Pre-rRNA-processing protein esf2

Overview
NamePre-rRNA-processing protein esf2
Smed IDSMED30033469
Length (bp)764
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-rRNA-processing protein esf2 (SMED30033469) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-rRNA-processing protein esf2 (SMED30033469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-rRNA-processing protein esf2 (SMED30033469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-rRNA-processing protein esf2 (SMED30033469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30033469h1SMcG0012108 dd_Smed_v4_1929_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Human
Match: ABT1 (activator of basal transcription 1 [Source:HGNC Symbol;Acc:HGNC:17369])

HSP 1 Score: 63.5438 bits (153), Expect = 2.686e-11
Identity = 37/139 (26.62%), Postives = 72/139 (51.80%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSN--------------TQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            +PG+V+L  IP       ++ ++SA+G +GRV+ +  +               +++     Y EGWVEF++   AK  A  L+       ++ P+   + N+K+L  FTWS + +E +  + +   +RLR ++ ++K+E
Sbjct:   44 VPGIVYLGHIPPRFRPLHVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHL-SEHLAFERQVRRQRLRAEVAQAKRE 181          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Celegans
Match: F57B10.8 (pep chromosome:WBcel235:I:6548644:6550447:-1 gene:WBGene00019005.1 transcript:F57B10.8.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B10.8)

HSP 1 Score: 51.2174 bits (121), Expect = 2.006e-7
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGP--IGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTW 349
            GVVF S+IP   NV  ++       P  +GR++L R N   K    +Y EGW+E +  + AK  A++++        K P   ++ NI++L  F W
Sbjct:   82 GVVFFSTIPPKYNVVRMREYFEKRCPGQVGRIFLAR-NKHSKNPQYLYSEGWMELKKKKIAKAIAEQIDNTPIGGKNKDPVSSMLWNIRYLSGFKW 176          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Celegans
Match: F57B10.8 (pep chromosome:WBcel235:I:6548644:6550397:-1 gene:WBGene00019005.1 transcript:F57B10.8.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B10.8)

HSP 1 Score: 51.2174 bits (121), Expect = 2.006e-7
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGP--IGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTW 349
            GVVF S+IP   NV  ++       P  +GR++L R N   K    +Y EGW+E +  + AK  A++++        K P   ++ NI++L  F W
Sbjct:   82 GVVFFSTIPPKYNVVRMREYFEKRCPGQVGRIFLAR-NKHSKNPQYLYSEGWMELKKKKIAKAIAEQIDNTPIGGKNKDPVSSMLWNIRYLSGFKW 176          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Celegans
Match: F57B10.8 (pep chromosome:WBcel235:I:6548644:6550436:-1 gene:WBGene00019005.1 transcript:F57B10.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57B10.8)

HSP 1 Score: 51.2174 bits (121), Expect = 2.006e-7
Identity = 31/96 (32.29%), Postives = 49/96 (51.04%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGP--IGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTW 349
            GVVF S+IP   NV  ++       P  +GR++L R N   K    +Y EGW+E +  + AK  A++++        K P   ++ NI++L  F W
Sbjct:   82 GVVFFSTIPPKYNVVRMREYFEKRCPGQVGRIFLAR-NKHSKNPQYLYSEGWMELKKKKIAKAIAEQIDNTPIGGKNKDPVSSMLWNIRYLSGFKW 176          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Match: CG10993 (gene:FBgn0030524 transcript:FBtr0073837)

HSP 1 Score: 64.6994 bits (156), Expect = 2.750e-12
Identity = 34/104 (32.69%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTI 379
            GV+++S++P  + +  L+ I+  +G IGR +LR     RK    ++ EGWVEF++   AK     LN       KK P+   +  +++LP F W+ + NE + I
Sbjct:   65 GVIYISNLPKHMTLTRLREILGEYGAIGRAFLRSQKLSRKPHNFLFAEGWVEFKSKRVAKQIVPLLNYKQISTHKKSPFYYSLWIMEYLPRFKWARL-NELMNI 167          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Match: CG32708 (gene:FBgn0052708 transcript:FBtr0071286)

HSP 1 Score: 59.6918 bits (143), Expect = 2.420e-10
Identity = 40/145 (27.59%), Postives = 72/145 (49.66%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKV--------VIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKEGREVKGILNYSKFL 475
            G++++S+IP  +NV  L+ I+  +G IGRVYL+       K          + + EGWVEF++   AK     LN       K   +   + ++K+LP F W  +  E +  +     +RL  ++ +++KE    +  L+ S+F+
Sbjct:   74 GIIYISNIPKHMNVTRLREILGEYGAIGRVYLQPEKLSSAKAKKNKRKRYNIHFTEGWVEFKSKRVAKQIVPLLNNKQISGRKTSQFYDSLWSMKYLPRFKWVHL-TERMNYEQAVHKQRLHTEVSQARKETTFFQNNLDKSEFI 217          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Match: CG32706 (gene:FBgn0052706 transcript:FBtr0071287)

HSP 1 Score: 56.9954 bits (136), Expect = 1.680e-9
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTW 349
            GV+ +S+IP  ++   L+ IM+    +GRVY++       K      +GWVEF +   AK  A ELN     + K   + G++  +KFLP F W
Sbjct:   61 GVILISNIPKDMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAKKIALELNNKPITDGKSSRFRGLLWKMKFLPRFKW 154          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Match: CG6999 (gene:FBgn0030085 transcript:FBtr0071288)

HSP 1 Score: 56.6102 bits (135), Expect = 2.543e-9
Identity = 32/94 (34.04%), Postives = 49/94 (52.13%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTW 349
            GV+ +S+IP  ++   L+ IM+    +GRVY++       K      +GWVEF +   AK  A ELN     + K   + G++  +KFLP F W
Sbjct:   61 GVILISNIPKDMDGDCLKEIMNLHSVVGRVYVQPETLSSFKTKKNMRKGWVEFISKSGAKKIALELNNKPITDGKSSRFRGLLWKMKFLPRFKW 154          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Match: CG40813 (gene:FBgn0085521 transcript:FBtr0346695)

HSP 1 Score: 51.9878 bits (123), Expect = 8.886e-8
Identity = 27/92 (29.35%), Postives = 49/92 (53.26%), Query Frame = 2
Query:   83 SSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            S+IP  + +  L+ I+  +G IGR +LR  ++  K   +++ EGWVEF++   AK     LN          P+   + ++++LP F W+ +
Sbjct:   75 SNIPKHMTLTRLREILGEYGGIGRAFLRSQSS--KHHNILFAEGWVEFKSKHVAKQLVLLLNNKQISTRNNSPFYYSLWSMEYLPRFKWARL 164          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Zebrafish
Match: abt1 (activator of basal transcription 1 [Source:ZFIN;Acc:ZDB-GENE-050522-127])

HSP 1 Score: 63.1586 bits (152), Expect = 2.750e-11
Identity = 38/132 (28.79%), Postives = 71/132 (53.79%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSN-------TQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            +PG+V+L  IP  +    ++ ++SA+G IGR++L+  +        +   K   + EGWVEF++   AK  A  L+     N K+  +   + +IK+L  F W  + +E +  +    ++R+R +I ++KKE
Sbjct:   84 VPGIVYLGHIPPRMRPKHMRNLLSAYGEIGRIFLQPEDRCVKRKKKKAGCKSSSFTEGWVEFRDKRVAKRVAASLHNTPMANRKRSRFSSDLWSIKYLHRFQWCHL-SERLAYEQTVYHQRMRTEISQAKKE 214          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Zebrafish
Match: abt1 (activator of basal transcription 1 [Source:ZFIN;Acc:ZDB-GENE-050522-127])

HSP 1 Score: 63.1586 bits (152), Expect = 2.750e-11
Identity = 38/132 (28.79%), Postives = 71/132 (53.79%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSN-------TQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            +PG+V+L  IP  +    ++ ++SA+G IGR++L+  +        +   K   + EGWVEF++   AK  A  L+     N K+  +   + +IK+L  F W  + +E +  +    ++R+R +I ++KKE
Sbjct:   84 VPGIVYLGHIPPRMRPKHMRNLLSAYGEIGRIFLQPEDRCVKRKKKKAGCKSSSFTEGWVEFRDKRVAKRVAASLHNTPMANRKRSRFSSDLWSIKYLHRFQWCHL-SERLAYEQTVYHQRMRTEISQAKKE 214          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Zebrafish
Match: abt1 (activator of basal transcription 1 [Source:ZFIN;Acc:ZDB-GENE-050522-127])

HSP 1 Score: 46.9802 bits (110), Expect = 2.950e-6
Identity = 24/76 (31.58%), Postives = 42/76 (55.26%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSN-------TQRKKKVVIYEEGWVEFQNLEDAKLAAKELN 268
            +PG+V+L  IP  +    ++ ++SA+G IGR++L+  +        +   K   + EGWVEF++   AK  A  L+
Sbjct:   84 VPGIVYLGHIPPRMRPKHMRNLLSAYGEIGRIFLQPEDRCVKRKKKKAGCKSSSFTEGWVEFRDKRVAKRVAASLH 159          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Match: Abt1 (activator of basal transcription 1 [Source:MGI Symbol;Acc:MGI:1353636])

HSP 1 Score: 65.4698 bits (158), Expect = 3.699e-12
Identity = 39/140 (27.86%), Postives = 72/140 (51.43%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVI---------------YEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            +PG+V+L  +P       ++ ++SA+G +GRV+ +  +   K+K                  Y EGWVEF++   AK  A  L+       K+ P+   + N+K+L  FTWS + +E +  + +   +RLR ++ ++K+E
Sbjct:   46 VPGIVYLGHVPPRFRPLHVRNLLSAYGEVGRVFFQAEDHFVKRKKKAAAAAGGKKGAKYSKDYTEGWVEFRDKRVAKRVAASLHNTPMGARKRSPFRYDLWNLKYLHRFTWSHL-SEHLAFERQVRRQRLRAEVAQAKRE 184          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Match: Gm4064 (predicted gene 4064 [Source:MGI Symbol;Acc:MGI:3782239])

HSP 1 Score: 53.9138 bits (128), Expect = 6.526e-8
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVF 280
            M E D PG +F+  +        LQ I   FGP+ RV L R    +K +   +    + F+ L DAK A KE+NGV+ 
Sbjct:    1 MAETDQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAF----LTFRRLADAKNAVKEMNGVIL 74          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Match: Gm10352 (predicted gene 10352 [Source:MGI Symbol;Acc:MGI:3708825])

HSP 1 Score: 53.5286 bits (127), Expect = 7.025e-8
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVF 280
            M E D PG +F+  +        LQ I   FGP+ RV L R    +K +   +    + F+ L DAK A KE+NGV+ 
Sbjct:    1 MAETDQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAF----LTFRRLADAKNAVKEMNGVIL 74          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Match: Gm10352 (predicted gene 10352 [Source:MGI Symbol;Acc:MGI:3708825])

HSP 1 Score: 53.5286 bits (127), Expect = 7.025e-8
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVF 280
            M E D PG +F+  +        LQ I   FGP+ RV L R    +K +   +    + F+ L DAK A KE+NGV+ 
Sbjct:    1 MAETDQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAF----LTFRRLADAKNAVKEMNGVIL 74          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Match: Gm10256 (predicted gene 10256 [Source:MGI Symbol;Acc:MGI:3710530])

HSP 1 Score: 53.5286 bits (127), Expect = 7.025e-8
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVF 280
            M E D PG +F+  +        LQ I   FGP+ RV L R    +K +   +    + F+ L DAK A KE+NGV+ 
Sbjct:    1 MAETDQPGKIFIGGLNIKTRQKTLQEIFGRFGPVARVILMRDRETKKSRGFAF----LTFRRLADAKNAVKEMNGVIL 74          
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Match: sp|Q6FWS2|ESF2_CANGA (Pre-rRNA-processing protein ESF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=ESF2 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.466e-18
Identity = 42/105 (40.00%), Postives = 61/105 (58.10%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKK--------KVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            GVV+LS IP  +  A ++ I+S FG I R++L+R +  + K        K ++YEEGW EF    DAKL A+ LNG +    K   +   I N+K+LP F W+D+
Sbjct:  114 GVVYLSRIPPYMKPAKMRQILSRFGEIDRLFLKREDEAKHKQRTRGGGNKKIMYEEGWAEFIRKRDAKLCAETLNGNIIGGKKGSFYHDDILNVKYLPGFKWADL 218          
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Match: sp|P53743|ESF2_YEAST (Pre-rRNA-processing protein ESF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESF2 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 9.190e-17
Identity = 40/105 (38.10%), Postives = 61/105 (58.10%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVI--------YEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            GVV+ SSIP  +  A ++ I++ FG + R++L++ + Q+ K+ V         YEEGW EF    DAKL A+ LNG +    K   +   I N+K+LP F W+D+
Sbjct:  114 GVVYFSSIPPYMKPAKMRQILTRFGEVDRLFLKKEDDQKYKQRVKGGGNKKNKYEEGWAEFIRKRDAKLCAETLNGNIIGGKKGTFYHDDILNVKYLPGFKWADL 218          
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Match: sp|Q6CSP8|ESF2_KLULA (Pre-rRNA-processing protein ESF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=ESF2 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.426e-15
Identity = 37/105 (35.24%), Postives = 60/105 (57.14%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVV--------IYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            GVV+LS +P  +  A L+ I++ FG + R++L+R    + ++ V        ++EEGW EF   +DAKL A  LNG +    K   +   + N+K+LP F W+D+
Sbjct:   91 GVVYLSRVPPYMKPAKLRQILTRFGEVDRLFLKREEEHKHQQRVKSGGNKKTMFEEGWAEFIRKKDAKLCASTLNGNIIGGKKGNFYHDDVMNVKYLPGFKWADL 195          
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Match: sp|Q75DA3|ESF2_ASHGO (Pre-rRNA-processing protein ESF2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=ESF2 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.656e-15
Identity = 59/198 (29.80%), Postives = 103/198 (52.02%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRR----SNTQRKK----KVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKEGREVKGILNYSKFLNS-----RKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYT--VSSVVHN 613
            GVV+LS IP  +  A ++ I+S FG + R++L+R    S+ QR K    K V++ EGW EF   +DAKL A+ LNG +    K   +   + N+K+L  F W+D+  E++  +      +L+ +I ++ K   E    +  SK LN+      K ED +    +H      +    + +  + +++P +  +S+V+HN
Sbjct:  116 GVVYLSKIPPYMKPAKMRQILSRFGDLDRLFLKREDEHSHRQRVKGGGNKKVMFREGWAEFIRKKDAKLCAETLNGNIIGGKKGNFYHDDVMNVKYLSGFKWADL-TEQIARENDVRQSKLQLEISQANKLNAEFIRNVEKSKMLNNIRAKKHKDEDSSERTESHLPVKQRKVTSNRASAPESQKQPASEKLSNVLHN 312          
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Match: sp|Q59YL9|ESF2_CANAL (Pre-rRNA-processing protein ESF2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ESF2 PE=3 SV=2)

HSP 1 Score: 71.2478 bits (173), Expect = 4.030e-13
Identity = 40/105 (38.10%), Postives = 55/105 (52.38%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIY--------EEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            GV +LS +P  +  A L++++S FG I R++L+  +     K V Y         EGW+EF N  DAKL A  LNG      K   +   I NIK+LP F W D+
Sbjct:  124 GVCYLSRVPPYMKPAKLRSVLSRFGEIDRLFLKPEDPSVYHKRVKYGGNKKKNFTEGWIEFVNKSDAKLCAATLNGNKLGGKKTSYYYDDIINIKYLPGFKWLDL 228          
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Match: A0A4S2MCU5 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000936 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.875e-29
Identity = 59/142 (41.55%), Postives = 86/142 (60.56%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKF 472
            ME    PG+++LS+IP G+NV+++  IMS FG +GRVYL    T+R K    Y+EGWVEF N + AK  AK LN    P SK+ PW G + NI++LPD +W+D+   E   + +  +   RDI+ +K+  R+    L  +K 
Sbjct:    6 MESATEPGIIYLSTIPTGMNVSMISDIMSQFGKLGRVYLVPKATKRGK-FRQYDEGWVEFVNKKYAKRVAKNLNCAEVPGSKRNPWFGELWNIRYLPDASWNDLFGAEREEQEQRRSAHDRDILIAKRHARQFTAALEATKL 146          
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Match: G7YTN6 (ESF2/ABP1 family protein OS=Clonorchis sinensis OX=79923 GN=esf2 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 9.221e-29
Identity = 75/211 (35.55%), Postives = 110/211 (52.13%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKF-----------LNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVS---SVVHNPDIAKSLF 637
            ME    PG+++LS+IP G+NV+++  IMS FG +GRVYL    T ++KK   Y+EGWVEF N + AK  AK LN    P SK+ PW G + NI++LPD +W+D+   E   + +  +   RDI+ +K+  R+    L  +K              SR+P D     L      +E    +++ +S   R P   S   S + N D   SLF
Sbjct:    6 MEPATEPGIIYLSTIPTGMNVSMISDIMSQFGKLGRVYLVPKAT-KQKKFRQYDEGWVEFVNKKYAKRVAKNLNCAEVPGSKRNPWFGELWNIRYLPDASWNDLFGAEREEQEQRRSAHDRDILIAKRHARQFTAALEATKLEKKLEVSKGKRFRSRQPID-----LNKRQRLTESEILERLARSH--RTPPEGSSSLSALSNKDFMTSLF 208          
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Match: A0A4S2MJH8 (RRM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000936 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.105e-28
Identity = 75/211 (35.55%), Postives = 109/211 (51.66%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKF-----------LNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVS---SVVHNPDIAKSLF 637
            ME    PG+++LS+IP G+NV+++  IMS FG +GRVYL    T+R K    Y+EGWVEF N + AK  AK LN    P SK+ PW G + NI++LPD +W+D+   E   + +  +   RDI+ +K+  R+    L  +K              SR+P D     L      +E    +++ +S   R P   S   S + N D   SLF
Sbjct:    6 MESATEPGIIYLSTIPTGMNVSMISDIMSQFGKLGRVYLVPKATKRGK-FRQYDEGWVEFVNKKYAKRVAKNLNCAEVPGSKRNPWFGELWNIRYLPDASWNDLFGAEREEQEQRRSAHDRDILIAKRHARQFTAALEATKLEKKLEVSKGKRFRSRQPID-----LNKRQRLTESEILERLARSH--RTPPEGSSSLSALSNKDFMTSLF 208          
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Match: A0A075A7F3 (RRM domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02226 PE=4 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 9.287e-28
Identity = 62/157 (39.49%), Postives = 90/157 (57.32%), Query Frame = 2
Query:   65 PGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKF-----------LNSRKPEDGN 502
            PGV++LS+IP G+NV+++  IMS FG +GRVYL    T+R K    Y+EGWVEF N + AK  AK LN    P SK+ PW G + NI++LPD +W+D+   E   + +  +   RD++ +K+  R+    L  +K              SR+P D N
Sbjct:   12 PGVIYLSTIPTGMNVSMISDIMSQFGKLGRVYLVPKTTKRGK-FRQYDEGWVEFVNKKYAKRVAKNLNCTEVPGSKRNPWFGELWNIRYLPDASWNDLFGAEREEQEQRRSAHDRDVLIAKRHARQFTAALEATKLEKKLEVSKGKRFRSRQPIDLN 167          
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Match: A0A183PNU7 (RRM domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS16033 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.832e-26
Identity = 73/209 (34.93%), Postives = 106/209 (50.72%), Query Frame = 2
Query:   53 EVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKV---VIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKFLNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVS----------SVVHNPDIAKSLFG 640
            E D+PG+++LS+IP G+NV+++  IM  FG IGRVYL      +KKKV     YEEGWVEF N + A+  AK LN      SK+ PW G + NI+FL D +W+D+   E   + +      RDI+ +K + R+    L+  K     K   G        +  +    ++K+T+ + K K    S          S V NP+   SLF 
Sbjct:   13 ESDVPGIIYLSTIPNGMNVSMISDIMQQFGKIGRVYL----VPKKKKVGKYRQYEEGWVEFLNSKIARRVAKRLNCTEVLGSKRNPWFGELWNIRFLKDTSWNDLFGAEREEEEQRRTAHDRDIVVAKHQARQFSAALDAKKLEKKMKQVKGKRFTERKPVRLNR---RQKLTEDEIKEKLAHSSRTPPEGCLGFSAVSNPEFMGSLFA 214          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Cavefish
Match: abt1 (activator of basal transcription 1 [Source:NCBI gene;Acc:103024745])

HSP 1 Score: 62.003 bits (149), Expect = 5.955e-11
Identity = 40/132 (30.30%), Postives = 74/132 (56.06%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLR---RSNTQRKKKV----VIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            +PG+V+L  IP  L    L+ ++ A+G IGR++L+    S T++K+K       + EGWVEF++   AK  A  L+     N K+  +   + ++K+L  F W  + +E +  +    ++R+R +I ++K+E
Sbjct:   80 VPGIVYLGHIPPRLRPKNLRIMLGAYGEIGRIFLQPEDHSVTRKKRKAGNNGKNFIEGWVEFRDKRVAKRVAASLHNTPMTNRKRSQFISDLWSLKYLHRFQWCHL-SERLAYEQTVYHQRMRTEISQAKRE 210          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000251.1 (pep scaffold:Pmarinus_7.0:GL476635:327653:333482:1 gene:ENSPMAG00000000226.1 transcript:ENSPMAT00000000251.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 1.319e-6
Identity = 28/78 (35.90%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  203 YEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKE 433
            Y EGWVEF +   AKLAA  LN       K+  +   + ++K+L  F W+ + +E +  +    N+RLR +I ++KKE
Sbjct:   63 YTEGWVEFVDKRKAKLAAIMLNNNRITTRKRSRFYDDLWSLKYLHRFRWAHL-SERLAYERTVRNQRLRTEIAQAKKE 139          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Yeast
Match: ESF2 (Essential nucleolar protein involved in pre-18S rRNA processing; binds to RNA and stimulates ATPase activity of Dbp8; involved in assembly of the small subunit (SSU) processome [Source:SGD;Acc:S000005337])

HSP 1 Score: 81.6481 bits (200), Expect = 1.323e-18
Identity = 40/105 (38.10%), Postives = 61/105 (58.10%), Query Frame = 2
Query:   68 GVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVI--------YEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDI 358
            GVV+ SSIP  +  A ++ I++ FG + R++L++ + Q+ K+ V         YEEGW EF    DAKL A+ LNG +    K   +   I N+K+LP F W+D+
Sbjct:  114 GVVYFSSIPPYMKPAKMRQILTRFGEVDRLFLKKEDDQKYKQRVKGGGNKKNKYEEGWAEFIRKRDAKLCAETLNGNIIGGKKGTFYHDDILNVKYLPGFKWADL 218          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Nematostella
Match: EDO34990 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS8])

HSP 1 Score: 72.4034 bits (176), Expect = 9.263e-16
Identity = 42/133 (31.58%), Postives = 73/133 (54.89%), Query Frame = 2
Query:   65 PGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVV--------IYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLR-DIIKSKKEG 436
            PG+V+LS +P  +  A ++   S FG +GR++L+  +   +KK           + EGWVEF++   AKL A+ LN       KK  +   I N+K+LP F W  + +E++  +  +  +R+R +I ++KK+ 
Sbjct:   16 PGIVYLSRLPPFMKPAKIRHTFSQFGEVGRLFLQPEDPSVRKKRKKFGGSGKKAFTEGWVEFKDKRIAKLVARSLNNTQIGGKKKSYYHDDIWNVKYLPKFLWGHL-SEKIAFEKAAREQRMRTEISQAKKDA 147          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Medaka
Match: abt1 (activator of basal transcription 1 [Source:NCBI gene;Acc:101157040])

HSP 1 Score: 64.6994 bits (156), Expect = 6.530e-12
Identity = 44/140 (31.43%), Postives = 70/140 (50.00%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQ--RKKK-----VVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILN 460
            +PG+V+L  IP  L    L+ ++S +G IGR++L+  + Q  RKKK        + EGWVEF++   AK  A  L+       K+  +   +  IK+L  F W+ + +E +  +     +RLR  +   K  RE    LN
Sbjct:   60 VPGIVYLGHIPPRLRPKHLRNMLSVYGEIGRIFLQPEDHQVRRKKKKSGLRRCDFTEGWVEFRDKRVAKRVAASLHNTPMGTRKRQRFSSDLWCIKYLHRFQWTHL-SERLAYEQTVLQQRLRTEVSQAK--RETNFYLN 196          
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Medaka
Match: abt1 (activator of basal transcription 1 [Source:NCBI gene;Acc:101157040])

HSP 1 Score: 64.6994 bits (156), Expect = 1.306e-11
Identity = 44/140 (31.43%), Postives = 70/140 (50.00%), Query Frame = 2
Query:   62 IPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQ--RKKK-----VVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILN 460
            +PG+V+L  IP  L    L+ ++S +G IGR++L+  + Q  RKKK        + EGWVEF++   AK  A  L+       K+  +   +  IK+L  F W+ + +E +  +     +RLR  +   K  RE    LN
Sbjct:  191 VPGIVYLGHIPPRLRPKHLRNMLSVYGEIGRIFLQPEDHQVRRKKKKSGLRRCDFTEGWVEFRDKRVAKRVAASLHNTPMGTRKRQRFSSDLWCIKYLHRFQWTHL-SERLAYEQTVLQQRLRTEVSQAK--RETNFYLN 327          
BLAST of Pre-rRNA-processing protein esf2 vs. Planmine SMEST
Match: SMESG000007887.1 (SMESG000007887.1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.117e-146
Identity = 199/199 (100.00%), Postives = 199/199 (100.00%), Query Frame = 2
Query:   47 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKFLNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVSSVVHNPDIAKSLFGI 643
            MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKFLNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVSSVVHNPDIAKSLFGI
Sbjct:    1 MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKVVIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFTWSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKFLNSRKPEDGNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVSSVVHNPDIAKSLFGI 199          
The following BLAST results are available for this feature:
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ABT12.686e-1126.62activator of basal transcription 1 [Source:HGNC Sy... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
F57B10.82.006e-732.29pep chromosome:WBcel235:I:6548644:6550447:-1 gene:... [more]
F57B10.82.006e-732.29pep chromosome:WBcel235:I:6548644:6550397:-1 gene:... [more]
F57B10.82.006e-732.29pep chromosome:WBcel235:I:6548644:6550436:-1 gene:... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG109932.750e-1232.69gene:FBgn0030524 transcript:FBtr0073837[more]
CG327082.420e-1027.59gene:FBgn0052708 transcript:FBtr0071286[more]
CG327061.680e-934.04gene:FBgn0052706 transcript:FBtr0071287[more]
CG69992.543e-934.04gene:FBgn0030085 transcript:FBtr0071288[more]
CG408138.886e-829.35gene:FBgn0085521 transcript:FBtr0346695[more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
abt12.750e-1128.79activator of basal transcription 1 [Source:ZFIN;Ac... [more]
abt12.750e-1128.79activator of basal transcription 1 [Source:ZFIN;Ac... [more]
abt12.950e-631.58activator of basal transcription 1 [Source:ZFIN;Ac... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abt13.699e-1227.86activator of basal transcription 1 [Source:MGI Sym... [more]
Gm40646.526e-835.90predicted gene 4064 [Source:MGI Symbol;Acc:MGI:378... [more]
Gm103527.025e-835.90predicted gene 10352 [Source:MGI Symbol;Acc:MGI:37... [more]
Gm103527.025e-835.90predicted gene 10352 [Source:MGI Symbol;Acc:MGI:37... [more]
Gm102567.025e-835.90predicted gene 10256 [Source:MGI Symbol;Acc:MGI:37... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6FWS2|ESF2_CANGA4.466e-1840.00Pre-rRNA-processing protein ESF2 OS=Candida glabra... [more]
sp|P53743|ESF2_YEAST9.190e-1738.10Pre-rRNA-processing protein ESF2 OS=Saccharomyces ... [more]
sp|Q6CSP8|ESF2_KLULA1.426e-1535.24Pre-rRNA-processing protein ESF2 OS=Kluyveromyces ... [more]
sp|Q75DA3|ESF2_ASHGO2.656e-1529.80Pre-rRNA-processing protein ESF2 OS=Ashbya gossypi... [more]
sp|Q59YL9|ESF2_CANAL4.030e-1338.10Pre-rRNA-processing protein ESF2 OS=Candida albica... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MCU54.875e-2941.55RRM domain-containing protein OS=Opisthorchis feli... [more]
G7YTN69.221e-2935.55ESF2/ABP1 family protein OS=Clonorchis sinensis OX... [more]
A0A4S2MJH81.105e-2835.55RRM domain-containing protein OS=Opisthorchis feli... [more]
A0A075A7F39.287e-2839.49RRM domain-containing protein OS=Opisthorchis vive... [more]
A0A183PNU71.832e-2634.93RRM domain-containing protein OS=Schistosoma matth... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abt15.955e-1130.30activator of basal transcription 1 [Source:NCBI ge... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000251.11.319e-635.90pep scaffold:Pmarinus_7.0:GL476635:327653:333482:1... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ESF21.323e-1838.10Essential nucleolar protein involved in pre-18S rR... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349909.263e-1631.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
abt16.530e-1231.43activator of basal transcription 1 [Source:NCBI ge... [more]
abt11.306e-1131.43activator of basal transcription 1 [Source:NCBI ge... [more]
back to top
BLAST of Pre-rRNA-processing protein esf2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000007887.11.117e-146100.00SMESG000007887.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033469 ID=SMED30033469|Name=Pre-rRNA-processing protein esf2|organism=Schmidtea mediterranea sexual|type=transcript|length=764bp
CTTAAATTTAAAGTTTGTTTAAATAATGCTAAATTAAATATAAATTATGG
AAGAAGTTGATATCCCTGGAGTAGTATTTTTATCATCAATTCCTTATGGA
TTGAATGTAGCACTTTTACAAACAATCATGTCTGCATTTGGACCGATAGG
AAGAGTTTATTTACGTCGTTCAAATACTCAACGTAAAAAGAAAGTTGTTA
TTTACGAAGAAGGCTGGGTGGAGTTTCAAAATCTTGAAGATGCAAAACTT
GCTGCTAAGGAACTAAATGGAGTTGTTTTCCCAAATTCTAAAAAAATGCC
GTGGGAAGGAGTAATTTGTAATATAAAATTTTTACCTGATTTCACATGGT
CCGATATACACAACGAAGAAGTAACTATAAAAGCTAAATCTGGAAACAAA
CGATTGCGAGATATTATAAAATCTAAAAAGGAAGGTAGAGAAGTCAAAGG
AATCTTAAATTATAGCAAATTTTTGAATTCCCGAAAACCAGAAGATGGAA
ATCACACAGTTTTAACCCATGATATTAATTGTAGTGAAGAACCTCCCAAA
AAGAAAGTTACTAAGTCTCAACCAAAACGTAAACCATACACTGTTTCAAG
TGTTGTGCATAATCCAGACATCGCAAAAAGTTTATTTGGAATATAATTTG
TCTACTATTTAAGCAATTAATTAACTTGTTTTACGATGAATAATTCTTAT
AATATTGAAAGTTAAGTCAACAATATTTAAGTATTATGGAGATTTTATAT
TAGGAGGATTAGGG
back to top

protein sequence of SMED30033469-orf-1

>SMED30033469-orf-1 ID=SMED30033469-orf-1|Name=SMED30033469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MEEVDIPGVVFLSSIPYGLNVALLQTIMSAFGPIGRVYLRRSNTQRKKKV
VIYEEGWVEFQNLEDAKLAAKELNGVVFPNSKKMPWEGVICNIKFLPDFT
WSDIHNEEVTIKAKSGNKRLRDIIKSKKEGREVKGILNYSKFLNSRKPED
GNHTVLTHDINCSEEPPKKKVTKSQPKRKPYTVSSVVHNPDIAKSLFGI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR039119ABT1/Esf2
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 10..81
e-value: 4.0E-7
score: 29.8
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 8..84
score: 9.269
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 2..86
e-value: 6.8E-9
score: 37.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..182
NoneNo IPR availablePANTHERPTHR12311:SF7ACTIVATOR OF BASAL TRANSCRIPTION 1coord: 5..131
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
IPR039119ABT1/Esf2PANTHERPTHR12311FAMILY NOT NAMEDcoord: 5..131
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 7..81