Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30033453
Length (bp)364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30033453) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30033453) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033453

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30033453SMESG000001790.1 dd_Smed_v6_212_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30033453SMESG000001790.1 dd_Smed_v4_212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043280.1 (uncharacterized LOC100492546 [Source:NCBI gene;Acc:100492546])

HSP 1 Score: 51.2174 bits (121), Expect = 4.969e-8
Identity = 33/115 (28.70%), Postives = 53/115 (46.09%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPFSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKL 348
            H   FLS DC+  +    +      RK+S  +TK  TI+ +V A  ++  +L+ +      ++ TDASN G  K +P              VLL + ++D++   D    IK KL
Sbjct:  101 HHQSFLSMDCSAGLIKRFY-----ERKFSCSKTKCETIITDVLAKWAEDTVLQDIDKVSYVTLLTDASNSGQVKRYP--------------VLLRYVIIDTKPMGDCKVQIKTKL 196          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: D7ELW0 (Uncharacterized protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC001482 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 3.743e-20
Identity = 49/112 (43.75%), Postives = 71/112 (63.39%), Query Frame = 1
Query:    4 HSHRFLSS-DCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPFSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSI 336
            HSH + SS  C   +F  LF D N+A K++ GRTK + +V  + A  SK +IL  L  D PFS++TDAS+KGN KTFP +  NF K  G+   L+ F+ L+S++S D+  ++
Sbjct:  167 HSHSYNSSMSCGSKLFPILFPDSNVAAKFTCGRTKATKVVTAILAPLSKEQILSDLVEDHPFSIATDASDKGNIKTFPLIVRNFNKSSGVCTKLIRFFNLESKKSVDVANAL 278          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1Y1KMY9 (Uncharacterized protein (Fragment) OS=Photinus pyralis OX=7054 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.024e-16
Identity = 51/120 (42.50%), Postives = 68/120 (56.67%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDI----PFSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H H +LS+DCA  + S L+ D  +A+K   GRTK   IV N  A +S   +LE ++ +     PFSV +DASNKGN K FP     F+ + GIQN LL F   + E S  +T SI   L+
Sbjct:  135 HHHSYLSTDCAIKLNSKLYRDSALAKKVHCGRTKAEAIVENCLAPKSIEDVLEDMQVNTDTSSPFSVLSDASNKGNQKLFPVAVRYFSVKNGIQNKLLDFVENNDESSASVTNSIVKSLQ 254          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A3B3QSE0 (Dimer_Tnp_hAT domain-containing protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.538e-16
Identity = 49/128 (38.28%), Postives = 74/128 (57.81%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDI-------PF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            H+H + S+DC+  +   +F D  IA+K S GRTK ++IV NV A  S  + +++L   +       PF SV++DASN G+ K FP     +T E G+ N +L FY   +E S+ I + I +KL+ N L
Sbjct:   79 HTHSYRSTDCSNKLAPVIFPDSEIAKKMSCGRTKAASIVANVLAPVSVEKCVQELTSSLLVGGTHTPFFSVASDASNHGSTKLFPLAVRYWTPEFGLMNRVLDFYEDSAETSESIHHQITSKLKENGL 206          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A3B3QSD6 (Uncharacterized protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 6.245e-16
Identity = 49/128 (38.28%), Postives = 74/128 (57.81%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDI-------PF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            H+H + S+DC+  +   +F D  IA+K S GRTK ++IV NV A  S  + +++L   +       PF SV++DASN G+ K FP     +T E G+ N +L FY   +E S+ I + I +KL+ N L
Sbjct:   79 HTHSYRSTDCSNKLAPVIFPDSEIAKKMSCGRTKAASIVANVLAPVSVEKCVQELTSSLLVGGTHTPFFSVASDASNHGSTKLFPLAVRYWTPEFGLMNRVLDFYEDSAETSESIHHQITSKLKENGL 206          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: H3AS70 (Uncharacterized protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.724e-16
Identity = 52/121 (42.98%), Postives = 63/121 (52.07%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIP-----FSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            HS  + S DC   + S +F D N+A K S GRTK   +V NV A +S R  L+ L    P     FSV+TDAS KGN K FP     F    GIQ  LL FY    E +  I  ++KN LE
Sbjct:   71 HSLSYNSMDCGNKLASEMFHDSNVANKLSCGRTKAQLLVTNVLAPKSVRDCLQDLLSLPPEQPMYFSVATDASKKGNRKMFPMCLRYFIISDGIQCKLLDFYEDSDESASGIHRAVKNCLE 191          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030070.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001920.1:87523:93776:-1 gene:ENSAMXG00000033236.1 transcript:ENSAMXT00000030070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 5.025e-17
Identity = 43/107 (40.19%), Postives = 60/107 (56.07%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPFSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDI 324
            H H +LS+DC   + + +F D NIA K S GRTK   +V NV A  S+ R+  +L+    F+V +DASN G+ K FP     F   +G++  LL FY    E S+ I
Sbjct:   95 HGHNYLSTDCGNKVSAKIFSDSNIATKMSCGRTKSEALVENVLAPFSQERLAAELQKVHYFAVCSDASNSGHTKLFPYTVQYFCASEGVKCGLLDFYEDPDESSEAI 201          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000029907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:33864003:33865857:-1 gene:ENSAMXG00000029392.1 transcript:ENSAMXT00000029907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.0182 bits (175), Expect = 1.287e-15
Identity = 47/121 (38.84%), Postives = 64/121 (52.89%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            HS  + S DC   + S +F D  IA+K S GRTK +++V +V A  S        K   PF SV++DASN G  KT P VF     + G+++ +L FY    E +  I   I +KLE N L
Sbjct:   94 HSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESC--DKKAHTPFFSVASDASNHGTTKTLPTVFEILDTKAGLKSKILDFYEDSHESAATIHCQITSKLEENGL 212          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000048878.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:18990267:18996294:-1 gene:ENSAMXG00000041866.1 transcript:ENSAMXT00000048878.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 6.544e-15
Identity = 46/121 (38.02%), Postives = 65/121 (53.72%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            HS  + S DC   + S +F D  IA+K S GRTK +++V +V A  S     +  K   PF SV++DASN G  K FP     +T + G+++ +L FY    E +  I   I +KLE N L
Sbjct:   89 HSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESCDK--KAHTPFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEENGL 207          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051257.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001235.1:256137:262891:1 gene:ENSAMXG00000033420.1 transcript:ENSAMXT00000051257.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.864e-14
Identity = 46/121 (38.02%), Postives = 64/121 (52.89%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            HS  + S DC   + S +F D  IA+K S GRTK +++V +V A  S        K   PF SV++DASN G  K FP     +T + G+++ +L FY    E +  I   I +KLE N L
Sbjct:  108 HSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESC--DKKAHTPFFSVASDASNHGTTKLFPLSLRYWTPKLGLKSKILDFYEDSHESAATIHCQITSKLEENGL 226          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000041838.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29525919:29530293:-1 gene:ENSAMXG00000031975.1 transcript:ENSAMXT00000041838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.243e-12
Identity = 45/121 (37.19%), Postives = 63/121 (52.07%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIP-FSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLESNYL 363
            HS  + S DC   + S +F D  IA+K S GRTK +++V +V A  S        K   P FSV++DASN G  K FP     +T +  +++ +L FY    E +  I   I +KLE N L
Sbjct:  106 HSLSYRSEDCGNKLTSAIFPDSEIAKKMSCGRTKAASLVTDVLAPASVESC--DKKAHTPFFSVASDASNHGTTKLFPLSLRYWTPK--LESKILDFYEDSHESAATIHCQITSKLEENGL 222          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000023292.1 (SMESG000023292.1)

HSP 1 Score: 66.6254 bits (161), Expect = 9.751e-14
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H + + S+ C   + S +F D  +A++ S G+TK   I  NV A      I++ L   IPF SVSTD SN G  K FP +   F K  GI   ++  Y L +E ++ I+ ++   LE
Sbjct:   99 HHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSL-SKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLE 214          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000026972.1 (SMESG000026972.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.138e-13
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H + + S+ C   + S +F D  +A++ S G+TK   I  NV A      I++ L   IPF SVSTD SN G  K FP +   F K  GI   ++  Y L +E ++ I+ ++   LE
Sbjct:  192 HHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSL-SKIPFISVSTDGSNHGAIKLFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLE 307          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000064306.1 (SMESG000064306.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.168e-13
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H + + S+ C   + S +F D  +A++ S G+TK   I  NV A      I++ L   IPF SVSTD SN G  K FP +   F K  GI   ++  Y L +E ++ I+ ++   LE
Sbjct:   29 HHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSL-SKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLE 144          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000052607.1 (SMESG000052607.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.184e-13
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H + + S+ C   + S +F D  +A++ S G+TK   I  NV A      I++ L   IPF SVSTD SN G  K FP +   F K  GI   ++  Y L +E ++ I+ ++   LE
Sbjct:   99 HHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSL-SKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLE 214          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000079481.1 (SMESG000079481.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.195e-13
Identity = 41/117 (35.04%), Postives = 61/117 (52.14%), Query Frame = 1
Query:    4 HSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKRRILEQLKGDIPF-SVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLLDSERSDDITYSIKNKLE 351
            H + + S+ C   + S +F D  +A++ S G+TK   I  NV A      I++ L   IPF SVSTD SN G  K FP +   F K  GI   ++  Y L +E ++ I+ ++   LE
Sbjct:   99 HHYSYNSTVCTNKLLSNMFDDSEVAKRISSGKTKTRCIANNVIAPYCIENIMQSL-SKIPFISVSTDGSNHGAIKMFPVLIQFFDKNNGIMTKMIDLYSLPNETAETISDNLNTCLE 214          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043280.14.969e-828.70uncharacterized LOC100492546 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D7ELW03.743e-2043.75Uncharacterized protein OS=Tribolium castaneum OX=... [more]
A0A1Y1KMY91.024e-1642.50Uncharacterized protein (Fragment) OS=Photinus pyr... [more]
A0A3B3QSE05.538e-1638.28Dimer_Tnp_hAT domain-containing protein OS=Paramor... [more]
A0A3B3QSD66.245e-1638.28Uncharacterized protein OS=Paramormyrops kingsleya... [more]
H3AS708.724e-1642.98Uncharacterized protein OS=Latimeria chalumnae OX=... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030070.15.025e-1740.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000029907.11.287e-1538.84pep primary_assembly:Astyanax_mexicanus-2.0:15:338... [more]
ENSAMXT00000048878.16.544e-1538.02pep primary_assembly:Astyanax_mexicanus-2.0:8:1899... [more]
ENSAMXT00000051257.11.864e-1438.02pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000041838.11.243e-1237.19pep primary_assembly:Astyanax_mexicanus-2.0:14:295... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023292.19.751e-1435.04SMESG000023292.1[more]
SMESG000026972.11.138e-1335.04SMESG000026972.1[more]
SMESG000064306.11.168e-1335.04SMESG000064306.1[more]
SMESG000052607.11.184e-1335.04SMESG000052607.1[more]
SMESG000079481.11.195e-1335.04SMESG000079481.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033453 ID=SMED30033453|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=364bp
ATGCATTCACACAGGTTTTTATCCAGTGATTGTGCTGGTTCAATATTTTC
TGGTTTGTTTTTTGATTTGAATATAGCAAGAAAGTACAGCGGTGGAAGAA
CCAAAATATCCACAATTGTTTGTAATGTTTCGGCCCTCGAATCGAAAAGA
AGAATTTTAGAACAGTTAAAAGGTGATATTCCATTTTCTGTGAGTACCGA
TGCTTCGAATAAAGGAAATGCTAAAACATTTCCTGCAGTCTTTATAAATT
TTACCAAAGAAAAAGGTATACAAAATGTTCTTCTTTCTTTTTATTTACTA
GATAGTGAACGTTCAGATGACATAACATATTCTATAAAGAACAAATTGGA
ATCCAACTATTTAA
back to top

protein sequence of SMED30033453-orf-1

>SMED30033453-orf-1 ID=SMED30033453-orf-1|Name=SMED30033453-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MHSHRFLSSDCAGSIFSGLFFDLNIARKYSGGRTKISTIVCNVSALESKR
RILEQLKGDIPFSVSTDASNKGNAKTFPAVFINFTKEKGIQNVLLSFYLL
DSERSDDITYSIKNKLESNYL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR37162FAMILY NOT NAMEDcoord: 2..119