Histone H4

Overview
NameHistone H4
Smed IDSMED30033466
Uniprot Best hitHistone H4 OS=Xenopus tropicalis GN=TGas006m08.1 PE=3 SV=1 (E=1.54015e-50)
Length (bp)421
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone H4 (SMED30033466) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone H4 (SMED30033466) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone H4 (SMED30033466) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone H4 (SMED30033466) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Histone H4 vs. Ensembl Human
Match: HIST1H4I (histone cluster 1, H4i [Source:HGNC Symbol;Acc:HGNC:4793])

HSP 1 Score: 162.925 bits (411), Expect = 2.997e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: HIST2H4B (histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 2.997e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: HIST2H4B (histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 2.997e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: HIST2H4B (histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGNC:29607])

HSP 1 Score: 162.925 bits (411), Expect = 2.997e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Human
Match: HIST1H4B (histone cluster 1, H4b [Source:HGNC Symbol;Acc:HGNC:4789])

HSP 1 Score: 162.925 bits (411), Expect = 2.997e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-67 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 6.139e-51
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-64 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 6.139e-51
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-60 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 6.139e-51
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-56 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 6.139e-51
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Celegans
Match: his-50 (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P62784])

HSP 1 Score: 160.999 bits (406), Expect = 6.139e-51
Identity = 81/82 (98.78%), Postives = 81/82 (98.78%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTY EHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYCEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33875 (His4:CG33875 [Source:FlyBase gene name;Acc:FBgn0053875])

HSP 1 Score: 162.925 bits (411), Expect = 1.775e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33903 (His4:CG33903 [Source:FlyBase gene name;Acc:FBgn0053903])

HSP 1 Score: 162.925 bits (411), Expect = 1.775e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33871 (His4:CG33871 [Source:FlyBase gene name;Acc:FBgn0053871])

HSP 1 Score: 162.925 bits (411), Expect = 1.775e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4:CG33907 (His4:CG33907 [Source:FlyBase gene name;Acc:FBgn0053907])

HSP 1 Score: 162.925 bits (411), Expect = 1.775e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Fly
Match: His4r (Histone H4 replacement [Source:FlyBase gene name;Acc:FBgn0013981])

HSP 1 Score: 162.925 bits (411), Expect = 1.775e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: HIST1H4J (si:dkey-23a13.15 [Source:ZFIN;Acc:ZDB-GENE-160113-119])

HSP 1 Score: 162.925 bits (411), Expect = 1.760e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: HIST1H4G (si:dkey-23a13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-88])

HSP 1 Score: 162.925 bits (411), Expect = 1.760e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: HIST1H4A (histone cluster 1, H4a [Source:HGNC Symbol;Acc:HGNC:4781])

HSP 1 Score: 162.925 bits (411), Expect = 1.760e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: si:ch1073-35f11.1 (si:ch1073-35f11.1 [Source:ZFIN;Acc:ZDB-GENE-160113-101])

HSP 1 Score: 162.925 bits (411), Expect = 1.760e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Zebrafish
Match: si:dkey-23a13.19 (si:dkey-23a13.19 [Source:ZFIN;Acc:ZDB-GENE-160113-37])

HSP 1 Score: 162.925 bits (411), Expect = 1.760e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR4])

HSP 1 Score: 162.925 bits (411), Expect = 9.468e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR4])

HSP 1 Score: 162.925 bits (411), Expect = 9.468e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR4])

HSP 1 Score: 162.925 bits (411), Expect = 9.468e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR4])

HSP 1 Score: 162.925 bits (411), Expect = 9.468e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Xenopus
Match: hist1h4c (Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR4])

HSP 1 Score: 162.925 bits (411), Expect = 9.468e-52
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4a (histone cluster 1, H4a [Source:MGI Symbol;Acc:MGI:2448419])

HSP 1 Score: 162.925 bits (411), Expect = 1.977e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4b (histone cluster 1, H4b [Source:MGI Symbol;Acc:MGI:2448420])

HSP 1 Score: 162.925 bits (411), Expect = 1.977e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4c (histone cluster 1, H4c [Source:MGI Symbol;Acc:MGI:2448421])

HSP 1 Score: 162.925 bits (411), Expect = 1.977e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist4h4 (histone cluster 4, H4 [Source:MGI Symbol;Acc:MGI:2448443])

HSP 1 Score: 162.925 bits (411), Expect = 1.977e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. Ensembl Mouse
Match: Hist1h4i (histone cluster 1, H4i [Source:MGI Symbol;Acc:MGI:2448432])

HSP 1 Score: 162.925 bits (411), Expect = 1.977e-51
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|Q28DR4|H4_XENTR (Histone H4 OS=Xenopus tropicalis GN=TGas006m08.1 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.540e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62799|H4_XENLA (Histone H4 OS=Xenopus laevis PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.540e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62798|H4_XENBO (Histone H4 OS=Xenopus borealis PE=3 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.540e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62794|H4_URECA (Histone H4 OS=Urechis caupo PE=3 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.540e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. UniProt
Match: sp|P62804|H4_RAT (Histone H4 OS=Rattus norvegicus GN=Hist1h4b PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.540e-50
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   22 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 103          
BLAST of Histone H4 vs. TrEMBL
Match: tr|G5BSF6|G5BSF6_HETGA (Histone H4 OS=Heterocephalus glaber GN=GW7_10007 PE=3 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 4.515e-49
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   17 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 98          
BLAST of Histone H4 vs. TrEMBL
Match: tr|A0A0P5B3P4|A0A0P5B3P4_9CRUS (Histone H4 OS=Daphnia magna PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.458e-49
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   13 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 94          
BLAST of Histone H4 vs. TrEMBL
Match: tr|A0A0P5AYY8|A0A0P5AYY8_9CRUS (Histone H4 OS=Daphnia magna PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 7.933e-49
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   14 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 95          
BLAST of Histone H4 vs. TrEMBL
Match: tr|A0A0P5PY65|A0A0P5PY65_9CRUS (Histone H4 OS=Daphnia magna PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 9.750e-49
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:   14 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 95          
BLAST of Histone H4 vs. TrEMBL
Match: tr|B4IMZ0|B4IMZ0_DROSE (Histone H4 (Fragment) OS=Drosophila sechellia GN=Dsec\GM19733 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.203e-48
Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 2
Query:  119 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 364
            VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sbjct:    7 VLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG 88          
The following BLAST results are available for this feature:
BLAST of Histone H4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
HIST1H4I2.997e-51100.00histone cluster 1, H4i [Source:HGNC Symbol;Acc:HGN... [more]
HIST2H4B2.997e-51100.00histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGN... [more]
HIST2H4B2.997e-51100.00histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGN... [more]
HIST2H4B2.997e-51100.00histone cluster 2, H4b [Source:HGNC Symbol;Acc:HGN... [more]
HIST1H4B2.997e-51100.00histone cluster 1, H4b [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Histone H4 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
his-676.139e-5198.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-646.139e-5198.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-606.139e-5198.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-566.139e-5198.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
his-506.139e-5198.78Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:P6278... [more]
back to top
BLAST of Histone H4 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
His4:CG338751.775e-51100.00His4:CG33875 [Source:FlyBase gene name;Acc:FBgn005... [more]
His4:CG339031.775e-51100.00His4:CG33903 [Source:FlyBase gene name;Acc:FBgn005... [more]
His4:CG338711.775e-51100.00His4:CG33871 [Source:FlyBase gene name;Acc:FBgn005... [more]
His4:CG339071.775e-51100.00His4:CG33907 [Source:FlyBase gene name;Acc:FBgn005... [more]
His4r1.775e-51100.00Histone H4 replacement [Source:FlyBase gene name;A... [more]
back to top
BLAST of Histone H4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
HIST1H4J1.760e-51100.00si:dkey-23a13.15 [Source:ZFIN;Acc:ZDB-GENE-160113-... [more]
HIST1H4G1.760e-51100.00si:dkey-23a13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-8... [more]
HIST1H4A1.760e-51100.00histone cluster 1, H4a [Source:HGNC Symbol;Acc:HGN... [more]
si:ch1073-35f11.11.760e-51100.00si:ch1073-35f11.1 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
si:dkey-23a13.191.760e-51100.00si:dkey-23a13.19 [Source:ZFIN;Acc:ZDB-GENE-160113-... [more]
back to top
BLAST of Histone H4 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
hist1h4c9.468e-52100.00Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR... [more]
hist1h4c9.468e-52100.00Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR... [more]
hist1h4c9.468e-52100.00Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR... [more]
hist1h4c9.468e-52100.00Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR... [more]
hist1h4c9.468e-52100.00Histone H4 [Source:UniProtKB/Swiss-Prot;Acc:Q28DR... [more]
back to top
BLAST of Histone H4 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Hist1h4a1.977e-51100.00histone cluster 1, H4a [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4b1.977e-51100.00histone cluster 1, H4b [Source:MGI Symbol;Acc:MGI:... [more]
Hist1h4c1.977e-51100.00histone cluster 1, H4c [Source:MGI Symbol;Acc:MGI:... [more]
Hist4h41.977e-51100.00histone cluster 4, H4 [Source:MGI Symbol;Acc:MGI:2... [more]
Hist1h4i1.977e-51100.00histone cluster 1, H4i [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Histone H4 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28DR4|H4_XENTR1.540e-50100.00Histone H4 OS=Xenopus tropicalis GN=TGas006m08.1 P... [more]
sp|P62799|H4_XENLA1.540e-50100.00Histone H4 OS=Xenopus laevis PE=1 SV=2[more]
sp|P62798|H4_XENBO1.540e-50100.00Histone H4 OS=Xenopus borealis PE=3 SV=2[more]
sp|P62794|H4_URECA1.540e-50100.00Histone H4 OS=Urechis caupo PE=3 SV=2[more]
sp|P62804|H4_RAT1.540e-50100.00Histone H4 OS=Rattus norvegicus GN=Hist1h4b PE=1 S... [more]
back to top
BLAST of Histone H4 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|G5BSF6|G5BSF6_HETGA4.515e-49100.00Histone H4 OS=Heterocephalus glaber GN=GW7_10007 P... [more]
tr|A0A0P5B3P4|A0A0P5B3P4_9CRUS7.458e-49100.00Histone H4 OS=Daphnia magna PE=3 SV=1[more]
tr|A0A0P5AYY8|A0A0P5AYY8_9CRUS7.933e-49100.00Histone H4 OS=Daphnia magna PE=3 SV=1[more]
tr|A0A0P5PY65|A0A0P5PY65_9CRUS9.750e-49100.00Histone H4 OS=Daphnia magna PE=3 SV=1[more]
tr|B4IMZ0|B4IMZ0_DROSE1.203e-48100.00Histone H4 (Fragment) OS=Drosophila sechellia GN=D... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availablePFAMPF15511CENP-T_Ccoord: 39..100
e-value: 1.9E-8
score: 34.3
IPR001951Histone H4PRINTSPR00623HISTONEH4coord: 93..104
score: 97.79
coord: 24..43
score: 93.38
coord: 44..64
score: 93.56
coord: 81..93
score: 92.76
coord: 9..20
score: 95.59
coord: 66..80
score: 95.1
IPR001951Histone H4SMARTSM00417h44coord: 20..94
e-value: 2.9E-29
score: 113.2
IPR004823TATA box binding protein associated factor (TAF)SMARTSM00803TAF_clscoord: 32..97
e-value: 0.0086
score: 17.0
IPR009072Histone-foldGENE3DG3DSA:1.10.20.10coord: 6..107
e-value: 6.1E-59
score: 196.0
IPR009072Histone-foldSUPERFAMILYSSF47113Histone-foldcoord: 7..106
IPR019809Histone H4, conserved sitePROSITEPS00047HISTONE_H4coord: 19..23

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR001951Histone_H4
IPR004823TAF_TATA-bd
IPR009072Histone-fold
IPR019809Histone_H4_CS
Vocabulary: cellular component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
GO:0000788nuclear nucleosome
GO:0005694chromosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0046982protein heterodimerization activity
GO:0042393histone binding
Vocabulary: biological process
TermDefinition
GO:0006352DNA-templated transcription, initiation
GO:0006334nucleosome assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023temporary embryonic pharynx
PLANA:0000211primitive ectoderm cell
PLANA:0000058embryonic digestive system
PLANA:0000212blastomere compartment
PLANA:0000429neoblast compartment
PLANA:0000029primitive ectoderm
PLANA:0004517blastomere
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000003Stage 3
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033466 ID=SMED30033466|Name=Histone H4|organism=Schmidtea mediterranea sexual|type=transcript|length=421bp
GATCTCACTATATAAATAAGTATTTGTCCCTATTAATTCATAACAATTAT
TCAACATGTCTGGTCGAGGTAAAGGAGGAAAAGGACTAGGAAAAGGTGGA
GCAAAGCGTCACAGAAAAGTCCTTCGTGATAACATTCAAGGTATCACAAA
GCCAGCAATCAGAAGATTAGCTCGTCGAGGTGGTGTTAAGAGAATTTCTG
GATTGATATATGAAGAAACCCGAGGTGTTCTTAAAGTATTCTTGGAAAAT
GTTATTAGAGACGCTGTGACATACACTGAGCACGCTAAGCGCAAGACAGT
AACTGCCATGGATGTCGTCTATGCTTTGAAACGACAAGGAAGAACTTTGT
ACGGTTTTGGAGGTTAAATAACACTTTCATATTTGTGAATGTTTTAGCGG
CCCTCTTTAGGGCCACAAATG
back to top

protein sequence of SMED30033466-orf-1

>SMED30033466-orf-1 ID=SMED30033466-orf-1|Name=SMED30033466-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGL
IYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
FGG*
back to top