Histone H4

Overview
NameHistone H4
Smed IDSMED30033466
Uniprot Best hitHistone H4 OS=Xenopus tropicalis OX=8364 GN=TGas006m08.1 PE=3 SV=1 (E=6.41151e-52)
Length (bp)421
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H4 (SMED30033466) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H4 (SMED30033466) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H4 (SMED30033466) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H4 (SMED30033466) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30033466

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 dd_Smed_v4_6148_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
X2 cellSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 SmedASXL_010948SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN306099ncbi_smed_estsPMID:17376870whole organismjuvenilecolorimetric in situ hybridization evidence
testis primordiumSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN306099ncbi_smed_estsPMID:17376870whole organismjuvenilecolorimetric in situ hybridization evidence
neoblastSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN306099ncbi_smed_estsPMID:17376870whole organismasexual adultcolorimetric in situ hybridization evidence
testis primordiumSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN306099ncbi_smed_estsPMID:17376870whole organismasexual adultcolorimetric in situ hybridization evidence
neoblastSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 KC916777smed_ncbi_20200123PMID:24903754whole organismasexual adultfluorescence in situ hybridization evidence
chromatoid bodySMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 KC916777smed_ncbi_20200123PMID:24903754whole organismasexual adultfluorescence in situ hybridization evidence
testisSMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN297663ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
ovarySMED30033466SMESG000070504.1 SMESG000070501.1 SMESG000011051.1 DN297663ncbi_smed_estsPMID:16344473whole organismadult hermaphroditecolorimetric in situ hybridization evidence
Homology
BLAST of Histone H4 vs. Ensembl Human
Match: H4C9 (H4 clustered histone 9 [Source:HGNC Symbol;Acc:HGNC:4793])

HSP 1 Score: 162.925 bits (411), Expect = 1.335e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 1.335e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 1.335e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C15 (H4 clustered histone 15 [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 1.335e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: H4C14 (H4 clustered histone 14 [Source:HGNC Symbol;Acc:HGNC:4794])

HSP 1 Score: 162.925 bits (411), Expect = 1.335e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-67 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 2.785e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-64 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 2.785e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-60 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 2.785e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-56 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 2.785e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-50 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 2.785e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33899 (gene:FBgn0053899 transcript:FBtr0091903)

HSP 1 Score: 162.925 bits (411), Expect = 7.295e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33897 (gene:FBgn0053897 transcript:FBtr0091901)

HSP 1 Score: 162.925 bits (411), Expect = 7.295e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0334029)

HSP 1 Score: 162.925 bits (411), Expect = 7.295e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0082962)

HSP 1 Score: 162.925 bits (411), Expect = 7.295e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (gene:FBgn0013981 transcript:FBtr0082963)

HSP 1 Score: 162.925 bits (411), Expect = 7.295e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.925 bits (411), Expect = 8.493e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.925 bits (411), Expect = 8.493e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: zgc:153409 (zgc:153409 [Source:ZFIN;Acc:ZDB-GENE-060929-224])

HSP 1 Score: 162.925 bits (411), Expect = 8.493e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.925 bits (411), Expect = 8.493e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: hist1h4l (histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-070927-10])

HSP 1 Score: 162.925 bits (411), Expect = 8.493e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: zbtb22 (zinc finger and BTB domain containing 22 [Source:Xenbase;Acc:XB-GENE-6458515])

HSP 1 Score: 162.925 bits (411), Expect = 1.210e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (histone H4 [Source:NCBI gene;Acc:101732638])

HSP 1 Score: 162.925 bits (411), Expect = 1.210e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (H4 clustered histone 1 [Source:NCBI gene;Acc:549623])

HSP 1 Score: 162.925 bits (411), Expect = 1.210e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: cpa1 (carboxypeptidase A1 [Source:Xenbase;Acc:XB-GENE-960032])

HSP 1 Score: 162.925 bits (411), Expect = 1.210e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (H4 clustered histone 1 [Source:NCBI gene;Acc:549623])

HSP 1 Score: 162.925 bits (411), Expect = 1.210e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c14 (H4 clustered histone 14 [Source:MGI Symbol;Acc:MGI:2140113])

HSP 1 Score: 162.925 bits (411), Expect = 9.166e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c9 (H4 clustered histone 9 [Source:MGI Symbol;Acc:MGI:2448432])

HSP 1 Score: 162.925 bits (411), Expect = 9.166e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4n (histone cluster 1, H4n [Source:MGI Symbol;Acc:MGI:4843992])

HSP 1 Score: 162.925 bits (411), Expect = 9.166e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4m (histone cluster 1, H4m [Source:MGI Symbol;Acc:MGI:2448441])

HSP 1 Score: 162.925 bits (411), Expect = 9.166e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: H4c12 (H4 clustered histone 12 [Source:MGI Symbol;Acc:MGI:2448439])

HSP 1 Score: 162.925 bits (411), Expect = 9.166e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|Q28DR4|H4_XENTR (Histone H4 OS=Xenopus tropicalis OX=8364 GN=TGas006m08.1 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.412e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62799|H4_XENLA (Histone H4 OS=Xenopus laevis OX=8355 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 6.412e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62798|H4_XENBO (Histone H4 OS=Xenopus borealis OX=8354 PE=3 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 6.412e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62794|H4_URECA (Histone H4 OS=Urechis caupo OX=6431 PE=3 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 6.412e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62804|H4_RAT (Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 6.412e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. TrEMBL
Match: gnl|BL_ORD_ID|174651654 (tr|A0A0F8BYJ6|A0A0F8BYJ6_LARCR Histone H4 OS=Larimichthys crocea OX=215358 GN=EH28_09091 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.973e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. TrEMBL
Match: gnl|BL_ORD_ID|167569453 (tr|G5BSF6|G5BSF6_HETGA Histone H4 OS=Heterocephalus glaber OX=10181 GN=GW7_10007 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.371e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   17 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 98          
BLAST of Histone H4 vs. TrEMBL
Match: gnl|BL_ORD_ID|172612981 (tr|A0A3P9L595|A0A3P9L595_ORYLA Histone H4 OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 5.336e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   16 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 97          
BLAST of Histone H4 vs. TrEMBL
Match: gnl|BL_ORD_ID|175451063 (tr|A0A3Q2P121|A0A3Q2P121_FUNHE Histone H4 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.895e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   14 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 95          
BLAST of Histone H4 vs. TrEMBL
Match: gnl|BL_ORD_ID|172616777 (tr|A0A3P9LDN7|A0A3P9LDN7_ORYLA Histone H4 OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.544e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   13 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 94          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000032266.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:10098617:10101488:1 gene:ENSAMXG00000042821.1 transcript:ENSAMXT00000032266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 4.794e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000036719.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:21807:22190:1 gene:ENSAMXG00000036201.1 transcript:ENSAMXT00000036719.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 4.847e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000025764.2 (histone H4 [Source:NCBI gene;Acc:111190747])

HSP 1 Score: 162.925 bits (411), Expect = 7.198e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000025592.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:172325:175033:-1 gene:ENSAMXG00000024866.2 transcript:ENSAMXT00000025592.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.925 bits (411), Expect = 7.305e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   20 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 101          
BLAST of Histone H4 vs. Ensembl Cavefish
Match: ENSAMXT00000043832.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002305.1:155578:160764:1 gene:ENSAMXG00000039753.1 transcript:ENSAMXT00000043832.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 2.304e-52
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEET GVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   27 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETHGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 108          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002372.1 (pep scaffold:Pmarinus_7.0:GL476925:46740:47638:1 gene:ENSPMAG00000002161.1 transcript:ENSPMAT00000002372.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.291e-38
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 361
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002391.1 (pep scaffold:Pmarinus_7.0:GL476925:199603:200503:1 gene:ENSPMAG00000002178.1 transcript:ENSPMAT00000002391.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.291e-38
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 361
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002392.1 (pep scaffold:Pmarinus_7.0:GL476925:215484:216380:1 gene:ENSPMAG00000002179.1 transcript:ENSPMAT00000002392.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.291e-38
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 361
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002394.1 (pep scaffold:Pmarinus_7.0:GL476925:225178:226079:1 gene:ENSPMAG00000002180.1 transcript:ENSPMAT00000002394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.291e-38
Identity = 65/81 (80.25%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFG 361
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT+  +DV     RQ   L+   
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTLVLIDVA----RQNANLHPLN 98          
BLAST of Histone H4 vs. Ensembl Yeast
Match: HHF2 (Histone H4; core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF1); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity [Source:SGD;Acc:S000004975])

HSP 1 Score: 152.14 bits (383), Expect = 1.950e-49
Identity = 74/82 (90.24%), Postives = 79/82 (96.34%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRD+VTYTEHAKRKTVT++DVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Yeast
Match: HHF1 (Histone H4; core histone protein required for chromatin assembly and chromosome function; one of two identical histone proteins (see also HHF2); contributes to telomeric silencing; N-terminal domain involved in maintaining genomic integrity [Source:SGD;Acc:S000000213])

HSP 1 Score: 152.14 bits (383), Expect = 1.950e-49
Identity = 74/82 (90.24%), Postives = 79/82 (96.34%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEE R VLK FLE+VIRD+VTYTEHAKRKTVT++DVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO40764 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.54 bits (410), Expect = 4.210e-53
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO27765 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.54 bits (410), Expect = 4.210e-53
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO38246 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.54 bits (410), Expect = 4.210e-53
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO30153 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.54 bits (410), Expect = 4.210e-53
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Nematostella
Match: EDO46460 (Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0])

HSP 1 Score: 162.54 bits (410), Expect = 4.210e-53
Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            +LRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 ILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000014777.2 (pep primary_assembly:ASM223467v1:14:21234245:21236569:-1 gene:ENSORLG00000027210.1 transcript:ENSORLT00000014777.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 4.764e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   12 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 93          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000000211.2 (histone H4 [Source:NCBI gene;Acc:101170646])

HSP 1 Score: 162.925 bits (411), Expect = 7.153e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000042762.1 (histone H4 [Source:NCBI gene;Acc:101159884])

HSP 1 Score: 162.925 bits (411), Expect = 7.153e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000028618.1 (histone H4 [Source:NCBI gene;Acc:101168421])

HSP 1 Score: 162.925 bits (411), Expect = 7.153e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Medaka
Match: ENSORLT00000043801.1 (histone H4 [Source:NCBI gene;Acc:101172305])

HSP 1 Score: 162.925 bits (411), Expect = 7.153e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000070504.1 (SMESG000070504.1)

HSP 1 Score: 162.925 bits (411), Expect = 5.285e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000070501.1 (SMESG000070501.1)

HSP 1 Score: 162.925 bits (411), Expect = 5.285e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000054351.1 (SMESG000054351.1)

HSP 1 Score: 162.925 bits (411), Expect = 5.285e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000048697.1 (SMESG000048697.1)

HSP 1 Score: 162.925 bits (411), Expect = 5.285e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Planmine SMEST
Match: SMESG000011051.1 (SMESG000011051.1)

HSP 1 Score: 162.925 bits (411), Expect = 5.285e-53
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
The following BLAST results are available for this feature:
BLAST of Histone H4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H4C91.335e-52100.00H4 clustered histone 9 [Source:HGNC Symbol;Acc:HGN... [more]
H4C151.335e-52100.00H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C151.335e-52100.00H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C151.335e-52100.00H4 clustered histone 15 [Source:HGNC Symbol;Acc:HG... [more]
H4C141.335e-52100.00H4 clustered histone 14 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Histone H4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
his-672.785e-5298.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-642.785e-5298.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-602.785e-5298.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-562.785e-5298.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-502.785e-5298.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
back to top
BLAST of Histone H4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
His4:CG338997.295e-53100.00gene:FBgn0053899 transcript:FBtr0091903[more]
His4:CG338977.295e-53100.00gene:FBgn0053897 transcript:FBtr0091901[more]
His4r7.295e-53100.00gene:FBgn0013981 transcript:FBtr0334029[more]
His4r7.295e-53100.00gene:FBgn0013981 transcript:FBtr0082962[more]
His4r7.295e-53100.00gene:FBgn0013981 transcript:FBtr0082963[more]
back to top
BLAST of Histone H4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hist1h4l8.493e-53100.00histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
hist1h4l8.493e-53100.00histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
zgc:1534098.493e-53100.00zgc:153409 [Source:ZFIN;Acc:ZDB-GENE-060929-224][more]
hist1h4l8.493e-53100.00histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
hist1h4l8.493e-53100.00histone 1, H4, like [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
back to top
BLAST of Histone H4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zbtb221.210e-52100.00zinc finger and BTB domain containing 22 [Source:X... [more]
hist1h4c1.210e-52100.00histone H4 [Source:NCBI gene;Acc:101732638][more]
hist1h4c1.210e-52100.00H4 clustered histone 1 [Source:NCBI gene;Acc:54962... [more]
cpa11.210e-52100.00carboxypeptidase A1 [Source:Xenbase;Acc:XB-GENE-96... [more]
hist1h4c1.210e-52100.00H4 clustered histone 1 [Source:NCBI gene;Acc:54962... [more]
back to top
BLAST of Histone H4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
H4c149.166e-53100.00H4 clustered histone 14 [Source:MGI Symbol;Acc:MGI... [more]
H4c99.166e-53100.00H4 clustered histone 9 [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4n9.166e-53100.00histone cluster 1, H4n [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4m9.166e-53100.00histone cluster 1, H4m [Source:MGI Symbol;Acc:MGI:... [more]
H4c129.166e-53100.00H4 clustered histone 12 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Histone H4 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DR4|H4_XENTR6.412e-52100.00Histone H4 OS=Xenopus tropicalis OX=8364 GN=TGas00... [more]
sp|P62799|H4_XENLA6.412e-52100.00Histone H4 OS=Xenopus laevis OX=8355 PE=1 SV=2[more]
sp|P62798|H4_XENBO6.412e-52100.00Histone H4 OS=Xenopus borealis OX=8354 PE=3 SV=2[more]
sp|P62794|H4_URECA6.412e-52100.00Histone H4 OS=Urechis caupo OX=6431 PE=3 SV=2[more]
sp|P62804|H4_RAT6.412e-52100.00Histone H4 OS=Rattus norvegicus OX=10116 GN=H4c2 P... [more]
back to top
BLAST of Histone H4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1746516541.973e-50100.00tr|A0A0F8BYJ6|A0A0F8BYJ6_LARCR Histone H4 OS=Larim... [more]
gnl|BL_ORD_ID|1675694534.371e-50100.00tr|G5BSF6|G5BSF6_HETGA Histone H4 OS=Heterocephalu... [more]
gnl|BL_ORD_ID|1726129815.336e-50100.00tr|A0A3P9L595|A0A3P9L595_ORYLA Histone H4 OS=Oryzi... [more]
gnl|BL_ORD_ID|1754510636.895e-50100.00tr|A0A3Q2P121|A0A3Q2P121_FUNHE Histone H4 OS=Fundu... [more]
gnl|BL_ORD_ID|1726167777.544e-50100.00tr|A0A3P9LDN7|A0A3P9LDN7_ORYLA Histone H4 OS=Oryzi... [more]
back to top
BLAST of Histone H4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032266.14.794e-53100.00pep primary_assembly:Astyanax_mexicanus-2.0:21:100... [more]
ENSAMXT00000036719.14.847e-53100.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000025764.27.198e-53100.00histone H4 [Source:NCBI gene;Acc:111190747][more]
ENSAMXT00000025592.27.305e-53100.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000043832.12.304e-5298.78pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Histone H4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002372.11.291e-3880.25pep scaffold:Pmarinus_7.0:GL476925:46740:47638:1 g... [more]
ENSPMAT00000002391.11.291e-3880.25pep scaffold:Pmarinus_7.0:GL476925:199603:200503:1... [more]
ENSPMAT00000002392.11.291e-3880.25pep scaffold:Pmarinus_7.0:GL476925:215484:216380:1... [more]
ENSPMAT00000002394.11.291e-3880.25pep scaffold:Pmarinus_7.0:GL476925:225178:226079:1... [more]
back to top
BLAST of Histone H4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HHF21.950e-4990.24Histone H4; core histone protein required for chro... [more]
HHF11.950e-4990.24Histone H4; core histone protein required for chro... [more]
back to top
BLAST of Histone H4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407644.210e-5398.78Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO277654.210e-5398.78Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO382464.210e-5398.78Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO301534.210e-5398.78Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
EDO464604.210e-5398.78Histone H4 [Source:UniProtKB/TrEMBL;Acc:A7RJL0][more]
back to top
BLAST of Histone H4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000014777.24.764e-53100.00pep primary_assembly:ASM223467v1:14:21234245:21236... [more]
ENSORLT00000000211.27.153e-53100.00histone H4 [Source:NCBI gene;Acc:101170646][more]
ENSORLT00000042762.17.153e-53100.00histone H4 [Source:NCBI gene;Acc:101159884][more]
ENSORLT00000028618.17.153e-53100.00histone H4 [Source:NCBI gene;Acc:101168421][more]
ENSORLT00000043801.17.153e-53100.00histone H4 [Source:NCBI gene;Acc:101172305][more]
back to top
BLAST of Histone H4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070504.15.285e-53100.00SMESG000070504.1[more]
SMESG000070501.15.285e-53100.00SMESG000070501.1[more]
SMESG000054351.15.285e-53100.00SMESG000054351.1[more]
SMESG000048697.15.285e-53100.00SMESG000048697.1[more]
SMESG000011051.15.285e-53100.00SMESG000011051.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033466 ID=SMED30033466|Name=Histone H4|organism=Schmidtea mediterranea sexual|type=transcript|length=421bp
GATCTCACTATATAAATAAGTATTTGTCCCTATTAATTCATAACAATTAT
TCAACATGTCTGGTCGAGGTAAAGGAGGAAAAGGACTAGGAAAAGGTGGA
GCAAAGCGTCACAGAAAAGTCCTTCGTGATAACATTCAAGGTATCACAAA
GCCAGCAATCAGAAGATTAGCTCGTCGAGGTGGTGTTAAGAGAATTTCTG
GATTGATATATGAAGAAACCCGAGGTGTTCTTAAAGTATTCTTGGAAAAT
GTTATTAGAGACGCTGTGACATACACTGAGCACGCTAAGCGCAAGACAGT
AACTGCCATGGATGTCGTCTATGCTTTGAAACGACAAGGAAGAACTTTGT
ACGGTTTTGGAGGTTAAATAACACTTTCATATTTGTGAATGTTTTAGCGG
CCCTCTTTAGGGCCACAAATG
back to top

protein sequence of SMED30033466-orf-1

>SMED30033466-orf-1 ID=SMED30033466-orf-1|Name=SMED30033466-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007268chemical synaptic transmission
GO:0007411axon guidance
GO:0007420brain development
GO:0009416response to light stimulus
GO:0006352DNA-templated transcription, initiation
GO:0006334nucleosome assembly
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0045202synapse
GO:0000786nucleosome
GO:0005634nucleus
GO:0000788nuclear nucleosome
GO:0005694chromosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0002020chromatoid body
PLANA:0002111X2 cell
PLANA:0003304testis primordium
PLANA:0000058embryonic digestive system
PLANA:0004517blastomere
PLANA:0000211primitive ectoderm cell
PLANA:0000029primitive ectoderm
PLANA:0000023embryonic pharynx
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001951Histone_H4
IPR004823TAF_TATA-bd
IPR009072Histone-fold
IPR019809Histone_H4_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0042393histone binding
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000006Stage 6
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000004Stage 4
PLANA:0000008Stage 8