAAAAAATACTGCAAGACTCCGTGCTCGGGAATTTGGGCTTGTTTATT
TGATAGAACTGGATCATATTATCAAGGAATCGTAAGTGTGACTGAAAAGA
ATGAAACATGTGCGATTTGGTCATCCAAAGGCTCAATTTATACAAATGCT
AATTTCCCAGAAAATTCAATCGCTAACGCAAACAATTATTGCAGAAATCC
TACAAACAATACTGGAGGACCTTGGTGCTGGCTGCAGAGTGATCTAAATA
AATTTGGGTTTTGTACAATACCAACTTGCCAACAAACCCCACCACTGCCA
CCATTGACAACCACTGCAGGAAATGCTACTTGCCAGTCAACAACTTCTGG
TGTGGAATATGCTGGGACTATAGCAATCACAACGAACTCAAACCCTTGTG
CACCATGGACTACGACGACAACATTTTACAATCCTTATTTCAACAGACCT
ATACTATTTAAAACGGCGACTATGGCCGAAGTTGCAAACTATTGTAGGAA
TCCAAATGCCGACCCCTCAGGACCATGGTGCTATACCACAACCGGCAATC
AAGAGTACTGCACTATACCAAAATGCTTCACAACAACGCCAGCTACAATT
ACAAGAAATAATTGTCGAACTACTGTTGCTGGTACTGAGTACACTGGTAC
CATCAGTACAACAGCTAAGGGTGATACCTGCACTTTATGGAGTTCTGTAA
CGAATGGTAATTTCAATGACAGTTCTTTTCCAGACGGCTCAGCTGCCAAT
GCTGTTAACTATTGCAGAAATCTTCCAAGAAGCAATTTACCAGGTCCTTT
TTGTTTCGTTGGACCGAATAGAGTTATGTGTGTAGTTCCAATGTGCAATA
CCGCAACGTGTCGCACAACGGTTGAAGGCTACTCATACGCAGGAACGCAG
GCTATATCAAAAAGCGGATTGCCCTGTTTGCTTTGGACAAATATAAGTGT
TACTTCAATTGAACCAAATTATTTTCCGGATCAAAGCATTGTTGCTGCTA
AAAATTATTGCAGAAGTCCTTCTAATGTACTTTCCGTTGATGGTCCGTTT
TGCTACACCTCATTAACAACAACGGAAACATGCAACATAAGCTATTGTAC
ACCCCAATGTCGAAATAGTCAAACAGCAACAGATTACGCAGGAATCGTCA
ACAGGACCAACTCTGGAGTCTGCATGTTCTGGACTGATCCACGAAATATT
AATTTCAGAAATCCTCAGCTGCTAAATGCTGCAAAACTAGAAGATGCTGC
TAATTATTGCCGCAACCCCGACAGCGATCCCTTAGGGCCATGGTGTTATC
TTGAATCTCAAGTAAAAATCTATTGTCAACTACCAGTTTGTTCCCCCACT
CAAGGCTGCTATACGCAAAATAATGCTTGGGCATATACTGGGAACATTAA
TGTCACTAAAAATGGAGTTTCTTGTCTAAAGTGGTCAGACTATCCACCAG
CACTATTTGATGCAAGTATTTCCCCTTCTTTCATGTCACAGCTTCTCCCG
GATGCATCAACGACCGATGCTCAAAATTATTGCAGAACTCCTACAAATCA
ATCAGCATATTCTGGTAGTCCATGGTGCTATTATTCGGAACCTCAGGTCA
ATGGATCCACACTCTCCTTTTTTGGATACTGTAATGTCACAATTTGCACA
TCATGTTATACGTTTGAAAATGTTTCTCGCTACAATGGATTCGCGAATAC
GACATCAAACGGGACCCCTTGTTTAGTGTGGTCAACAATGAATATGACAA
GTTTATCGAAATTATCCGGTCCAAACTATGTTTCAAGTCTTTTACCAGAT
AATACTGTTGTCGCCGCAAATAATTATTGTAGAGTTCCTACAAGAGATAT
TGGGTACATAAATCAGCCATGGTGTTACGTCTCACCGTCTTCAGTGCTCA
GCCAAACAACTGGACAGAATTTCGGGTTTTGTACGATCAATACATGCCCA
ACCGCAGCCATTATCAATCCAATAAACACATTTCAAACATTTTTCATGGC
CATTTTGATGGCCGGATTTGTGACTGTCGCTACACTGAGTTTGACATCAA
CGACAATGGCAATATTTGAGATGAACATGAATATATTTTCTGAGAGTAAA
GAAATAATTTTATCAAACGAAAGTCGACCACTGCCACCAGAGCCCTTTTA
TGAAGCCATTGAGCCTCAAACAGCATCATCACAAGTGTATAATTCAGCTC
CAGTTCAATATCAAAATCCAAATATTGCAAATTCCGGTCAAGAGTTTTCC
GGAAGTACTCAAATGGTCAATGCACCTAAAGTTATTGGAACAGTGTCGGA
TGGAATGAGCTATGTAACAGTTTCGGATAATCAAAATCAATCAAGTCAAC
AAATGACATCAAAATATCGTCCTGTTCAATTAGGGTACGACAATTACAGT
AATATCATGATAAGTGGAAATGAGATCATAGTACCAATGAATGCAAATAC
TGTATATGGAGCTCCAAAGATTATAGGAACGGAAACAAGTAACGAATATT
CACTTGCAGTGTCTTCAAATATGGACAACGATCAAAACACTACAATTCCA
GGTGTAGTTAAGGTTAATTCATCAAGTATAGGAGGATCGCTAAATGCCGG
TAACGTTATGATGATGTCAAGCCAGAGTGGACAATCAGGTGGATATGGAG
GACAGTCTGGTGGATATGGAGGACAAGCAGGTGGATTTGGAGGACAAGCA
GCTGGGTTTGGAGGGCAGTCTGGTGGATATGGAGGGCAGTCGGGTGGATT
TGGAGGGCAGTCAGGAGGATTTGGAGGGCAATCTGGTGGATTTGGAGAGC
AGTCGGGAGGATTTGGAGGACAATCTGGTGGATTGGGTGGACAAGCAGTT
AGATATGGAGGGCAGTCGGGTGGAGGATCTGGTGCATCTGTGGAATATGT
GATAAAGCCAAACGTTACTTCTGGTCTTCAACAAAGTGTTGGACAAGAAT
ATGGGAGTAATGAATCTACGACAGGAACCAAAAATGCTGTCTATTATGAT
ATTAATAATCCAAGTGTAAAATATGAAGTTTTTAATATGTCCGACATTGG
TGGAAGTTCTTCTGGTGGAAATATGCAGAAACGTGTTATTGTAAGTAATC
AGGATCATTCCACGGCTCAATTCAAAGAAACAAGTTTAAGTGGAAATCAA
AATAATCAAGCTGGAAATGCTAGCAGAGCTGAAAAAACAGAAACGCAACA
AGGAACCAATCAAAGCTCACAAAATAAGCTAGGCCAATGAAACCAGATCA
TATTCTTTACTTGATGATTGACAAAATTAGACAGCAATTTAAACAATGAT
TAAACTTGATCAAAACTTTCTGAATTTGGTTTACTTGACATTCTTAGATT
CATTTGTGGCCTTCTATTTAACTCGCTTCATTTACTTTATGCCGAAGGAC
TTTATTGCCAAATGAGATTTATTTATTATAAACACATTCCTCATTA
back to top

protein sequence of SMED30033477-orf-1

>SMED30033477-orf-1 ID=SMED30033477-orf-1|Name=SMED30033477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1180bp
MAPVCKSTTGCVNGVTNYLFKSQTATEQYLQSCVPWANIPLQYSNQSATP
TILTTSDIVNPIFHPALLPDASLSDASNYCRNPDNDTVGGWCYVTNGTHF
LKKYCKTPCSGIWACLFDRTGSYYQGIVSVTEKNETCAIWSSKGSIYTNA
NFPENSIANANNYCRNPTNNTGGPWCWLQSDLNKFGFCTIPTCQQTPPLP
PLTTTAGNATCQSTTSGVEYAGTIAITTNSNPCAPWTTTTTFYNPYFNRP
ILFKTATMAEVANYCRNPNADPSGPWCYTTTGNQEYCTIPKCFTTTPATI
TRNNCRTTVAGTEYTGTISTTAKGDTCTLWSSVTNGNFNDSSFPDGSAAN
AVNYCRNLPRSNLPGPFCFVGPNRVMCVVPMCNTATCRTTVEGYSYAGTQ
AISKSGLPCLLWTNISVTSIEPNYFPDQSIVAAKNYCRSPSNVLSVDGPF
CYTSLTTTETCNISYCTPQCRNSQTATDYAGIVNRTNSGVCMFWTDPRNI
NFRNPQLLNAAKLEDAANYCRNPDSDPLGPWCYLESQVKIYCQLPVCSPT
QGCYTQNNAWAYTGNINVTKNGVSCLKWSDYPPALFDASISPSFMSQLLP
DASTTDAQNYCRTPTNQSAYSGSPWCYYSEPQVNGSTLSFFGYCNVTICT
SCYTFENVSRYNGFANTTSNGTPCLVWSTMNMTSLSKLSGPNYVSSLLPD
NTVVAANNYCRVPTRDIGYINQPWCYVSPSSVLSQTTGQNFGFCTINTCP
TAAIINPINTFQTFFMAILMAGFVTVATLSLTSTTMAIFEMNMNIFSESK
EIILSNESRPLPPEPFYEAIEPQTASSQVYNSAPVQYQNPNIANSGQEFS
GSTQMVNAPKVIGTVSDGMSYVTVSDNQNQSSQQMTSKYRPVQLGYDNYS
NIMISGNEIIVPMNANTVYGAPKIIGTETSNEYSLAVSSNMDNDQNTTIP
GVVKVNSSSIGGSLNAGNVMMMSSQSGQSGGYGGQSGGYGGQAGGFGGQA
AGFGGQSGGYGGQSGGFGGQSGGFGGQSGGFGEQSGGFGGQSGGLGGQAV
RYGGQSGGGSGASVEYVIKPNVTSGLQQSVGQEYGSNESTTGTKNAVYYD
INNPSVKYEVFNMSDIGGSSSGGNMQKRVIVSNQDHSTAQFKETSLSGNQ
NNQAGNASRAEKTETQQGTNQSSQNKLGQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR038178Kringle_sf
IPR000001Kringle
IPR018056Kringle_CS
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0004252serine-type endopeptidase activity
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0007596blood coagulation
GO:0007599hemostasis
GO:0042730fibrinolysis
GO:0048771tissue remodeling
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000001KringleSMARTSM00130KR_2coord: 294..394
e-value: 1.8E-7
score: 31.2
coord: 128..211
e-value: 3.7E-7
score: 28.4
coord: 212..292
e-value: 7.4E-8
score: 34.6
coord: 46..127
e-value: 1.0E-6
score: 24.4
IPR000001KringlePFAMPF00051Kringlecoord: 299..392
e-value: 3.1E-8
score: 33.8
coord: 5..35
e-value: 2.1E-7
score: 31.2
coord: 399..492
e-value: 1.4E-8
score: 34.9
coord: 218..290
e-value: 2.3E-11
score: 43.8
coord: 52..130
e-value: 1.6E-9
score: 37.9
coord: 134..209
e-value: 9.4E-10
score: 38.7
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 212..290
score: 11.011
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 6..35
score: 11.754
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 404..492
score: 13.687
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 54..130
score: 10.982
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 135..213
score: 12.583
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 299..392
score: 15.392
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 215..292
e-value: 3.3E-15
score: 57.9
coord: 398..495
e-value: 1.4E-11
score: 46.2
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 2..40
e-value: 7.4E-10
score: 40.9
coord: 293..397
e-value: 8.5E-14
score: 53.8
coord: 41..131
e-value: 4.7E-14
score: 54.6
coord: 132..214
e-value: 1.4E-13
score: 53.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 863..922
NoneNo IPR availablePANTHERPTHR24261FAMILY NOT NAMEDcoord: 293..691
coord: 135..297
coord: 6..48
coord: 48..126
NoneNo IPR availableTMHMMTMhelixcoord: 507..529
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 262..275
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 7..20
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 134..211
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 52..132
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 398..502
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 296..398
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 219..291
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 5..41