Voltage-dependent L-type calcium channel subunit alpha

Overview
NameVoltage-dependent L-type calcium channel subunit alpha
Smed IDSMED30033439
Length (bp)5891
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30033439) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30033439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent L-type calcium channel subunit alpha (SMED30033439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent L-type calcium channel subunit alpha (SMED30033439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033439h1SMcG0000188 dd_Smed_v4_9877_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 357/773 (46.18%), Postives = 516/773 (66.75%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV------------DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNK-------SRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L LK+K   +P AS+ FIFS +N+FR+ CHR++N ++   ++L  I+ S I +A  +P+Q  + +  IL   DY+FT  FTLE+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y CSD S++TE  CKG YI Y  DG     ++  R+W N++F++DNVL  MM LF VSTF+G+ ++L+ +ID+  E +GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P +++++++W +V S  F   +F++I+LNTI +++       L     +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS +DVI     PA             +  + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W  IM++C+   K       S        CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  865 LHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK-DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1629          

HSP 2 Score: 382.874 bits (982), Expect = 8.953e-107
Identity = 265/656 (40.40%), Postives = 396/656 (60.37%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ--------GK---VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN---VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVK----TTFEIQ----DNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +        GK    D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCYN           +P PC                L  G    C    N ++    + GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y V+D  G  WPW++F+ L+I+GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     +E +DE   +     T E +    +N+   D +     EN   R+  ++  +  S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:   90 KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCA---------------LETGHGRQC---QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEG----ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 721          

HSP 3 Score: 97.8265 bits (242), Expect = 1.939e-19
Identity = 75/285 (26.32%), Postives = 137/285 (48.07%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-------ACSDISQRTEDNCKGTYIYYAYDGSYQ-AKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++FH  +YLRN +N +DFI+V +G+   IL     +              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +         +D+    ED+     +   +    Q   V    W   +    N+DN    M+T+F   T +G+ D+L+   DAV R++   YF
Sbjct:  103 ALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVP--AEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYF 385          

HSP 4 Score: 89.3521 bits (220), Expect = 7.195e-17
Identity = 85/282 (30.14%), Postives = 143/282 (50.71%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVY 1037
            P+ S F+ F   NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L N +     IF +E I+K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +F+ +G+ LF G   +TC ++ +KQ  +  K      N + Y  D   + P+ Q  S    + NS    +F         FDN+  AM+ +F + T EGW +++Y   D +
Sbjct:  875 PEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLS--SISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL-YTCSDS-SKQTEAECK-----GNYITYK-DGEVDHPIIQPRS----WENS----KF--------DFDNVLAAMMALFTVSTFEGWPELLYRSIDSH 1128          

HSP 5 Score: 77.411 bits (189), Expect = 2.908e-13
Identity = 58/220 (26.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N   + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   +   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  548 QPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754          

HSP 6 Score: 58.151 bits (139), Expect = 2.119e-7
Identity = 65/255 (25.49%), Postives = 128/255 (50.20%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++ VL+ +N++ +A ++ GQ  +     +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  S+I++ L  TN                ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W 
Sbjct: 1171 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ 1419          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 357/773 (46.18%), Postives = 516/773 (66.75%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV------------DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNK-------SRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L LK+K   +P AS+ FIFS +N+FR+ CHR++N ++   ++L  I+ S I +A  +P+Q  + +  IL   DY+FT  FTLE+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y CSD S++TE  CKG YI Y  DG     ++  R+W N++F++DNVL  MM LF VSTF+G+ ++L+ +ID+  E +GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P +++++++W +V S  F   +F++I+LNTI +++       L     +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS +DVI     PA             +  + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W  IM++C+   K       S        CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  865 LHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK-DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1629          

HSP 2 Score: 382.874 bits (982), Expect = 8.953e-107
Identity = 265/656 (40.40%), Postives = 396/656 (60.37%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ--------GK---VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN---VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVK----TTFEIQ----DNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +        GK    D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCYN           +P PC                L  G    C    N ++    + GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y V+D  G  WPW++F+ L+I+GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     +E +DE   +     T E +    +N+   D +     EN   R+  ++  +  S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:   90 KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCA---------------LETGHGRQC---QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEG----ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 721          

HSP 3 Score: 97.8265 bits (242), Expect = 1.939e-19
Identity = 75/285 (26.32%), Postives = 137/285 (48.07%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-------ACSDISQRTEDNCKGTYIYYAYDGSYQ-AKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++FH  +YLRN +N +DFI+V +G+   IL     +              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +         +D+    ED+     +   +    Q   V    W   +    N+DN    M+T+F   T +G+ D+L+   DAV R++   YF
Sbjct:  103 ALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVP--AEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYF 385          

HSP 4 Score: 89.3521 bits (220), Expect = 7.195e-17
Identity = 85/282 (30.14%), Postives = 143/282 (50.71%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVY 1037
            P+ S F+ F   NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L N +     IF +E I+K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +F+ +G+ LF G   +TC ++ +KQ  +  K      N + Y  D   + P+ Q  S    + NS    +F         FDN+  AM+ +F + T EGW +++Y   D +
Sbjct:  875 PEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLS--SISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL-YTCSDS-SKQTEAECK-----GNYITYK-DGEVDHPIIQPRS----WENS----KF--------DFDNVLAAMMALFTVSTFEGWPELLYRSIDSH 1128          

HSP 5 Score: 77.411 bits (189), Expect = 2.908e-13
Identity = 58/220 (26.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N   + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   +   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  548 QPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754          

HSP 6 Score: 58.151 bits (139), Expect = 2.119e-7
Identity = 65/255 (25.49%), Postives = 128/255 (50.20%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++ VL+ +N++ +A ++ GQ  +     +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  S+I++ L  TN                ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W 
Sbjct: 1171 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ 1419          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1S (calcium voltage-gated channel subunit alpha1 S [Source:HGNC Symbol;Acc:HGNC:1397])

HSP 1 Score: 636.336 bits (1640), Expect = 0.000e+0
Identity = 349/774 (45.09%), Postives = 517/774 (66.80%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN-QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FD  FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  + + +  I  I+L+  L  F+F+ IGV  FKG F+ C+D+S+ TE+ C+G Y  Y      Q ++ +R W ++ F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E+ILK++AF  R YF D  N+FDF++V+GS +DVI     +P     +    FRLFR +RL+KLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIAL + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +L++NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  749 EPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1515          

HSP 2 Score: 390.963 bits (1003), Expect = 1.192e-109
Identity = 260/634 (41.01%), Postives = 391/634 (61.67%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENV-FDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     IV  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDF IV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q IT EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F K ++  +  +D   Y  WI QG     E++D   V+   E + +L         +YE    ++I+  ++   +    ++ K      +I+K++ ++ +++++V +N+L +A+E+  QP  L++ QD +N   L LFT E+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M  +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E W   MY GI   GG
Sbjct:   26 RPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSPCA-RTGS-GRRC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQG-----EVMD---VEDFREGKLSLDEGGSDTESLYEIAGLNKIIQFIRHWRQWNRIFRWKCH----DIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGG 629          

HSP 3 Score: 96.6709 bits (239), Expect = 4.955e-19
Identity = 74/279 (26.52%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  ++     + I+L+ I ++C+ +A + P+  +   +  L +   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DF +VF+G+  VIL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   T +G+ D+L+   DA+
Sbjct:   30 ALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSP---CARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAI 305          

HSP 4 Score: 87.4261 bits (215), Expect = 2.766e-16
Identity = 49/161 (30.43%), Postives = 88/161 (54.66%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  L++ ++    +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI  + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGN 930          

HSP 5 Score: 74.7146 bits (182), Expect = 1.879e-12
Identity = 56/219 (25.57%), Postives = 110/219 (50.23%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + DI N + + LFT E+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W  +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWTSMMYNGI--------MAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVD 662          

HSP 6 Score: 72.4034 bits (176), Expect = 1.055e-11
Identity = 107/434 (24.65%), Postives = 197/434 (45.39%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWP----WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNL--------KDTDDYLFYKDWIEQ---GDKIINEL---LDE-----SSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----------IIKTRYYFIVILVLVFINSLIMATE-YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-------------------ISEDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            ++FDN   A+++VFQ++T E WT +MY     YG  S+P     ++FI L + G+Y LLN+ + I      + +     Q    +EK+          K  ++       +EQ   G+ I       +DE     + VK  +   D    D+E   +I  +   R L +L+   K + P    +  ++ +           I+   ++   IL+ + ++S  +A E  I    + +Q   + ++ F  +FT+E++LK+ + G    K  F +  FN+ D +++ VS+I M L  + +       ILR +R+LR  +       LK +V  M  +I +I +++L+  L   + + +G+QLF GKF                   + +DG   +             +FD++L A++++F + T EGW + +YK I
Sbjct:  595 SNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAV-PIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAI 1024          

HSP 7 Score: 58.5362 bits (140), Expect = 1.615e-7
Identity = 51/175 (29.14%), Postives = 82/175 (46.86%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFE--AFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD----QGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         IV +  FE   F +I +   CLG     M   N S  +N   +   +   +IF +E I+K++ +     A+ Y  + WNV DF+IV+  I+  ILS  D      ++     R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1083 KNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLG-----MQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAF----KARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQAL 1248          

HSP 8 Score: 54.6842 bits (130), Expect = 2.467e-6
Identity = 60/246 (24.39%), Postives = 124/246 (50.41%), Query Frame = 3
Query: 1320 DEQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQ---IGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
             EQ    Y+N       +L    ++   Y LKA            Q  +  I+ + Y+  ++  L+ +N++ +  ++  Q   ++   D  N+ F I+FT+E++LKL +   + YF  P+N++DF+I+  S+I++ L   +  ++   I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct: 1069 QEQGETEYKNC------ELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQE 1308          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 355/773 (45.92%), Postives = 515/773 (66.62%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV------------DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNK-------SRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L LK+K   +P AS+ FIFS +N+FR+ CHR++N ++   ++L  I+ S I +A  +P+Q  + +  IL  FD +FT  FT+E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y CSD S++TE  CKG YI Y  DG     ++  R+W N++F++DNVL  MM LF VSTF+G+ ++L+ +ID+  E +GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P +++++++W +V S  F   +F++I+LNTI +++       L     +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS +DVI     PA             +  + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W  IM++C+   K       S        CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  865 LHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK-DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1629          

HSP 2 Score: 383.259 bits (983), Expect = 6.607e-107
Identity = 265/656 (40.40%), Postives = 396/656 (60.37%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ--------GK---VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN---VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVK----TTFEIQ----DNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +        GK    D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCYN           +P PC                L  G    C    N ++    + GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y V+D  G  WPW++F+ L+I+GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     +E +DE   +     T E +    +N+   D +     EN   R+  ++  +  S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:   90 KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCA---------------LETGHGRQC---QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEG----ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 721          

HSP 3 Score: 98.2117 bits (243), Expect = 1.612e-19
Identity = 75/285 (26.32%), Postives = 137/285 (48.07%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-------ACSDISQRTEDNCKGTYIYYAYDGSYQ-AKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++FH  +YLRN +N +DFI+V +G+   IL     +              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +         +D+    ED+     +   +    Q   V    W   +    N+DN    M+T+F   T +G+ D+L+   DAV R++   YF
Sbjct:  103 ALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVP--AEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYF 385          

HSP 4 Score: 84.7297 bits (208), Expect = 2.066e-15
Identity = 84/282 (29.79%), Postives = 142/282 (50.35%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVY 1037
            P+ S F+ F   NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L   ++    IF IE  +K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +F+ +G+ LF G   +TC ++ +KQ  +  K      N + Y  D   + P+ Q  S    + NS    +F         FDN+  AM+ +F + T EGW +++Y   D +
Sbjct:  875 PEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLS--SISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL-YTCSDS-SKQTEAECK-----GNYITYK-DGEVDHPIIQPRS----WENS----KF--------DFDNVLAAMMALFTVSTFEGWPELLYRSIDSH 1128          

HSP 5 Score: 77.7962 bits (190), Expect = 2.811e-13
Identity = 58/220 (26.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N   + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   +   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  548 QPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754          

HSP 6 Score: 58.5362 bits (140), Expect = 1.703e-7
Identity = 65/255 (25.49%), Postives = 128/255 (50.20%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++ VL+ +N++ +A ++ GQ  +     +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  S+I++ L  TN                ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W 
Sbjct: 1171 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ 1419          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Match: CACNA1C (calcium voltage-gated channel subunit alpha1 C [Source:HGNC Symbol;Acc:HGNC:1390])

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 355/773 (45.92%), Postives = 515/773 (66.62%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV------------DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNK-------SRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L LK+K   +P AS+ FIFS +N+FR+ CHR++N ++   ++L  I+ S I +A  +P+Q  + +  IL  FD +FT  FT+E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y CSD S++TE  CKG YI Y  DG     ++  R+W N++F++DNVL  MM LF VSTF+G+ ++L+ +ID+  E +GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P +++++++W +V S  F   +F++I+LNTI +++       L     +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS +DVI     PA             +  + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W  IM++C+   K       S        CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  865 LHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK-DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1629          

HSP 2 Score: 383.259 bits (983), Expect = 6.607e-107
Identity = 265/656 (40.40%), Postives = 396/656 (60.37%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ--------GK---VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN---VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVK----TTFEIQ----DNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +        GK    D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCYN           +P PC                L  G    C    N ++    + GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y V+D  G  WPW++F+ L+I+GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     +E +DE   +     T E +    +N+   D +     EN   R+  ++  +  S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:   90 KKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCA---------------LETGHGRQC---QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEG----ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 721          

HSP 3 Score: 98.2117 bits (243), Expect = 1.612e-19
Identity = 75/285 (26.32%), Postives = 137/285 (48.07%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-------ACSDISQRTEDNCKGTYIYYAYDGSYQ-AKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++FH  +YLRN +N +DFI+V +G+   IL     +              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +         +D+    ED+     +   +    Q   V    W   +    N+DN    M+T+F   T +G+ D+L+   DAV R++   YF
Sbjct:  103 ALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVP--AEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYF 385          

HSP 4 Score: 84.7297 bits (208), Expect = 2.066e-15
Identity = 84/282 (29.79%), Postives = 142/282 (50.35%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVY 1037
            P+ S F+ F   NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L   ++    IF IE  +K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +F+ +G+ LF G   +TC ++ +KQ  +  K      N + Y  D   + P+ Q  S    + NS    +F         FDN+  AM+ +F + T EGW +++Y   D +
Sbjct:  875 PEASAFFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLS--SISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL-YTCSDS-SKQTEAECK-----GNYITYK-DGEVDHPIIQPRS----WENS----KF--------DFDNVLAAMMALFTVSTFEGWPELLYRSIDSH 1128          

HSP 5 Score: 77.7962 bits (190), Expect = 2.811e-13
Identity = 58/220 (26.36%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N   + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   +   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  548 QPNWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 754          

HSP 6 Score: 58.5362 bits (140), Expect = 1.703e-7
Identity = 65/255 (25.49%), Postives = 128/255 (50.20%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++ VL+ +N++ +A ++ GQ  +     +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  S+I++ L  TN                ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W 
Sbjct: 1171 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ 1419          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 365/756 (48.28%), Postives = 517/756 (68.39%), Query Frame = 3
Query: 2544 IPIASSLFIFSQSNKFRIFCHRVINHS-LTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQ----------LSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IP ASSLFI S +N FR+FC+ V+NHS  T  +L  I+VSS  M+A  +PLQ N+T+  ILN FDY FT  FT+E+ + +I +G++FHKGS+ RNAFN +D +VV + +   +L    MS +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  +  F+F++IGV  FKG+F+ C+D+S+ TE  C+G YI+Y      +     R WSNN FN+DNV + M++LFVVSTF+G+  +L+  ID+  E +GP  N+ + +  F++ ++I+  FF++NIF+GFV++++Q   E EY++ ELDKNQ+KCI   LK+KP  RY+P +R ++R+W  VTS  F   IFLII++NT++++     + +   D  D+FN IF  +F  E +LKI+A N +NY  D+ N+FD +VV+GSF+D+ +    P     + IN FRLFR +RLVKLL + + IR +LWTF+ +F  LP+V LL++++ +IYA+IGMQFFGK+AL+++ S I  NNNF +   + +VL R  TGE W  IM+SC D    RC           L+   CG  FAY YFISF +L ++L++NLF+AVI++ FDYLT+D S LGPHHLE F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+CF ATLFALVR NL+I    N      I+E NE+LR  IKR+W++T   +L+E++ P+   + VTVGKFYATFLIQD+FR
Sbjct:  772 IPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSA-MLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTS-IHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGN------IDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFR 1519          

HSP 2 Score: 387.882 bits (995), Expect = 4.987e-109
Identity = 270/632 (42.72%), Postives = 401/632 (63.45%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLC---DNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIK--EKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-ISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSL 2054
            + +RS       N +R     IV  K FE  I+  I  +C+ L++ + YP  DS+  N  LE  E   I++F IE ++KI+  GF+ H  +YLRN WN+LDFIIVV+G+V+ ILS       D+KALRAFRVLRPLRL+S +PSLQ+VLN+I+ A+ PL +I LLVLF+I+I++I+G+ LF G  H TC +  T Q    +P PC        + C   D+L N+  G  W C      S N   +PGPN GIT+FDN G AMLTVFQ ++ EGWTD+MY V+D  G  WPW++F+ LVILGS+F+LNL++G+L G+F+KE+ K   +  F K  EKQ L+  +D   Y DWI Q + I     +E  DE   +T        +V +E + +  E V D    K  +  K++E    + +     ++K++ ++ ++++LV +N+L++ +E+ GQ   L  FQ  +N+FF+ILF++E+LLK++SLGF  Y    FN +D  ++  S++E  LV  ++M  +G S+LRS RLLR+FK+TK+W +L+ +V++++ S++SI+SLLLL+ LF++I +LLGMQ+FGGKF  +      R NFD  + A++TVFQ++T E WN  MY GI+  GG  +L
Sbjct:   63 RSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNM--GVRWEC------SSNTT-WPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLE--EDLKGYLDWITQAEDIEPVNEDEQEDEPVAQT--------VVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTL 675          

HSP 3 Score: 130.954 bits (328), Expect = 7.146e-30
Identity = 162/615 (26.34%), Postives = 289/615 (46.99%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVG--QVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWP--------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNV--MNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            S F    TN  R+F   +VN   F   ++ CI  S   L+       N + ++   L   +     +F +E  +K+I++G V H  S+ RN +N+LD ++V + + +++L  TD   V +K LR  RVLRPLR I++   L+ V+  +I+A+K + NI+L+   L  +F+I+G+ LF G F F C N+++K   +    C  R   + Y  D  P  PV   +VWS     NN  N             FDN+G AM+++F + T EGW  ++Y+ +D    +  P         +FFI  +I+ ++F++N+ +G +   F         QNE  +E +N +                      LD++  K                          I   LK+   +    + + Q  +   + +R +  VI +++ +N++ +A ++         F D  N+ F  +F  E +LK+ +L  KNY    +N++D +++  S I+++    N    N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ FG   + +  S++R  NF     AI+ +F+  T E W 
Sbjct:  777 SLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNM--ILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR-TDAMSV-VKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF-FLC-NDLSKMTEAE---C--RGEYIHYE-DGDPTKPVSKKRVWS-----NNDFN-------------FDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF---------QNEGEREYENCE----------------------LDKNQRKC-------------------------IEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQ 1305          

HSP 4 Score: 108.227 bits (269), Expect = 5.263e-23
Identity = 79/282 (28.01%), Postives = 142/282 (50.35%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNP--LQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY------ACSDISQRTEDNCKGTYIYYAYD----------GSYQAKVMNRTW---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            SL   S +N  R  C  ++     + ++L +I ++CI +A + P   Q +  +  +L   +Y+F V FT+E ++ +++ G +FH  +YLRNA+N +DFI+V IG++  IL  + +    +K LR  RV++ LR ++    L+ ++N++   M  +  I L+ L    I+++IG+  F G  +      A   ++Q+    C       A+           G       N TW   +N   N+DN    M+T+F   + +G+ D+++   DAV RE+   YF
Sbjct:   67 SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYF 348          

HSP 5 Score: 73.1738 bits (178), Expect = 2.513e-12
Identity = 58/218 (26.61%), Postives = 111/218 (50.92%), Query Frame = 3
Query: 3657 QLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGS---FVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + ++    + N  F+ LF++E++LK+ +  F  Y   + N FD  VV+ S   FV V F   +P     L +++ R  R LR+ K+     S+R ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N    +     NF T   + + + + +TGE W+ +M   ++       L    C       Y+I   I  NY+++N+FLA+ ++
Sbjct:  499 EWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKP-----LGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGG-KFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVC------IYYIVLFICGNYILLNVFLAIAVD 704          

HSP 6 Score: 57.7658 bits (138), Expect = 1.148e-7
Identity = 71/266 (26.69%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 3666 NDISDIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-------------GKIA-----------------------LNNTGS--EITTN------NNFQTLFNSF----IVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            N + +   Y+FI +FTIE +LKI+A  F      Y  +  NI DFI+V+   V  I      ++ G   +   R FR LR ++L+    S++ +L   + A   L  + LLVL ++ IYAIIG++ F             G++A                       L N G   E ++N      NN  T F++F    + + +C++ E W  +M    D             G  + + YF++ +IL ++ ++NL L V+  +F
Sbjct:  120 NTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKM--SIQG-FDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVND-----------AVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: egl-19 (Voltage-dependent L-type calcium channel subunit alpha [Source:UniProtKB/TrEMBL;Acc:W6RY76])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 365/756 (48.28%), Postives = 517/756 (68.39%), Query Frame = 3
Query: 2544 IPIASSLFIFSQSNKFRIFCHRVINHS-LTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQ----------LSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IP ASSLFI S +N FR+FC+ V+NHS  T  +L  I+VSS  M+A  +PLQ N+T+  ILN FDY FT  FT+E+ + +I +G++FHKGS+ RNAFN +D +VV + +   +L    MS +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  +  F+F++IGV  FKG+F+ C+D+S+ TE  C+G YI+Y      +     R WSNN FN+DNV + M++LFVVSTF+G+  +L+  ID+  E +GP  N+ + +  F++ ++I+  FF++NIF+GFV++++Q   E EY++ ELDKNQ+KCI   LK+KP  RY+P +R ++R+W  VTS  F   IFLII++NT++++     + +   D  D+FN IF  +F  E +LKI+A N +NY  D+ N+FD +VV+GSF+D+ +    P     + IN FRLFR +RLVKLL + + IR +LWTF+ +F  LP+V LL++++ +IYA+IGMQFFGK+AL+++ S I  NNNF +   + +VL R  TGE W  IM+SC D    RC           L+   CG  FAY YFISF +L ++L++NLF+AVI++ FDYLT+D S LGPHHLE F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+CF ATLFALVR NL+I    N      I+E NE+LR  IKR+W++T   +L+E++ P+   + VTVGKFYATFLIQD+FR
Sbjct:  772 IPKASSLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSA-MLAAEDPLQANSTRNMILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEAECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQRKCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTS-IHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDDYHKGGLNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNATLFALVRTNLKIYTEGN------IDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTVGKFYATFLIQDYFR 1519          

HSP 2 Score: 387.882 bits (995), Expect = 2.849e-109
Identity = 266/630 (42.22%), Postives = 399/630 (63.33%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLC---DNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-ISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSL 2054
            + +RS       N +R     IV  K FE  I+  I  +C+ L++ + YP  DS+  N  LE  E   I++F IE ++KI+  GF+ H  +YLRN WN+LDFIIVV+G+V+ ILS       D+KALRAFRVLRPLRL+S +PSLQ+VLN+I+ A+ PL +I LLVLF+I+I++I+G+ LF G  H TC +  T Q    +P PC        + C   D+L N+  G  W C      S N   +PGPN GIT+FDN G AMLTVFQ ++ EGWTD+MY V+D  G  WPW++F+ LVILGS+F+LNL++G+L G+F+KE+ K   +  F K ++  +  +D   Y DWI Q + I     +E  DE   +T        +V +E + +  E V D    K  +  K++E    + +     ++K++ ++ ++++LV +N+L++ +E+ GQ   L  FQ  +N+FF+ILF++E+LLK++SLGF  Y    FN +D  ++  S++E  LV  ++M  +G S+LRS RLLR+FK+TK+W +L+ +V++++ S++SI+SLLLL+ LF++I +LLGMQ+FGGKF  +      R NFD  + A++TVFQ++T E WN  MY GI+  GG  +L
Sbjct:   63 RSERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNM--GVRWEC------SSNTT-WPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQEDEPVAQT--------VVGEEADEEGEERVEDVRPSKWAARMKRLEKLNRRCRRACRRLVKSQTFYWLVILLVLLNTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTL 675          

HSP 3 Score: 130.954 bits (328), Expect = 5.992e-30
Identity = 162/615 (26.34%), Postives = 289/615 (46.99%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVG--QVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWP--------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNV--MNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            S F    TN  R+F   +VN   F   ++ CI  S   L+       N + ++   L   +     +F +E  +K+I++G V H  S+ RN +N+LD ++V + + +++L  TD   V +K LR  RVLRPLR I++   L+ V+  +I+A+K + NI+L+   L  +F+I+G+ LF G F F C N+++K   +    C  R   + Y  D  P  PV   +VWS     NN  N             FDN+G AM+++F + T EGW  ++Y+ +D    +  P         +FFI  +I+ ++F++N+ +G +   F         QNE  +E +N +                      LD++  K                          I   LK+   +    + + Q  +   + +R +  VI +++ +N++ +A ++         F D  N+ F  +F  E +LK+ +L  KNY    +N++D +++  S I+++    N    N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ FG   + +  S++R  NF     AI+ +F+  T E W 
Sbjct:  777 SLFILSHTNSFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNM--ILNYFDYFFTSVFTVEITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLR-TDAMSV-VKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTF-FLC-NDLSKMTEAE---C--RGEYIHYE-DGDPTKPVSKKRVWS-----NNDFN-------------FDNVGDAMISLFVVSTFEGWPQLLYVAIDSNEEDKGPIHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTF---------QNEGEREYENCE----------------------LDKNQRKC-------------------------IEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGFEDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGGTNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQ 1305          

HSP 4 Score: 107.842 bits (268), Expect = 6.942e-23
Identity = 79/282 (28.01%), Postives = 142/282 (50.35%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNP--LQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY------ACSDISQRTEDNCKGTYIYYAYD----------GSYQAKVMNRTW---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            SL   S +N  R  C  ++     + ++L +I ++CI +A + P   Q +  +  +L   +Y+F V FT+E ++ +++ G +FH  +YLRNA+N +DFI+V IG++  IL  + +    +K LR  RV++ LR ++    L+ ++N++   M  +  I L+ L    I+++IG+  F G  +      A   ++Q+    C       A+           G       N TW   +N   N+DN    M+T+F   + +G+ D+++   DAV RE+   YF
Sbjct:   67 SLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQGFDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYF 348          

HSP 5 Score: 72.7886 bits (177), Expect = 3.175e-12
Identity = 58/218 (26.61%), Postives = 111/218 (50.92%), Query Frame = 3
Query: 3657 QLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGS---FVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + ++    + N  F+ LF++E++LK+ +  F  Y   + N FD  VV+ S   FV V F   +P     L +++ R  R LR+ K+     S+R ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N    +     NF T   + + + + +TGE W+ +M   ++       L    C       Y+I   I  NY+++N+FLA+ ++
Sbjct:  499 EWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVVISSILEFVLVYFDLMKP-----LGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLLLLFLFIVIFALLGMQVFGG-KFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHGIESFGGVGTLGVIVC------IYYIVLFICGNYILLNVFLAIAVD 704          

HSP 6 Score: 57.3806 bits (137), Expect = 1.442e-7
Identity = 71/266 (26.69%), Postives = 118/266 (44.36%), Query Frame = 3
Query: 3666 NDISDIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-------------GKIA-----------------------LNNTGS--EITTN------NNFQTLFNSF----IVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            N + +   Y+FI +FTIE +LKI+A  F      Y  +  NI DFI+V+   V  I      ++ G   +   R FR LR ++L+    S++ +L   + A   L  + LLVL ++ IYAIIG++ F             G++A                       L N G   E ++N      NN  T F++F    + + +C++ E W  +M    D             G  + + YF++ +IL ++ ++NL L V+  +F
Sbjct:  120 NTLLETIEYVFIVVFTIECVLKIVAMGFMFHPSAYLRNAWNILDFIIVVIGLVSTILSKM--SIQG-FDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELFCGKLHSTCIDPATGQLAQKDPTPCGTDTEGSAFKCQPSDSLTNMGVRWECSSNTTWPGPNNGITNFDNFGLAMLTVFQCVSLEGWTDVMYWVND-----------AVGREWPWIYFVTLVILGSFFVLNLVLGVLSGEF 371          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 476.093 bits (1224), Expect = 6.803e-140
Identity = 293/761 (38.50%), Postives = 456/761 (59.92%), Query Frame = 3
Query: 2556 SSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQA-KVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDR--YRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMIS------CVDDNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWR-KTSDAVLEEIIPSN---VMNTVTVGKFYATFLIQDFFR 4775
            SS+F  S +N FR+  H ++     + +++ +I  S + +A  +P+     +  +L   DY FT  F  E+++ +I  G++ H GSY R+ +N +D IVV   +        E SA      +K+LRVLRV++ L+TI +  +LK + + V  ++ N++ I+++  LF FIF+VI V  F G F+ C+D +++  + C G +  + YD      +V  R W    FNYDN +N M+TLFVV+T +G+  I   ++D   E +GP       +  FY+++ I+  FF +NIF+  ++I++Q+  E+E    +LDKNQK+CI   L ++P   ++P D+   ++RIW+LVTS  F  FI  +I  NT+ + + +  NP    +I  +FN     +FT+E ILKI+AF  RNYF D  N FDF+ V+GS  D +         G  + +   RLFR+ RL++LL +  +IR +LWTF+ +F  LP+V LL+ M+ +IYAI+GMQ FG I LN   +EI  +NNFQ+ FN+ I+L RC TGE W  IM++      C     +      G TCG+  +Y YF SF+ LS++L++NLF+AVI++ FDYLT+DSS LGPHHL+ FI  W+ YD  A GRI   ++ ++L  + PP+GFGK CP     + L+ MNMP+ +DGT+ F  TLFAL+R +L IK+    + ++ ++E +EELRL +K++W  K    +++ ++P N       +TVGK YA  LI + +R
Sbjct:  698 SSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQF--FVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTE----FGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLN-AATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKM----RPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYR 1447          

HSP 2 Score: 311.612 bits (797), Expect = 1.318e-85
Identity = 243/627 (38.76%), Postives = 366/627 (58.37%), Query Frame = 3
Query:  324 LTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYI-LSVTDQ------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN------NVTKQRMSNPKPCNPRANSLG-YLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPY------------------------------------KLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM-NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            + +  P ND   L++ LE TE   + IF +E ++K+I +GF LH  SYLR+ WN++DFI+VV G+VT +  S   Q        VD++ LRA RVLRPL+L+S +PSLQ+VL SI+ A+ PL  I LLVLF IIIF+I+G+  +SG FH  CYN      NV+++    P PC  + + +G Y CD           +CL          ++ GPN GITSFDN+GFAM+TVFQ IT EGWT +MY  +D  G+++ W +FIPL++LGS+F+LNL++G+L G+F KE+ +VE + EF+K ++  +   +   Y +WI   +++I   L E   +TT          +E+   I E        KLK  SK+                                        +L+ Q  ++  +KT+ ++  ++ LVF+N+  +A+E+ GQP   + F  Y+   FL +F +E+LLKLF++G + YF   FN +D ++I  S  E  ++   V     G S++R++RLLR+FKLT +W +L+ +V +++ S++SI+SLL L+ LF++I +LLGMQLFGG+F       Y T+FD   +A+ITVFQ++T E WN  MY  I+  GG YS
Sbjct:    1 MEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSER----PMPCTNKTSPMGVYNCDVKGT-------TCLQ---------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVI---LKED--RTT----------EEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIM--VKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAE--VIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYS 587          

HSP 3 Score: 98.9821 bits (245), Expect = 3.409e-20
Identity = 59/164 (35.98%), Postives = 90/164 (54.88%), Query Frame = 3
Query:  195 PDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD--QGK--VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P  S F+   TN  R+ I  IV TK FE  +M  I  S   +SL    P ++ N  N  L+  +     +FA E ++K+I  G +LH  SY R+FWN+LD I+V   +  +  + T+   GK    IK+LR  RVLRPL+ I ++P L+ V + ++ ++K + N
Sbjct:  696 PYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLS--SVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFN 857          

HSP 4 Score: 90.5077 bits (223), Expect = 1.315e-17
Identity = 64/217 (29.49%), Postives = 119/217 (54.84%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             PQ   D      ++F+ +F +E++LK+ A   R YF  K N FD +V++GS  +VI+        G+  I++ R  R LR+ KL     S+R ++ + +N+  ++  ++ L+ + + I+A++GMQ FG      T    T   +F T   + I + + +TGE W+++M   ++   S+  + SG  G P++  YFI  ++  NY ++N+FLA+ ++
Sbjct:  413 QPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE---VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYT---HFDTFPVALITVFQILTGEDWNEVMYLAIE---SQGGIYSG--GWPYS-IYFIVLVLFGNYTLLNVFLAIAVD 617          

HSP 5 Score: 72.0182 bits (175), Expect = 4.748e-12
Identity = 59/218 (27.06%), Postives = 109/218 (50.00%), Query Frame = 3
Query: 2742 FTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVD---------VEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-AC-------SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDIL-FTNIDAVREYEGPYF 3332
            F   F LE ++ +I++G   HKGSYLR+ +N +DFIVV  G++ ++            V+   L+TLR +RV++ L+ ++    L+ ++ S+   M  + +I L+ L    IF++IG+  + G+F+ AC        ++S+R       T     Y+   +     + W    +   ++DN+   M+T+F   T +G+  ++ +TN      Y   YF
Sbjct:   24 FMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYF 241          

HSP 6 Score: 62.3882 bits (150), Expect = 4.637e-9
Identity = 94/410 (22.93%), Postives = 177/410 (43.17%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMV----DDVYGNSWPW-VFFIPLVILGSYFLLNLIIGILCGQFT-KEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYK----LKAQN----YLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPY-------VLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPF-NIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRV---FKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFI------------------------------SEDGSLYRTNFDDMLIAIITVFQLMTIEGW 2003
            T FD    A++TVFQI+T E W ++MY+       +Y   WP+ ++FI LV+ G+Y LLN+ + I        ++L    + +   EK N  + +     + + ++GD    ++  E             + D ++  +  E+ F           K M PY     L   N     + +I+ T+Y+ ++++ ++ ++S+ +A E    P         + Q+ DY          +  L+    L     + + F NI D I++T ++       T        + ++S+R+LRV    K  K    LK + + +V S+K++ ++L++  LF  I +++ +QLF GKF                                 +  L   N+D+ + A++T+F + T EGW
Sbjct:  550 THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEAD---EKANEIEEESEELDEQY-QEGDHCTIDM--EGKTAGDMCAVARAMDDLDEECEEEESPF--------GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAE---DPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGW 942          

HSP 7 Score: 61.6178 bits (148), Expect = 7.495e-9
Identity = 49/156 (31.41%), Postives = 81/156 (51.92%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            RS F  +  N  +  I ++V +  FE FIM  I  + L L + K Y N    +   +L NT L    +F +ESI+KI+ +G     ++Y R+ WN  DF+ VV  I   +++      V +  LR FR  R +RL+ +  +++I+L + + + K L
Sbjct: 1024 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLIL-MMKYYNNPLFYEEILRLFNTAL--TAVFTVESILKILAFG----VRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKAL 1172          

HSP 8 Score: 52.373 bits (124), Expect = 4.188e-6
Identity = 51/189 (26.98%), Postives = 97/189 (51.32%), Query Frame = 3
Query: 1467 ILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNREMYKGIQ 2030
            I+ ++  N+LI+  +Y   P    +     N     +FT+E +LK+ + G +NYF   +N +DF+ +  S+ + +LV     + +    LR  R  R+ +L +    ++ ++   V+S K++  + LLI +   I +++GMQ+FG  +++    + R  NF     A+I +F+  T EGW   M   +Q
Sbjct: 1052 IMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITD-ALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQ 1239          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 477.248 bits (1227), Expect = 3.599e-138
Identity = 292/760 (38.42%), Postives = 456/760 (60.00%), Query Frame = 3
Query: 2556 SSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDR--YRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMIS------CVDDNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWR-KTSDAVLEEIIPSN---VMNTVTVGKFYATFLIQDFFR 4775
            SS+F  S +N FR+  H ++     + +++ +I  S + +A  +P+     +  +L   DY FT  F  E+++ +I  G++ H GSY R+ +N +D IVV   +        E SA      +K+LRVLRV++ L+TI +  +LK + + V  ++ N++ I+++  LF FIF+VI V  F G F+ C+D +++  + C G +  Y  + +   +V  R W    FNYDN +N M+TLFVV+T +G+  I   ++D   E +GP       +  FY+++ I+  FF +NIF+  ++I++Q+  E+E    +LDKNQK+CI   L ++P   ++P D+   ++RIW+LVTS  F  FI  +I  NT+ + + +  NP    +I  +FN     +FT+E ILKI+AF  RNYF D  N FDF+ V+GS  D +         G  + +   RLFR+ RL++LL +  +IR +LWTF+ +F  LP+V LL+ M+ +IYAI+GMQ FG I LN   +EI  +NNFQ+ FN+ I+L RC TGE W  IM++      C     +      G TCG+  +Y YF SF+ LS++L++NLF+AVI++ FDYLT+DSS LGPHHL+ FI  W+ YD  A GRI   ++ ++L  + PP+GFGK CP     + L+ MNMP+ +DGT+ F  TLFAL+R +L IK+    + ++ ++E +EELRL +K++W  K    +++ ++P N       +TVGK YA  LI + +R
Sbjct:  698 SSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYD-NQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTE----FGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLN-AATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKM----RPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYR 1447          

HSP 2 Score: 311.612 bits (797), Expect = 2.997e-85
Identity = 242/626 (38.66%), Postives = 366/626 (58.47%), Query Frame = 3
Query:  324 LTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYI-LSVTDQ------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN------NVTKQRMSNPKPCNPRANSLG-YLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPY------------------------------------KLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            + +  P ND   L++ LE TE   + IF +E ++K+I +GF LH  SYLR+ WN++DFI+VV G+VT +  S   Q        VD++ LRA RVLRPL+L+S +PSLQ+VL SI+ A+ PL  I LLVLF IIIF+I+G+  +SG FH  CYN      NV+++    P PC  + + +G Y CD        +  +CL          ++ GPN GITSFDN+GFAM+TVFQ IT EGWT +MY  +D  G+++ W +FIPL++LGS+F+LNL++G+L G+F KE+ +VE + EF+K ++  +   +   Y +WI   +++I   L E   +TT          +E+   I E        KLK  SK+                                        +L+ Q  ++  +KT+ ++  ++ LVF+N+  +A+E+ GQP   + F  Y+   FL +F +E+LLKLF++G + YF   FN +D ++I  S  E+ +         G S++R++RLLR+FKLT +W +L+ +V +++ S++SI+SLL L+ LF++I +LLGMQLFGG+F       Y T+FD   +A+ITVFQ++T E WN  MY  I+  GG YS
Sbjct:    1 MEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSER----PMPCTNKTSPMGVYNCDV-------KGTTCLQ---------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVI---LKED--RTT----------EEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIM--VKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEV-IWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYS 587          

HSP 3 Score: 99.3673 bits (246), Expect = 2.357e-20
Identity = 58/160 (36.25%), Postives = 88/160 (55.00%), Query Frame = 3
Query:  195 PDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD--QGK--VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIK 662
            P  S F+   TN  R+ I  IV TK FE  +M  I  S   +SL    P ++ N  N  L+  +     +FA E ++K+I  G +LH  SY R+FWN+LD I+V   +  +  + T+   GK    IK+LR  RVLRPL+ I ++P L+ V + ++ ++K
Sbjct:  696 PYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLS--SVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLK 853          

HSP 4 Score: 92.4337 bits (228), Expect = 3.169e-18
Identity = 64/217 (29.49%), Postives = 119/217 (54.84%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             PQ   D      ++F+ +F +E++LK+ A   R YF  K N FD +V++GS  +VI+        G+  I++ R  R LR+ KL     S+R ++ + +N+  ++  ++ L+ + + I+A++GMQ FG      T    T   +F T   + I + + +TGE W+++M   ++   S+  + SG  G P++  YFI  ++  NY ++N+FLA+ ++
Sbjct:  413 QPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE---VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYT---HFDTFPVALITVFQILTGEDWNEVMYLAIE---SQGGIYSG--GWPYS-IYFIVLVLFGNYTLLNVFLAIAVD 617          

HSP 5 Score: 71.2478 bits (173), Expect = 8.332e-12
Identity = 59/218 (27.06%), Postives = 109/218 (50.00%), Query Frame = 3
Query: 2742 FTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVD---------VEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-AC-------SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDIL-FTNIDAVREYEGPYF 3332
            F   F LE ++ +I++G   HKGSYLR+ +N +DFIVV  G++ ++            V+   L+TLR +RV++ L+ ++    L+ ++ S+   M  + +I L+ L    IF++IG+  + G+F+ AC        ++S+R       T     Y+   +     + W    +   ++DN+   M+T+F   T +G+  ++ +TN      Y   YF
Sbjct:   24 FMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYF 241          

HSP 6 Score: 62.003 bits (149), Expect = 5.807e-9
Identity = 49/156 (31.41%), Postives = 81/156 (51.92%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            RS F  +  N  +  I ++V +  FE FIM  I  + L L + K Y N    +   +L NT L    +F +ESI+KI+ +G     ++Y R+ WN  DF+ VV  I   +++      V +  LR FR  R +RL+ +  +++I+L + + + K L
Sbjct: 1024 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLIL-MMKYYNNPLFYEEILRLFNTAL--TAVFTVESILKILAFG----VRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKAL 1172          

HSP 7 Score: 61.6178 bits (148), Expect = 6.929e-9
Identity = 94/410 (22.93%), Postives = 177/410 (43.17%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMV----DDVYGNSWPW-VFFIPLVILGSYFLLNLIIGILCGQFT-KEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYK----LKAQN----YLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPY-------VLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPF-NIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRV---FKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFI------------------------------SEDGSLYRTNFDDMLIAIITVFQLMTIEGW 2003
            T FD    A++TVFQI+T E W ++MY+       +Y   WP+ ++FI LV+ G+Y LLN+ + I        ++L    + +   EK N  + +     + + ++GD    ++  E             + D ++  +  E+ F           K M PY     L   N     + +I+ T+Y+ ++++ ++ ++S+ +A E    P         + Q+ DY          +  L+    L     + + F NI D I++T ++       T        + ++S+R+LRV    K  K    LK + + +V S+K++ ++L++  LF  I +++ +QLF GKF                                 +  L   N+D+ + A++T+F + T EGW
Sbjct:  550 THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEAD---EKANEIEEESEELDEQY-QEGDHCTIDM--EGKTAGDMCAVARAMDDLDEECEEEESPF--------GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAE---DPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGW 942          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Match: unc-2 (High voltage activated calcium channel alpha-1 subunit [Source:UniProtKB/TrEMBL;Acc:Q86G45])

HSP 1 Score: 478.019 bits (1229), Expect = 3.960e-138
Identity = 292/760 (38.42%), Postives = 456/760 (60.00%), Query Frame = 3
Query: 2556 SSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDR--YRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMIS------CVDDNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWR-KTSDAVLEEIIPSN---VMNTVTVGKFYATFLIQDFFR 4775
            SS+F  S +N FR+  H ++     + +++ +I  S + +A  +P+     +  +L   DY FT  F  E+++ +I  G++ H GSY R+ +N +D IVV   +        E SA      +K+LRVLRV++ L+TI +  +LK + + V  ++ N++ I+++  LF FIF+VI V  F G F+ C+D +++  + C G +  Y  + +   +V  R W    FNYDN +N M+TLFVV+T +G+  I   ++D   E +GP       +  FY+++ I+  FF +NIF+  ++I++Q+  E+E    +LDKNQK+CI   L ++P   ++P D+   ++RIW+LVTS  F  FI  +I  NT+ + + +  NP    +I  +FN     +FT+E ILKI+AF  RNYF D  N FDF+ V+GS  D +         G  + +   RLFR+ RL++LL +  +IR +LWTF+ +F  LP+V LL+ M+ +IYAI+GMQ FG I LN   +EI  +NNFQ+ FN+ I+L RC TGE W  IM++      C     +      G TCG+  +Y YF SF+ LS++L++NLF+AVI++ FDYLT+DSS LGPHHL+ FI  W+ YD  A GRI   ++ ++L  + PP+GFGK CP     + L+ MNMP+ +DGT+ F  TLFAL+R +L IK+    + ++ ++E +EELRL +K++W  K    +++ ++P N       +TVGK YA  LI + +R
Sbjct:  789 SSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYD-NQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTE----FGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLN-AATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKM----RPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYR 1538          

HSP 2 Score: 332.028 bits (850), Expect = 1.716e-91
Identity = 257/670 (38.36%), Postives = 388/670 (57.91%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYI-LSVTDQ------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN------NVTKQRMSNPKPCNPRANSLG-YLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPY------------------------------------KLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            K   S F F + N +R     I+    FE FI++ I  +C+ LS+ +  P ND   L++ LE TE   + IF +E ++K+I +GF LH  SYLR+ WN++DFI+VV G+VT +  S   Q        VD++ LRA RVLRPL+L+S +PSLQ+VL SI+ A+ PL  I LLVLF IIIF+I+G+  +SG FH  CYN      NV+++    P PC  + + +G Y CD        +  +CL          ++ GPN GITSFDN+GFAM+TVFQ IT EGWT +MY  +D  G+++ W +FIPL++LGS+F+LNL++G+L G+F KE+ +VE + EF+K ++  +   +   Y +WI   +++I   L E   +TT          +E+   I E        KLK  SK+                                        +L+ Q  ++  +KT+ ++  ++ LVF+N+  +A+E+ GQP   + F  Y+   FL +F +E+LLKLF++G + YF   FN +D ++I  S  E+ +         G S++R++RLLR+FKLT +W +L+ +V +++ S++SI+SLL L+ LF++I +LLGMQLFGG+F       Y T+FD   +A+ITVFQ++T E WN  MY  I+  GG YS
Sbjct:   48 KGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSER----PMPCTNKTSPMGVYNCDV-------KGTTCLQ---------KWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVI---LKED--RTT----------EEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIM--VKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEV-IWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY-THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYS 678          

HSP 3 Score: 99.3673 bits (246), Expect = 2.284e-20
Identity = 58/160 (36.25%), Postives = 88/160 (55.00%), Query Frame = 3
Query:  195 PDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD--QGK--VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIK 662
            P  S F+   TN  R+ I  IV TK FE  +M  I  S   +SL    P ++ N  N  L+  +     +FA E ++K+I  G +LH  SY R+FWN+LD I+V   +  +  + T+   GK    IK+LR  RVLRPL+ I ++P L+ V + ++ ++K
Sbjct:  787 PYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLS--SVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLK 944          

HSP 4 Score: 92.8189 bits (229), Expect = 2.821e-18
Identity = 64/217 (29.49%), Postives = 119/217 (54.84%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             PQ   D      ++F+ +F +E++LK+ A   R YF  K N FD +V++GS  +VI+        G+  I++ R  R LR+ KL     S+R ++ + +N+  ++  ++ L+ + + I+A++GMQ FG      T    T   +F T   + I + + +TGE W+++M   ++   S+  + SG  G P++  YFI  ++  NY ++N+FLA+ ++
Sbjct:  504 QPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAE---VYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYT---HFDTFPVALITVFQILTGEDWNEVMYLAIE---SQGGIYSG--GWPYS-IYFIVLVLFGNYTLLNVFLAIAVD 708          

HSP 5 Score: 88.5817 bits (218), Expect = 5.370e-17
Identity = 77/292 (26.37%), Postives = 143/292 (48.97%), Query Frame = 3
Query: 2538 ANIPI----ASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI--LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVD---------VEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-AC-------SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDIL-FTNIDAVREYEGPYF 3332
            +N P+     SSLFIF++ N  R     +I     +  +L+ I+ +C++++    L  N  +A    L   +  F   F LE ++ +I++G   HKGSYLR+ +N +DFIVV  G++ ++            V+   L+TLR +RV++ L+ ++    L+ ++ S+   M  + +I L+ L    IF++IG+  + G+F+ AC        ++S+R       T     Y+   +     + W    +   ++DN+   M+T+F   T +G+  ++ +TN      Y   YF
Sbjct:   41 SNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYF 332          

HSP 6 Score: 62.003 bits (149), Expect = 6.514e-9
Identity = 49/156 (31.41%), Postives = 81/156 (51.92%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            RS F  +  N  +  I ++V +  FE FIM  I  + L L + K Y N    +   +L NT L    +F +ESI+KI+ +G     ++Y R+ WN  DF+ VV  I   +++      V +  LR FR  R +RL+ +  +++I+L + + + K L
Sbjct: 1115 RSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLIL-MMKYYNNPLFYEEILRLFNTAL--TAVFTVESILKILAFG----VRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKAL 1263          

HSP 7 Score: 61.6178 bits (148), Expect = 6.681e-9
Identity = 94/410 (22.93%), Postives = 177/410 (43.17%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMV----DDVYGNSWPW-VFFIPLVILGSYFLLNLIIGILCGQFT-KEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYK----LKAQN----YLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPY-------VLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPF-NIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRV---FKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFI------------------------------SEDGSLYRTNFDDMLIAIITVFQLMTIEGW 2003
            T FD    A++TVFQI+T E W ++MY+       +Y   WP+ ++FI LV+ G+Y LLN+ + I        ++L    + +   EK N  + +     + + ++GD    ++  E             + D ++  +  E+ F           K M PY     L   N     + +I+ T+Y+ ++++ ++ ++S+ +A E    P         + Q+ DY          +  L+    L     + + F NI D I++T ++       T        + ++S+R+LRV    K  K    LK + + +V S+K++ ++L++  LF  I +++ +QLF GKF                                 +  L   N+D+ + A++T+F + T EGW
Sbjct:  641 THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEAD---EKANEIEEESEELDEQY-QEGDHCTIDM--EGKTAGDMCAVARAMDDLDEECEEEESPF--------GGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAE---DPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGW 1033          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332021)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 360/789 (45.63%), Postives = 523/789 (66.29%), Query Frame = 3
Query: 2493 ITPEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFM---------------------NQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IT    ++ E+    K+  IP  +S F+FSQ+N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct:  806 ITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 1587          

HSP 2 Score: 408.683 bits (1049), Expect = 2.279e-115
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:   97 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 693          

HSP 3 Score: 114.39 bits (285), Expect = 9.566e-25
Identity = 77/265 (29.06%), Postives = 140/265 (52.83%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+  +++  YF
Sbjct:  101 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYF 365          

HSP 4 Score: 94.7449 bits (234), Expect = 9.120e-19
Identity = 59/162 (36.42%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P  S F F +TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct:  825 IPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 982          

HSP 5 Score: 86.2705 bits (212), Expect = 2.961e-16
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct:  520 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 741          

HSP 6 Score: 56.9954 bits (136), Expect = 2.543e-7
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1049 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1382          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090003)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 360/789 (45.63%), Postives = 523/789 (66.29%), Query Frame = 3
Query: 2493 ITPEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN---------------------QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IT    ++ E+    K+  IP  +S F+FSQ+N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct: 1299 ITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 2080          

HSP 2 Score: 408.297 bits (1048), Expect = 6.112e-115
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:  590 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 1186          

HSP 3 Score: 113.62 bits (283), Expect = 1.608e-24
Identity = 75/256 (29.30%), Postives = 135/256 (52.73%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+
Sbjct:  594 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAM 849          

HSP 4 Score: 94.7449 bits (234), Expect = 9.013e-19
Identity = 59/162 (36.42%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P  S F F +TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct: 1318 IPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 1475          

HSP 5 Score: 85.8853 bits (211), Expect = 4.257e-16
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct: 1013 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 1234          

HSP 6 Score: 56.6102 bits (135), Expect = 3.523e-7
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1542 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1875          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332022)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 360/789 (45.63%), Postives = 523/789 (66.29%), Query Frame = 3
Query: 2493 ITPEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFM---------------------NQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IT    ++ E+    K+  IP  +S F+FSQ+N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct:  806 ITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 1587          

HSP 2 Score: 407.912 bits (1047), Expect = 1.357e-115
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:   97 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 693          

HSP 3 Score: 114.39 bits (285), Expect = 9.563e-25
Identity = 77/265 (29.06%), Postives = 140/265 (52.83%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+  +++  YF
Sbjct:  101 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYF 365          

HSP 4 Score: 94.3597 bits (233), Expect = 1.063e-18
Identity = 59/162 (36.42%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P  S F F +TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct:  825 IPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 982          

HSP 5 Score: 85.8853 bits (211), Expect = 3.737e-16
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct:  520 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 741          

HSP 6 Score: 56.9954 bits (136), Expect = 2.097e-7
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1049 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1382          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0332024)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 361/796 (45.35%), Postives = 525/796 (65.95%), Query Frame = 3
Query: 2472 NIDEKLKITPEINKLLE--LKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFM---------------------NQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            N +   ++T    +L E  +K+    IP  S+ FIFS +N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct:  802 NSEVSARVTARPRRLSEVSMKKTKKPIPRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 1590          

HSP 2 Score: 408.297 bits (1048), Expect = 2.923e-115
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:   97 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 693          

HSP 3 Score: 114.005 bits (284), Expect = 1.123e-24
Identity = 77/265 (29.06%), Postives = 140/265 (52.83%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+  +++  YF
Sbjct:  101 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYF 365          

HSP 4 Score: 90.5077 bits (223), Expect = 1.737e-17
Identity = 59/161 (36.65%), Postives = 88/161 (54.66%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P  S F+ F  TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct:  829 PRGSAFFIFSYTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 985          

HSP 5 Score: 86.2705 bits (212), Expect = 3.115e-16
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct:  520 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 741          

HSP 6 Score: 56.9954 bits (136), Expect = 2.675e-7
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1052 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1385          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Match: Ca-alpha1D (gene:FBgn0001991 transcript:FBtr0090006)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 360/789 (45.63%), Postives = 523/789 (66.29%), Query Frame = 3
Query: 2493 ITPEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN---------------------QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IT    ++ E+    K+  IP  +S F+FSQ+N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct: 1299 ITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 2080          

HSP 2 Score: 407.912 bits (1047), Expect = 1.081e-114
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:  590 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 1186          

HSP 3 Score: 113.235 bits (282), Expect = 1.981e-24
Identity = 75/256 (29.30%), Postives = 135/256 (52.73%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+
Sbjct:  594 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAM 849          

HSP 4 Score: 94.3597 bits (233), Expect = 1.007e-18
Identity = 59/162 (36.42%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P  S F F +TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct: 1318 IPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 1475          

HSP 5 Score: 85.8853 bits (211), Expect = 4.589e-16
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct: 1013 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 1234          

HSP 6 Score: 55.4546 bits (132), Expect = 6.404e-7
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1542 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1875          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 349/765 (45.62%), Postives = 510/765 (66.67%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P+I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  IL  FDY FT  FT+E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNTI +++      +L N + DI N +F  +FT+E++LK+IAF  R+YF D  N FD ++V+GS VD+         D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ +  ++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  789 PKISELVK-KEKITPIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYIMYKEGDVNQPIIQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDH-TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1545          

HSP 2 Score: 374.015 bits (959), Expect = 3.331e-104
Identity = 271/686 (39.50%), Postives = 393/686 (57.29%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSV---------------------TDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI-----------------INELLDESSVKTTFEIQDN------LIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYK----------LKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L V                        G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H +CY   T      P PC    N  G  C      P+          N +L    + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I                 +  L+++      +  Q +         + E  N   E   D        T +K+   K          L  +N  L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L +FT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   43 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPCA--VNGHGRTC------PI----------NGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPENEEEEEESKRNRVTLASLMEKKKKGFGWFSQSSDTHASMPASETESMNTENEKGEDEKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 707          

HSP 3 Score: 90.5077 bits (223), Expect = 2.011e-17
Identity = 75/295 (25.42%), Postives = 139/295 (47.12%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL------------VDVEMSA-----------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L            V   +SA           +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      +DI +     C       A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   50 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPC-------AVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 337          

HSP 4 Score: 84.3445 bits (207), Expect = 1.815e-15
Identity = 77/299 (25.75%), Postives = 135/299 (45.15%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     IF +E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y   ++ N P+ Q       +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  796 KKEKITPI--PEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYIMYKEGDV-NQPIIQK---RHWHNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1055          

HSP 5 Score: 80.1073 bits (196), Expect = 2.749e-14
Identity = 60/219 (27.40%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + +FT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  531 QPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 737          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 348/776 (44.85%), Postives = 511/776 (65.85%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN----QEPAVD--------GALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P+I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  +L   DY+FT  FT E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNTI +++      +L N + DI N +F  +FT+E++LK+IAF  R+YF D  N FD ++V+GS VD+        + P VD          + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ +  ++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  764 PKISELVK-KEKITPIPEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYIMYKEGDVNQPIIQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENMGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLILLNTICLAVQHYGQSELFNYVMDILNMVFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDH-TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMPGKLCDPESDYNPGEEMTCGSSFAIIYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1531          

HSP 2 Score: 380.178 bits (975), Expect = 3.681e-106
Identity = 266/661 (40.24%), Postives = 393/661 (59.46%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSV---------------------TDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI-----INELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPY-KLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L V                        G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H +CY   T      P PC    N  G  C      P+          N +L    + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I       E   + +        +++  ++E+              K+  +  S++   + +L  +N  L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L +FT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   43 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPC--AVNGHGRTC------PI----------NGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGLELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPENEEEEEESKRNPSMPASETESMNTENEKGEDEKATCCGPTCQKISKSKFSRRWRRWNRLCRRNCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 682          

HSP 3 Score: 90.8929 bits (224), Expect = 1.800e-17
Identity = 75/295 (25.42%), Postives = 139/295 (47.12%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL------------VDVEMSA-----------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L            V   +SA           +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      +DI +     C       A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   50 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYVPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKEGGEKEEVGENLSAHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHASCYFQGTDILEDEPAPC-------AVNGHGRTCPINGTLCKEGWQGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 337          

HSP 4 Score: 81.6481 bits (200), Expect = 9.834e-15
Identity = 77/301 (25.58%), Postives = 135/301 (44.85%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQV--WSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     +F  E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y   ++ N P+ Q   W     +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  771 KKEKITPI--PEGSAFFIFSNTNPVRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYIMYKEGDV-NQPIIQKRHW-----HNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1030          

HSP 5 Score: 80.4925 bits (197), Expect = 2.461e-14
Identity = 60/219 (27.40%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + +FT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  506 QPMWLTQVQDVANKVLLAMFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVEFE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 712          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1sa (calcium channel, voltage-dependent, L type, alpha 1S subunit, a [Source:ZFIN;Acc:ZDB-GENE-090514-1])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 358/785 (45.61%), Postives = 511/785 (65.10%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--MNQEPAVDGAL-----------------------RINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG-------TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L+LK+    +P AS+ F+F   NKFR  CHR+IN +    I+L+ I+ S I +A  +P+ P + +  +L   DY+FT  FT E+++ M +YG   HKGS+ RN+FN +D IVV + +L + +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+ +L  F+F+ IGV  FKG F  C+D  + T + C+GT+I +  +  +   V  R W N+  N+DNVLNGM+ LF VSTF+G+ D+L+  ID+  E  GP +NN+  I  F+++YLI+  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +FL+I+LNT+ + +   K    I D++D  N IF  LFT+E+ILK+ AF  + YF D  N+FDF++V+GS VDVI   ++   A  G L                        I +FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIAL + G+ I  NNNFQT   + ++L RC TGE WH+IM+ C+     RC   S        TCG+ FA  YF+SF +L  +LI+NLF+AVI++ FDYLT+D S LGP HL+ F + W+ YD  A GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP+   + VTVGKFYATFLIQD FR
Sbjct:  776 LQLKETEVPMPEASAFFLFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADYVFTSVFTAEIVLKMTTYGAFLHKGSFCRNSFNILDLIVVGVSLLSMGMESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFLYCTDPLKMTAEECQGTFIQHQENALHDMVVSQRLWMNSDLNFDNVLNGMLALFTVSTFEGWPDLLYKAIDSNLENMGPVYNNHIEISIFFIVYLILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCKQSDHITDLADTLNVIFTVLFTVEMILKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDAALAAQGGLYCLTGCSEVNPMQAIADSENMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALLD-GTIINRNNNFQTFPQAVLLLFRCATGEGWHEIMLGCL--YGQRCDPKSEYLPGEEYTCGSGFAILYFMSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPQHLDEFKKIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLISMNMPLNSDGTVTFNATLFALVRTGLKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPALGDDEVTVGKFYATFLIQDHFR 1551          

HSP 2 Score: 399.053 bits (1024), Expect = 1.107e-112
Identity = 245/635 (38.58%), Postives = 391/635 (61.57%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN----VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P RS  +    N  R     IV  K FE  I++ IF +C+ L++    P  D+N+ N  LE+ E   ++IF +E  +KI+ YGF+ HA +YLRN WN+LDF+IV +G+ T ++            V  +G  D+KALRAFRVLRPLRL+S +PSLQ+V++SI+ ++ PL +I LLV F++ I++I+G+ LF    H TCY+     +     +   PC    N  G  C                  N +     +PGPN GIT FDN+GF+MLTV+Q IT +GWTD++Y V+D  G  WPW++F+ L++LGS+F+LNL++G+LCG+FTKE+ K  R  E+  ++E+Q     +D   Y +WI Q + + N+   +  +          + D  +   +YE ++ ++++  ++   +    ++ K + +    +K++ ++ ++++LVF N+L +ATE+  QP  L+ FQD +N   L LF +E+ LK++++G  +YF+  FN +D  +++V ++E+ LV  +VM+ +G S+LR +RLLR+ K+T+HW  L  +V +++ S++SI SLLLL+ LF++I +LLGMQ+FGGKF   D  + R+NFD+   A+ITVFQ++T EGWN  MY GI   GG
Sbjct:   38 RPARSLLFLTLKNPFRKACINIVEWKPFEIIILLTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTMECFLKIVAYGFLFHADAYLRNCWNILDFVIVTMGLFTVVVDFINSISGVEAPVEQKGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYHTGTDIIATGDDAQAAPCAQAGN--GRRCT----------------LNGTECRGDWPGPNNGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYFVTLILLGSFFILNLVLGVLCGEFTKEREKSSRSGEYQILRERQQFD--EDLKGYMEWITQAEVMDNDQEGQGLLP---------LQDGSETETLYELDILNKLMFYVRHARRWNRFFRRKCRVW----VKSKLFYWLVILLVFFNTLAIATEHHQQPDSLTNFQDNTNKALLSLFAVEMFLKMYAMGLPSYFMSLFNRFDCFVVSVGILELILVRMDVMSVMGISVLRCIRLLRIIKITRHWTTLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDDRVRRSNFDNFPQALITVFQILTGEGWNYVMYDGIMAHGG 639          

HSP 3 Score: 142.51 bits (358), Expect = 2.982e-33
Identity = 163/686 (23.76%), Postives = 316/686 (46.06%), Query Frame = 3
Query: 2469 FNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL----------VDVEMSA---LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQF-----KGSFYACSDISQRTEDNCKGTYIYYAYDG---SYQAKVMNRTW---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEE--------------------------LDKNQKKCIALILK--------------SKPIF------RYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
            F +DE+     +  KL +L+    N   A SL   +  N FR  C  ++     + I+L+ I ++C+ +A F P+    T     N+   +YIF + FT+E  + +++YG +FH  +YLRN +N +DF++V +G+  V++            VE      +K LR  RV++ LR ++    L+ +++S+  +M  ++ I L+      I+++IG+  F     K  ++  +DI   T D+ +      A +G   +         W   +N   ++DN+   M+T++   T QG+ D+L+   DA+  E+   YF          +  +++  FF++N+ +G +   + + RE   +S E                          +D +Q+    L L+              +K +F      R+    R + R+W  V S+ F   + L++  NT+ ++    + P  + +  D  N   + LF +E+ LK+ A    +YF    N FD  VV    +++I +  +  V   + I++ R  R LR++K+     ++  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG     N   +    +NF     + I + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:   12 FIMDEETLKRKQREKLKKLQATGGNPRPARSLLFLTLKNPFRKACINIVEWKPFEIIILLTIFANCVALAVFMPMPEEDTNNTNSNLESLEYIFLIIFTMECFLKIVAYGFLFHADAYLRNCWNILDFVIVTMGLFTVVVDFINSISGVEAPVEQKGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHISLLVFFMVTIYAIIGLELFKCKMHKTCYHTGTDIIA-TGDDAQAAPCAQAGNGRRCTLNGTECRGDWPGPNNGITHFDNLGFSMLTVYQCITTQGWTDVLYWVNDAIGMEWPWLYF----------VTLILLGSFFILNLVLGVLCGEFTKEREKSSRSGEYQILRERQQFDEDLKGYMEWITQAEVMDNDQEGQGLLPLQDGSETETLYELDILNKLMFYVRHARRWNRFFRRKCRVW--VKSKLFYWLVILLVFFNTLAIATEHHQQPDSLTNFQDNTNKALLSLFAVEMFLKMYAMGLPSYFMSLFNRFDCFVVSVGILELILVRMD--VMSVMGISVLRCIRLLRIIKITRHWTTLSNLVASLLNSVRSIASLLLLLFLFIVIFALLGMQVFG--GKFNFPDDRVRRSNFDNFPQALITVFQILTGEGWNYVMYDGI--------MAHGGPAIPGILVSIYFIILFICGNYILLNVFLAIAVD 672          

HSP 4 Score: 78.9518 bits (193), Expect = 6.114e-14
Identity = 50/161 (31.06%), Postives = 80/161 (49.69%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F   N+ R    +I+N   F   I++ I  S   +SL    P +  +  N  L   +     +F  E ++K+  YG  LH  S+ RN +N+LD I+V  G+    + +       +K LR  RVLRPLR I++   L+ V+  + +AIK + N
Sbjct:  786 PEASAFFLFGPQNKFRKLCHRIINATTFTNIILLFILLS--SISLAAEDPIDPMSFRNQVLAYADYVFTSVFTAEIVLKMTTYGAFLHKGSFCRNSFNILDLIVV--GVSLLSMGMESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGN 942          

HSP 5 Score: 70.8626 bits (172), Expect = 2.005e-11
Identity = 118/447 (26.40%), Postives = 200/447 (44.74%), Query Frame = 3
Query:  915 FPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWV-------FFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKE-------KQNLKDTDD---YLFYKDWIEQGDKI----------INELLDESSV---KTTFEIQDNLIVDDEQNNKIYENVFDRILG--KLKSTSKKMEPYKL--------KAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVL-SQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIK-PFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFI-------------------SEDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            FP   +  ++FDN   A++TVFQI+T EGW  +MY  D +  +  P +       +FI L I G+Y LLN+ + I      + +     Q E  +E       ++NL D  +    L  K   EQ  KI          ++E   ES+V   K  F   D    D+E+  +I  +   R +   +LK T   M             K +     II    +  +IL+ + ++S+ +A E    P    +Q   Y++  F  +FT E++LK+ + G    K  F +  FNI D I++ VS++ M +  + +       ILR +R+LR  +       LK +V  +  +IK+I +++L+ +L   + + +G+QLF GKF+                    ++ +L+              NFD++L  ++ +F + T EGW   +YK I
Sbjct:  597 FPDDRVRRSNFDNFPQALITVFQILTGEGWNYVMY--DGIMAHGGPAIPGILVSIYFIILFICGNYILLNVFLAIAVDNLAEAESLTSAQKEKAEEKKRKRLLRENLPDKGEEEKALLAKKLAEQRAKIDGIPTTAKLKVDEF--ESNVNEIKDPFPPADFPGDDEEEEPEIPLSPRPRPMADLQLKETEVPMPEASAFFLFGPQNKFRKLCHRIINATTFTNIILLFILLSSISLAAEDPIDPMSFRNQVLAYADYVFTSVFTAEIVLKMTTYGAFLHKGSFCRNSFNILDLIVVGVSLLSMGMESSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKFLYCTDPLKMTAEECQGTFIQHQENALHDMVVSQRLWMNSDLNFDNVLNGMLALFTVSTFEGWPDLLYKAI 1036          

HSP 6 Score: 52.7582 bits (125), Expect = 5.897e-6
Identity = 65/272 (23.90%), Postives = 132/272 (48.53%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSL--------------------------VITNVMN-QIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSL--YRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            EQ  + Y+N       +L    ++   Y LKA            Q  +  I+ + Y+  ++ +L+ +N++ +  ++  Q   ++   D  N+ F +LFT+E++LKL +   K YF  P+N++DF+I+  S++++ L                           I +  N  +  ++ R  R++R+ KL   ++ ++ ++   ++S +++  + LLIV+   I +++GMQ+F GK    DG++     NF     A++ +F+  T EGW+  M
Sbjct: 1082 EQGEQEYKNC------ELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSCYFEYLMFLLIMLNTMCLGMQHCKQSDHITDLADTLNVIFTVLFTVEMILKLGAFKAKGYFGDPWNVFDFVIVVGSIVDVILSEIDAALAAQGGLYCLTGCSEVNPMQAIADSENMSVSITLFRLFRVMRLVKLLNRFEGIRNLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVF-GKIALLDGTIINRNNNFQTFPQAVLLLFRCATGEGWHEIM 1346          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 351/777 (45.17%), Postives = 513/777 (66.02%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPA------------------VDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            ++LK+K   +P A + FIFS SNKFR+ CH+++NH++   ++L  I+ S I +A  +P++ ++ +  IL   DY+FT  FT+E+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG F+ C+D S++T+  C+G YI Y      + +   R+W N+ FN+D+VL GMM LF VSTF+G+  +L+  ID+  E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y++++W +V S  F   +F +I+LNTI +++      Q  N   +I N +F  LFT+E+ILK+IAF  R+YF D  N FD ++V+GS VD+      PA                   +   RI+I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIAL +  S+I  NNNFQT   + ++L RC TGE W +IM++C      +  S    SS  CG+ FA FYF+SF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR I+K++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  877 IQLKEKAVPMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFFYCTDTSKQTQAECRGAYILYKDGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDN-SQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1646          

HSP 2 Score: 375.17 bits (962), Expect = 1.728e-104
Identity = 269/661 (40.70%), Postives = 396/661 (59.91%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGK-----------VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC--YNNVTKQRMSN--PKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDES-----------------SVKTTFEIQDNLIVDDEQNNKIYENVFDRIL-GKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +G             D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC  Y +  K  ++   P PC P +++ G  C + PN     +  C+         + + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y + D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I  E  DE                  SV T     DN    D +       + +RI   K    S++   +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L+  QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:  100 KKQASTASTRPPRALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAP-SSAHGRHC-SPPN-----ITQCM---------MGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMPASENESVNT-----DNAPAGDMEGETCCTRMANRISKSKFSRYSRR---WNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE--TRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 732          

HSP 3 Score: 91.6633 bits (226), Expect = 9.050e-18
Identity = 71/284 (25.00%), Postives = 131/284 (46.13%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-AC--------SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQ---FNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++ H  +YLRN +N +DFI+V +G+   IL                    +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +  C          I++     C  +  +  +            W        N+DN    M+T+F   T +G+ D+L+   DA+  YE P+
Sbjct:  113 ALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAM-GYELPW 395          

HSP 4 Score: 79.337 bits (194), Expect = 6.007e-14
Identity = 59/220 (26.82%), Postives = 115/220 (52.27%), Query Frame = 3
Query: 3648 KNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + P+ + ++ DI N + + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG    N   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  560 QQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGG-KFNFDETRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 765          

HSP 5 Score: 75.0998 bits (183), Expect = 9.724e-13
Identity = 52/163 (31.90%), Postives = 82/163 (50.31%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLD-----FIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            ++ F F  +N+ R+   KIVN   F   I+  I  S   +SL    P  + +  N  L   +     IF IE I+K+  YG  LH  S+ RN++N+LD       ++  GI +  ++V       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  890 KAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLS--SISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 1043          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 352/805 (43.73%), Postives = 514/805 (63.85%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF-----------------------------------------------MNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            ++LK+K   +P A + FIFS SNKFR+ CH+++NH++   ++L  I+ S I +A  +P++ ++ +  IL   DY+FT  FT+E+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG F+ C+D S++T+  C+G YI Y      + +   R+W N+ FN+D+VL GMM LF VSTF+G+  +L+  ID+  E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y++++W +V S  F   +F +I+LNTI +++      Q  N   +I N +F  LFT+E+ILK+IAF  R YF D  N+FDF++V+GS +DVI                                                M  +   D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIAL +  S+I  NNNFQT   + ++L RC TGE W +IM++C      +  S    SS  CG+ FA FYF+SF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR I+K++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  877 IQLKEKAVPMPQAKAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTSLLQFMFACIGVQLFKGKFFYCTDTSKQTQAECRGAYILYKDGNVGKPEKAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSQSFNKAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINHYFVDAWNTFDALIVVGSVVDIAITEVNPADPSSSPPSSVVRPMGLQNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALRDN-SQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEINHSSEDCGSHFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1674          

HSP 2 Score: 375.17 bits (962), Expect = 1.486e-104
Identity = 269/661 (40.70%), Postives = 396/661 (59.91%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGK-----------VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC--YNNVTKQRMSN--PKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDES-----------------SVKTTFEIQDNLIVDDEQNNKIYENVFDRIL-GKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +G             D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC  Y +  K  ++   P PC P +++ G  C + PN     +  C+         + + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y + D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I  E  DE                  SV T     DN    D +       + +RI   K    S++   +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L+  QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:  100 KKQASTASTRPPRALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAP-SSAHGRHC-SPPN-----ITQCM---------MGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSMPASENESVNT-----DNAPAGDMEGETCCTRMANRISKSKFSRYSRR---WNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE--TRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 732          

HSP 3 Score: 92.0485 bits (227), Expect = 7.933e-18
Identity = 71/284 (25.00%), Postives = 131/284 (46.13%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-AC--------SDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQ---FNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++ H  +YLRN +N +DFI+V +G+   IL                    +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +  C          I++     C  +  +  +            W        N+DN    M+T+F   T +G+ D+L+   DA+  YE P+
Sbjct:  113 ALLCLTLKNPIRRACINIVEWKPFEIIILMTIFANCVALAVYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTSMGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFFYKDGHKGHIAEEKPAPCAPSSAHGRHCSPPNITQCMMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAM-GYELPW 395          

HSP 4 Score: 79.337 bits (194), Expect = 5.822e-14
Identity = 59/220 (26.82%), Postives = 115/220 (52.27%), Query Frame = 3
Query: 3648 KNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + P+ + ++ DI N + + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG    N   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  560 QQPEWLTNVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDSFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGG-KFNFDETRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 765          

HSP 5 Score: 75.485 bits (184), Expect = 8.447e-13
Identity = 52/163 (31.90%), Postives = 82/163 (50.31%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLD-----FIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            ++ F F  +N+ R+   KIVN   F   I+  I  S   +SL    P  + +  N  L   +     IF IE I+K+  YG  LH  S+ RN++N+LD       ++  GI +  ++V       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  890 KAFFIFSPSNKFRVLCHKIVNHNIFTNLILFFILLS--SISLAAEDPVKNDSFRNQILGYADYVFTGIFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 1043          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: frrs1l (ferric-chelate reductase 1-like [Source:Xenbase;Acc:XB-GENE-6257538])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 355/781 (45.45%), Postives = 523/781 (66.97%), Query Frame = 3
Query: 2472 NIDEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQE----PAVDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            +++ ++ I+P    L  L+LK+K   +P ASS FIF  +NKFR+ CHR++N +     +L+ I+ S I +A  +P++P + +  IL  FDY+FT  FT E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+FS IGV  FKG FY+C+D ++ TE+ C+G +I      S Q ++  R W+++ F++DNVL+GMM+LF +STF+G+  +L+  ID+  E  GP +N    I  F++IY+I+  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P ++++++IW LVTS  F   +F +I+LNTI++ +         + +SDI N  F  +FT+E++LK+ AF  + YF D  N+FDF++V+GS +DVI    +    P  +   RI+I  FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + +VL RC TGE W +I+++C      D           TCGT FAYFYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLF+LVR  L+IK   N       E+ NEELR+IIK++W++TS  +L+++IP    + VTVGKFYA FLIQ+ FR
Sbjct:  521 SLEPEIPISPRPRPLAELQLKEKAVPMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVIVTPGSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLVLFRCATGEAWQEILLACSYGKLCDPKSDFLPGEEYTCGTSFAYFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVSMNMPLNSDGTVTFNATLFSLVRTALKIKTEGN------FEQSNEELRMIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYAIFLIQEHFR 1294          

HSP 2 Score: 269.24 bits (687), Expect = 2.595e-72
Identity = 163/434 (37.56%), Postives = 264/434 (60.83%), Query Frame = 3
Query:  747 HFTCYNNVTK--QRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            H TCY   T     +  P PC+                  GQ   C    N S     +PGPN GIT FDN GFAMLTV+Q IT EGWT+++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F K ++     +D   Y DWI   + +  ++      +   +I+  ++V            F R+ G  +   K+   +    +    +++K+R+++  +++++  N++ +ATE+  QP  L++ QD +N   L +FT+E++LK+++LGF++YF+  FN +D  ++   ++E+ LV +N+M+ +G S+LR +RLLR+FK+T++W +L  +V +++ S++SI SLLLL+ LFMII +LLGMQ+FGGKF  ED  + R+ FD+   ++ITVFQ++T E WN  MY GI   GG
Sbjct:   31 HKTCYYKATDVIATVEKPSPCST----------------TGQGRQC--AINGSECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVLSGEFTKEREKAKSRGAFQKLREQQAMDEDLRGYLDWITHAEVMDPDMEQGDGKEVLRKIKSFILVSCS---------FLRVTG--EKGLKQWRHWHRLLRRKCRDLVKSRFFYWFVILIILFNTITIATEHHNQPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSNIMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGG 435          

HSP 3 Score: 90.5077 bits (223), Expect = 2.856e-17
Identity = 54/161 (33.54%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            PD S F+ F  TN+ R+   +IVN   F  FI++ I  S   +SL    P    +  N  L   +     IF  E  +K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AIK + N
Sbjct:  548 PDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLS--SISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGN 704          

HSP 4 Score: 83.5741 bits (205), Expect = 3.882e-15
Identity = 61/220 (27.73%), Postives = 118/220 (53.64%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P+ +    DI N + + +FT+E++LKI A  F++YF    N FD  VV    ++++ ++    +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ F GK    +T    +T +NF     S I + + +TGE W+ +M + +        ++ G    P  F   YFI   +  NY+++N+FLA+ ++
Sbjct:  262 QPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSN--IMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFP---QSLITVFQILTGEDWNSVMYNGI--------MAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVD 468          

HSP 5 Score: 69.707 bits (169), Expect = 5.451e-11
Identity = 83/373 (22.25%), Postives = 168/373 (45.04%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWP---------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
            FDN+   M+++F I T EGW  ++Y   D +               VFFI  +IL ++F++N+ +G +   F                                 EQG++                        + +N ++ +N    +   LK+   +    K + Q  +  ++ + Y+  ++  L+ +N++ +  ++ GQ    S   D  N+ F  +FT+E++LKL +   K YF  P+N++DF+I+  S+I++ L   +V+        ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct:  771 FDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQ--------------------------------EQGEQ------------------------EYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVIVTPGSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLVLFRCATGEAWQE 1087          

HSP 6 Score: 59.6918 bits (143), Expect = 6.948e-8
Identity = 90/413 (21.79%), Postives = 175/413 (42.37%), Query Frame = 3
Query:  915 FPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWPWVF----FIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQP-----YVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-------------------ISEDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            F    I  ++FDN   +++TVFQI+T E W  +MY     YG  ++P +F    FI L + G+Y LLN+ + I      + +     Q    +E++  K           I+   K    LL   + +    ++  + +           + ++ +    ++S  +     K +     I+    +   IL+ + ++S+ +A E   +P      +L+ F DY             +    +   K  F +  FNI D +++ VS++   +  + +       ILR +R+LR  +       LK +V  +  +IK+I +++L+  L   + S +G+QLF GKF                   +++DG   +             +FD++L  ++++F + T EGW + +Y+ I
Sbjct:  393 FEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVDNLAEAENLTSAQKAKAEERKRKKLKPMKKSAAKKIQHTSK---NLLQIHAWRNISSLEPEIPISPRPRPLAELQLKEKAVPMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYF-DYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAI 798          

HSP 7 Score: 54.299 bits (129), Expect = 2.742e-6
Identity = 49/178 (27.53%), Postives = 82/178 (46.07%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----VT----DQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE  +   I  + + L +       + + L+D L    +    IF +E ++K+  +     AK Y  + WNV DF+IV+  I+  ILS     VT    D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct:  857 KNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILN---VAFTGIFTVEMVLKLAAF----KAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVIVTPGSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQAL 1027          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: frrs1l (ferric-chelate reductase 1-like [Source:Xenbase;Acc:XB-GENE-6257538])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 351/760 (46.18%), Postives = 514/760 (67.63%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L+LK+K   +P ASS FIF  +NKFR+ CHR++N +     +L+ I+ S I +A  +P++P + +  IL  FDY+FT  FT E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+FS IGV  FKG FY+C+D ++ TE+ C+G +I      S Q ++  R W+++ F++DNVL+GMM+LF +STF+G+  +L+  ID+  E  GP +N    I  F++IY+I+  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P ++++++IW LVTS  F   +F +I+LNTI++ +         + +SDI N  F  +FT+E++LK+ AF  + YF D  N+FDF++V+GS +DVI    + + +   RI+I  FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + +VL RC TGE W +I+++C      D           TCGT FAYFYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLF+LVR  L+IK   N       E+ NEELR+IIK++W++TS  +L+++IP    + VTVGKFYA FLIQ+ FR
Sbjct:  682 LQLKEKAVPMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLVLFRCATGEAWQEILLACSYGKLCDPKSDFLPGEEYTCGTSFAYFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVSMNMPLNSDGTVTFNATLFSLVRTALKIKTEGN------FEQSNEELRMIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYAIFLIQEHFR 1434          

HSP 2 Score: 392.119 bits (1006), Expect = 6.778e-111
Identity = 251/605 (41.49%), Postives = 381/605 (62.98%), Query Frame = 3
Query:  264 TKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-------SVTDQGKV--DIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTK--QRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFD-RILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            T+ FE  I++ IF +C+ L++    P +D+N +N  LE  E   + IF IE+ +KI+ YGF+LH+ +YLRN WN+LDF IV +G+ T +L        VT  G    ++KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++IVG  LFSG  H TCY   T     +  P PC+                  GQ   C    N S     +PGPN GIT FDN GFAMLTV+Q IT EGWT+++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F K ++     +D   Y DWI                 T  E+ D  +   ++     E++++   + K  S  K+   +    +    +++K+R+++  +++++  N++ +ATE+  QP  L++ QD +N   L +FT+E++LK+++LGF++YF+  FN +D  ++   ++E+ LV +N+M+ +G S+LR +RLLR+FK+T++W +L  +V +++ S++SI SLLLL+ LFMII +LLGMQ+FGGKF  ED  + R+ FD+   ++ITVFQ++T E WN  MY GI   GG
Sbjct:    8 TEPFEMIILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCST----------------TGQGRQC--AINGSECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVLSGEFTKEREKAKSRGAFQKLREQQAMDEDLRGYLDWI-----------------THAEVMDPDMEQGDEGCSETESLYELEGINKFISFLKQWRHWHRLLRRKCRDLVKSRFFYWFVILIILFNTITIATEHHNQPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSNIMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGG 577          

HSP 3 Score: 90.5077 bits (223), Expect = 3.048e-17
Identity = 54/161 (33.54%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            PD S F+ F  TN+ R+   +IVN   F  FI++ I  S   +SL    P    +  N  L   +     IF  E  +K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AIK + N
Sbjct:  692 PDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLS--SISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGN 848          

HSP 4 Score: 86.2705 bits (212), Expect = 5.585e-16
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 3
Query: 2637 ILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVE----MSA-------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTED----NCKGTYIYYAYDGSYQAKVMNRTW----SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            I+L+ I ++CI +A + P+  + T +   IL   +YIF   FT+E  + +++YG I H  +YLRN +N +DF +V +G+  ++L  +     ++A       +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I++++G   F G      +Y  +D+    E     +  G     A +GS       R W    +N   ++DN    M+T++   T +G+ ++L+   DA+  E+   YF
Sbjct:   14 IILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCSTTGQGRQCAINGS-----ECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYF 267          

HSP 5 Score: 83.5741 bits (205), Expect = 3.508e-15
Identity = 61/220 (27.73%), Postives = 118/220 (53.64%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P+ +    DI N + + +FT+E++LKI A  F++YF    N FD  VV    ++++ ++    +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ F GK    +T    +T +NF     S I + + +TGE W+ +M + +        ++ G    P  F   YFI   +  NY+++N+FLA+ ++
Sbjct:  404 QPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSN--IMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFP---QSLITVFQILTGEDWNSVMYNGI--------MAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVD 610          

HSP 6 Score: 71.2478 bits (173), Expect = 1.960e-11
Identity = 83/369 (22.49%), Postives = 167/369 (45.26%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWP---------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSL----VITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
            FDN+   M+++F I T EGW  ++Y   D +               VFFI  +IL ++F++N+ +G +   F                                 EQG++                        + +N ++ +N    +   LK+   +    K + Q  +  ++ + Y+  ++  L+ +N++ +  ++ GQ    S   D  N+ F  +FT+E++LKL +   K YF  P+N++DF+I+  S+I++ L    V +   ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct:  915 FDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQ--------------------------------EQGEQ------------------------EYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLVLFRCATGEAWQE 1227          

HSP 7 Score: 58.5362 bits (140), Expect = 1.608e-7
Identity = 96/424 (22.64%), Postives = 180/424 (42.45%), Query Frame = 3
Query:  915 FPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWPWVF----FIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----------IIKTRYYFIVILVLVFINSLIMATEYIGQP-----YVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPF-NIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-------------------ISEDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            F    I  ++FDN   +++TVFQI+T E W  +MY     YG  ++P +F    FI L + G+Y LLN+ + I      + +     Q    +E++  K             Q    I + L   ++K  F        D+E+  +I  +   R L +L+   K + P    +  ++             I+    +   IL+ + ++S+ +A E   +P      +L+ F DY             +    +   K  F + + NI D +++ VS++   +  + +       ILR +R+LR  +       LK +V  +  +IK+I +++L+  L   + S +G+QLF GKF                   +++DG   +             +FD++L  ++++F + T EGW + +Y+ I
Sbjct:  535 FEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVDNLAEAENLTSAQKAKAEERKRKKLAR---------LQSTPNIEQFLSTVTLKNAF--VSIYCDDEEEEPEIPISPRPRPLAELQLKEKAV-PMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYF-DYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAI 942          

HSP 8 Score: 55.8398 bits (133), Expect = 1.079e-6
Identity = 47/174 (27.01%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-----SVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE  +   I  + + L +       + + L+D L    +    IF +E ++K+  +     AK Y  + WNV DF+IV+  I+  IL     S  D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1001 KNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILN---VAFTGIFTVEMVLKLAAF----KAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQAL 1167          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: CACNA1C (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:NCBI gene;Acc:100488055])

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 351/762 (46.06%), Postives = 518/762 (67.98%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-------LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDN--KSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L +K+K A +P AS+ F+F   N+FR+ CHR++N+++   ++L  I+ S I +A  +P++ N+ +  IL   DY+FT  FTLE+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y+C+D S+ TE  CKG YI Y      Q  +++R+W N++F++DNVL+ MM LF VSTF+G+ ++L+  ID+  E  GP +N+   I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P ++Y++++W +V S  F   +F++I+LNTI +++          +  +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS VDVI      ++ G        + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W +IM++C+         + S   CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR +L IK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  623 LHIKEKAAPMPEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLSSISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYSCTDSSKITEAECKGKYITYKDGDVSQPMIVDRSWENSKFDFDNVLSAMMALFTVSTFEGWPELLYRAIDSHTEDVGPIYNHRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNVSISGQNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPSKPCAPESETSEEKCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTSLCIKTDGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1377          

HSP 2 Score: 228.794 bits (582), Expect = 2.440e-59
Identity = 172/469 (36.67%), Postives = 259/469 (55.22%), Query Frame = 3
Query:  747 HFTCY-------NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINEL----------------------------LDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            H TCY       + +T++    P PC   +N+ G  C N      G V                 GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y + D  G   P V+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I  E                             +   + +T     DN+   D +       +  RI       S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  I+   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG
Sbjct:   31 HKTCYYLTNGYPDVLTEE---EPSPCALESNN-GRHCPNGTLCRSGWV-----------------GPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPCVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEDIDEEKPRNSMAPVQLHKGPPTYLPMSMPTSETESVNTDNVGSGDVEEESCGVRLAHRI--SKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGIMAYGG 474          

HSP 3 Score: 88.5817 bits (218), Expect = 1.223e-16
Identity = 52/161 (32.30%), Postives = 86/161 (53.42%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F+  NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L N +     IF +E I+K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  633 PEASAFFVFRSDNRFRVHCHRIVNNNIFTNLILFFILLS--SISLAAEDPVRHNSFRNQILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 789          

HSP 4 Score: 77.0258 bits (188), Expect = 4.065e-13
Identity = 55/219 (25.11%), Postives = 110/219 (50.23%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N + + LFT E++LK+ +   + YF    N FD  +V G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG     N    +T  + F     + + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  301 QPDWLTEVQDTANKVLLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILV--ETRIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFG--GKFNFDEMLTRRSTFDNFPQALLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 507          

HSP 5 Score: 65.4698 bits (158), Expect = 1.167e-9
Identity = 69/254 (27.17%), Postives = 129/254 (50.79%), Query Frame = 3
Query: 1320 DEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIV------------ILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM---------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNREM 2015
             EQ  + Y+N       +L    ++   Y LKA+     I K +Y + V            + VL+ +N++ +A ++ GQ     +  +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  SV+++ L  TNV          ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W   M
Sbjct:  928 QEQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCSFKEAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSVVDVILSETNVSISGQNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIM 1175          

HSP 6 Score: 53.9138 bits (128), Expect = 3.402e-6
Identity = 46/179 (25.70%), Postives = 81/179 (45.25%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS----------VTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +VN+  FE  + + I  + + L++        S    + +    +    +F +E I+K+I +      K Y  + WNV DF+IV+  +V  ILS          V +  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct:  942 KNQRQCVEYALKARPLRRYIPKNQYQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHY---GQSCSFKEAMNILNMLFTGLFTVEMILKLIAF----KPKGYFSDPWNVFDFLIVIGSVVDVILSETNVSISGQNVEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL 1113          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: frrs1l (ferric-chelate reductase 1-like [Source:Xenbase;Acc:XB-GENE-6257538])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 351/760 (46.18%), Postives = 514/760 (67.63%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L+LK+K   +P ASS FIF  +NKFR+ CHR++N +     +L+ I+ S I +A  +P++P + +  IL  FDY+FT  FT E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+FS IGV  FKG FY+C+D ++ TE+ C+G +I      S Q ++  R W+++ F++DNVL+GMM+LF +STF+G+  +L+  ID+  E  GP +N    I  F++IY+I+  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P ++++++IW LVTS  F   +F +I+LNTI++ +         + +SDI N  F  +FT+E++LK+ AF  + YF D  N+FDF++V+GS +DVI    + + +   RI+I  FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + +VL RC TGE W +I+++C      D           TCGT FAYFYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLF+LVR  L+IK   N       E+ NEELR+IIK++W++TS  +L+++IP    + VTVGKFYA FLIQ+ FR
Sbjct:  686 LQLKEKAVPMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLVLFRCATGEAWQEILLACSYGKLCDPKSDFLPGEEYTCGTSFAYFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVSMNMPLNSDGTVTFNATLFSLVRTALKIKTEGN------FEQSNEELRMIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYAIFLIQEHFR 1438          

HSP 2 Score: 391.734 bits (1005), Expect = 1.194e-110
Identity = 251/605 (41.49%), Postives = 381/605 (62.98%), Query Frame = 3
Query:  264 TKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-------SVTDQGKV--DIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTK--QRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFD-RILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            T+ FE  I++ IF +C+ L++    P +D+N +N  LE  E   + IF IE+ +KI+ YGF+LH+ +YLRN WN+LDF IV +G+ T +L        VT  G    ++KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++IVG  LFSG  H TCY   T     +  P PC+                  GQ   C    N S     +PGPN GIT FDN GFAMLTV+Q IT EGWT+++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F K ++     +D   Y DWI                 T  E+ D  +   ++     E++++   + K  S  K+   +    +    +++K+R+++  +++++  N++ +ATE+  QP  L++ QD +N   L +FT+E++LK+++LGF++YF+  FN +D  ++   ++E+ LV +N+M+ +G S+LR +RLLR+FK+T++W +L  +V +++ S++SI SLLLL+ LFMII +LLGMQ+FGGKF  ED  + R+ FD+   ++ITVFQ++T E WN  MY GI   GG
Sbjct:    8 TEPFEMIILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCST----------------TGQGRQC--AINGSECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVLSGEFTKEREKAKSRGAFQKLREQQAMDEDLRGYLDWI-----------------THAEVMDPDMEQGDEGCSETESLYELEGINKFISFLKQWRHWHRLLRRKCRDLVKSRFFYWFVILIILFNTITIATEHHNQPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSNIMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGG 577          

HSP 3 Score: 90.1225 bits (222), Expect = 3.601e-17
Identity = 54/161 (33.54%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            PD S F+ F  TN+ R+   +IVN   F  FI++ I  S   +SL    P    +  N  L   +     IF  E  +K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AIK + N
Sbjct:  696 PDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLS--SISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGN 852          

HSP 4 Score: 85.8853 bits (211), Expect = 6.651e-16
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 3
Query: 2637 ILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVE----MSA-------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTED----NCKGTYIYYAYDGSYQAKVMNRTW----SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            I+L+ I ++CI +A + P+  + T +   IL   +YIF   FT+E  + +++YG I H  +YLRN +N +DF +V +G+  ++L  +     ++A       +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I++++G   F G      +Y  +D+    E     +  G     A +GS       R W    +N   ++DN    M+T++   T +G+ ++L+   DA+  E+   YF
Sbjct:   14 IILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCSTTGQGRQCAINGS-----ECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYF 267          

HSP 5 Score: 83.5741 bits (205), Expect = 3.774e-15
Identity = 61/220 (27.73%), Postives = 118/220 (53.64%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P+ +    DI N + + +FT+E++LKI A  F++YF    N FD  VV    ++++ ++    +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ F GK    +T    +T +NF     S I + + +TGE W+ +M + +        ++ G    P  F   YFI   +  NY+++N+FLA+ ++
Sbjct:  404 QPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSN--IMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFP---QSLITVFQILTGEDWNSVMYNGI--------MAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVD 610          

HSP 6 Score: 71.2478 bits (173), Expect = 2.054e-11
Identity = 83/369 (22.49%), Postives = 167/369 (45.26%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWP---------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSL----VITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
            FDN+   M+++F I T EGW  ++Y   D +               VFFI  +IL ++F++N+ +G +   F                                 EQG++                        + +N ++ +N    +   LK+   +    K + Q  +  ++ + Y+  ++  L+ +N++ +  ++ GQ    S   D  N+ F  +FT+E++LKL +   K YF  P+N++DF+I+  S+I++ L    V +   ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct:  919 FDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQ--------------------------------EQGEQ------------------------EYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLVLFRCATGEAWQE 1231          

HSP 7 Score: 55.4546 bits (132), Expect = 1.358e-6
Identity = 47/174 (27.01%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-----SVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE  +   I  + + L +       + + L+D L    +    IF +E ++K+  +     AK Y  + WNV DF+IV+  I+  IL     S  D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1005 KNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILN---VAFTGIFTVEMVLKLAAF----KAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQAL 1171          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Match: frrs1l (ferric-chelate reductase 1-like [Source:Xenbase;Acc:XB-GENE-6257538])

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 351/760 (46.18%), Postives = 514/760 (67.63%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L+LK+K   +P ASS FIF  +NKFR+ CHR++N +     +L+ I+ S I +A  +P++P + +  IL  FDY+FT  FT E+ + M +YG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+FS IGV  FKG FY+C+D ++ TE+ C+G +I      S Q ++  R W+++ F++DNVL+GMM+LF +STF+G+  +L+  ID+  E  GP +N    I  F++IY+I+  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P ++++++IW LVTS  F   +F +I+LNTI++ +         + +SDI N  F  +FT+E++LK+ AF  + YF D  N+FDF++V+GS +DVI    + + +   RI+I  FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + +VL RC TGE W +I+++C      D           TCGT FAYFYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLF+LVR  L+IK   N       E+ NEELR+IIK++W++TS  +L+++IP    + VTVGKFYA FLIQ+ FR
Sbjct:  686 LQLKEKAVPMPDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLSSISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGNIVLVTTLLQFMFSCIGVQLFKGKFYSCTDTTKMTEEECRGYFIVAKDGDSTQIQLRERIWTHSDFHFDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLVLFRCATGEAWQEILLACSYGKLCDPKSDFLPGEEYTCGTSFAYFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVSMNMPLNSDGTVTFNATLFSLVRTALKIKTEGN------FEQSNEELRMIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYAIFLIQEHFR 1438          

HSP 2 Score: 391.349 bits (1004), Expect = 1.369e-110
Identity = 251/605 (41.49%), Postives = 381/605 (62.98%), Query Frame = 3
Query:  264 TKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-------SVTDQGKV--DIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTK--QRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFD-RILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            T+ FE  I++ IF +C+ L++    P +D+N +N  LE  E   + IF IE+ +KI+ YGF+LH+ +YLRN WN+LDF IV +G+ T +L        VT  G    ++KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++IVG  LFSG  H TCY   T     +  P PC+                  GQ   C    N S     +PGPN GIT FDN GFAMLTV+Q IT EGWT+++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F K ++     +D   Y DWI                 T  E+ D  +   ++     E++++   + K  S  K+   +    +    +++K+R+++  +++++  N++ +ATE+  QP  L++ QD +N   L +FT+E++LK+++LGF++YF+  FN +D  ++   ++E+ LV +N+M+ +G S+LR +RLLR+FK+T++W +L  +V +++ S++SI SLLLL+ LFMII +LLGMQ+FGGKF  ED  + R+ FD+   ++ITVFQ++T E WN  MY GI   GG
Sbjct:    8 TEPFEMIILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCST----------------TGQGRQC--AINGSECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYFVSLILLGSFFVLNLVLGVLSGEFTKEREKAKSRGAFQKLREQQAMDEDLRGYLDWI-----------------THAEVMDPDMEQGDEGCSETESLYELEGINKFISFLKQWRHWHRLLRRKCRDLVKSRFFYWFVILIILFNTITIATEHHNQPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSNIMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFPQSLITVFQILTGEDWNSVMYNGIMAYGG 577          

HSP 3 Score: 90.1225 bits (222), Expect = 3.468e-17
Identity = 54/161 (33.54%), Postives = 84/161 (52.17%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            PD S F+ F  TN+ R+   +IVN   F  FI++ I  S   +SL    P    +  N  L   +     IF  E  +K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AIK + N
Sbjct:  696 PDASSFFIFGPTNKFRVLCHRIVNATTFTNFILLFILLS--SISLAAEDPIEPESFRNQILAYFDYVFTAIFTTEIALKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIKTIGN 852          

HSP 4 Score: 85.8853 bits (211), Expect = 7.519e-16
Identity = 71/259 (27.41%), Postives = 130/259 (50.19%), Query Frame = 3
Query: 2637 ILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVE----MSA-------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTED----NCKGTYIYYAYDGSYQAKVMNRTW----SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            I+L+ I ++CI +A + P+  + T +   IL   +YIF   FT+E  + +++YG I H  +YLRN +N +DF +V +G+  ++L  +     ++A       +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I++++G   F G      +Y  +D+    E     +  G     A +GS       R W    +N   ++DN    M+T++   T +G+ ++L+   DA+  E+   YF
Sbjct:   14 IILLTIFANCIALAIYLPMPEDDTNSVNTILEKIEYIFLFIFTIEAALKIVAYGFILHSDAYLRNCWNILDFTIVSVGLFTIVLEQINKVQGVTAPGGTGFNVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFMIIIYAIVGKELFSGKMHKTCYYKATDVIATVEKPSPCSTTGQGRQCAINGS-----ECRGWWPGPNNGITHFDNFGFAMLTVYQCITMEGWTEVLYWVNDAIGNEWPWIYF 267          

HSP 5 Score: 83.1889 bits (204), Expect = 4.451e-15
Identity = 61/220 (27.73%), Postives = 118/220 (53.64%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P+ +    DI N + + +FT+E++LKI A  F++YF    N FD  VV    ++++ ++    +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ F GK    +T    +T +NF     S I + + +TGE W+ +M + +        ++ G    P  F   YFI   +  NY+++N+FLA+ ++
Sbjct:  404 QPEWLTKAQDIANQVLLAMFTLEMVLKIYALGFQSYFMSLFNRFDCFVVCTGILEILLVSSN--IMSPLGISVLRCIRLLRIFKITRYWTSLNNLVASLLNSVRSIASLLLLLFLFMIIFALLGMQMFGGKFDFEDTEIRRSTFDNFP---QSLITVFQILTGEDWNSVMYNGI--------MAYGGPTFPGMFVCIYFIILFVCGNYILLNVFLAIAVD 610          

HSP 6 Score: 71.2478 bits (173), Expect = 2.154e-11
Identity = 83/369 (22.49%), Postives = 167/369 (45.26%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWP---------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSL----VITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
            FDN+   M+++F I T EGW  ++Y   D +               VFFI  +IL ++F++N+ +G +   F                                 EQG++                        + +N ++ +N    +   LK+   +    K + Q  +  ++ + Y+  ++  L+ +N++ +  ++ GQ    S   D  N+ F  +FT+E++LKL +   K YF  P+N++DF+I+  S+I++ L    V +   ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct:  919 FDNVLSGMMSLFTISTFEGWPQLLYRAIDSHSEDMGPIYNYRIEIAVFFIIYIILIAFFMMNIFVGFVIVTFQ--------------------------------EQGEQ------------------------EYKNCELDKNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILNVAFTGIFTVEMVLKLAAFKAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLVLFRCATGEAWQE 1231          

HSP 7 Score: 55.4546 bits (132), Expect = 1.267e-6
Identity = 47/174 (27.01%), Postives = 80/174 (45.98%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYIL-----SVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE  +   I  + + L +       + + L+D L    +    IF +E ++K+  +     AK Y  + WNV DF+IV+  I+  IL     S  D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1005 KNQRQCVQYALKARPLRRYIPKNQHQYKIWYLVTSSYFEYLMFALIMLNTISLGMQHYGQTAEFSHLSDILN---VAFTGIFTVEMVLKLAAF----KAKGYFGDPWNVFDFLIVIGSIIDVILSEIDVSSEDTSRISITFFRLFRVMRLVKLLSRGEGVRTLLWTFIKSFQAL 1171          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 548/1306 (41.96%), Postives = 824/1306 (63.09%), Query Frame = 3
Query:  915 FPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVL------EILNSKNDEEPKKIKXXXXXXXXXXXSELE-VPVTKELVMINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDE-KLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN-QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M+ +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF+II +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG    G LV IY+I++ V GNY+LLNVF AI +      E L S    + ++ K           SE E   VTK+L   +    +P      I+           NVN    V+  +  A+      E                        DE ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E++LK+IAF  R YF D  N+FDF++V+GS +DVI     +P     +    FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:   18 WPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFE-------SNVN---EVKDPYPSADFPGDDEE------------------------DEPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1268          

HSP 2 Score: 89.7373 bits (221), Expect = 3.254e-17
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  527 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 683          

HSP 3 Score: 55.8398 bits (133), Expect = 8.439e-7
Identity = 48/175 (27.43%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFE--AFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD----QGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE   F +I +   CLG     M   N S  +N   +   +   +IF +E ++K+I +      + Y  + WNV DF+IV+  I+  ILS  D      ++     R FRV+R ++L+++   ++ +L + I + + L
Sbjct:  836 KNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLG-----MQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAF----KPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQAL 1001          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 646.351 bits (1666), Expect = 0.000e+0
Identity = 354/774 (45.74%), Postives = 519/774 (67.05%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN-QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E++LK+IAF  R YF D  N+FDF++V+GS +DVI     +P     +    FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  749 EPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1515          

HSP 2 Score: 387.882 bits (995), Expect = 6.127e-109
Identity = 264/636 (41.51%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     IV  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDFIIV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M+ +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF+II +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG
Sbjct:   26 RPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-RTGS-GRPC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGG 629          

HSP 3 Score: 97.8265 bits (242), Expect = 1.254e-19
Identity = 76/279 (27.24%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQP--NTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  ++     + I+L+ I ++C+ +A + P+    N T    L   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DFI+VF+G+  VIL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   + +G+ D+L+   DA+
Sbjct:   30 ALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSP---CARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAI 305          

HSP 4 Score: 88.9669 bits (219), Expect = 5.823e-17
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 930          

HSP 5 Score: 77.0258 bits (188), Expect = 2.875e-13
Identity = 57/219 (26.03%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFTIE+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LRL K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W+ +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWNSVMYNGI--------MAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662          

HSP 6 Score: 72.4034 bits (176), Expect = 6.699e-12
Identity = 105/437 (24.03%), Postives = 195/437 (44.62%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWPWV----FFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESS----------------------VKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----------IIKTRYYFIVILVLVFINSLIMATE-YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFIS-------------------EDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            ++FDN   A+++VFQ++T E W  +MY     YG  ++P V    +FI L + G+Y LLN+ + I      + +     Q    +E++  K +       D  E+    + + L++ S                      VK  +   D    D+E   +I  +   R L +L+   K + P    +  ++ +           I+   ++   IL+ + ++S  +A E  I    + +Q  +Y +  F  +FT+E++LK+ + G    K  F +  FNI D +++ VS+I M L  + +       ILR +R+LR  +       LK +V  +  +I++I +++L+  L   + + +G+QLF GKF S                   +DG   +             +FD++L A++++F + T EGW + +YK I
Sbjct:  595 SNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKG---LPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAV-PIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAI 1024          

HSP 7 Score: 55.0694 bits (131), Expect = 1.429e-6
Identity = 48/175 (27.43%), Postives = 81/175 (46.29%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFE--AFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD----QGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +V +  FE   F +I +   CLG     M   N S  +N   +   +   +IF +E ++K+I +      + Y  + WNV DF+IV+  I+  ILS  D      ++     R FRV+R ++L+++   ++ +L + I + + L
Sbjct: 1083 KNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLG-----MQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAF----KPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQAL 1248          

HSP 8 Score: 53.1434 bits (126), Expect = 5.491e-6
Identity = 59/246 (23.98%), Postives = 124/246 (50.41%), Query Frame = 3
Query: 1320 DEQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQ---IGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNR 2009
             EQ    Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++  L+ +N++ +  ++  Q   ++   D  N+ F I+FT+E++LKL +   + YF  P+N++DF+I+  S+I++ L   +  ++   I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W  
Sbjct: 1069 QEQGETEYKNC------ELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQE 1308          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 355/793 (44.77%), Postives = 520/793 (65.57%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--------------------MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E++LK+IAF  R YF D  N+FDF++V+GS +DVI                      N +P     +    FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  749 EPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1534          

HSP 2 Score: 387.882 bits (995), Expect = 7.648e-109
Identity = 264/636 (41.51%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     IV  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDFIIV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M+ +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF+II +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG
Sbjct:   26 RPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-RTGS-GRPC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGG 629          

HSP 3 Score: 97.8265 bits (242), Expect = 1.335e-19
Identity = 76/279 (27.24%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQP--NTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  ++     + I+L+ I ++C+ +A + P+    N T    L   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DFI+VF+G+  VIL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   + +G+ D+L+   DA+
Sbjct:   30 ALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSP---CARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAI 305          

HSP 4 Score: 89.3521 bits (220), Expect = 5.791e-17
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 930          

HSP 5 Score: 77.0258 bits (188), Expect = 3.006e-13
Identity = 57/219 (26.03%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFTIE+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LRL K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W+ +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWNSVMYNGI--------MAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662          

HSP 6 Score: 72.4034 bits (176), Expect = 7.002e-12
Identity = 105/437 (24.03%), Postives = 195/437 (44.62%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWPWV----FFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESS----------------------VKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----------IIKTRYYFIVILVLVFINSLIMATE-YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFIS-------------------EDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            ++FDN   A+++VFQ++T E W  +MY     YG  ++P V    +FI L + G+Y LLN+ + I      + +     Q    +E++  K +       D  E+    + + L++ S                      VK  +   D    D+E   +I  +   R L +L+   K + P    +  ++ +           I+   ++   IL+ + ++S  +A E  I    + +Q  +Y +  F  +FT+E++LK+ + G    K  F +  FNI D +++ VS+I M L  + +       ILR +R+LR  +       LK +V  +  +I++I +++L+  L   + + +G+QLF GKF S                   +DG   +             +FD++L A++++F + T EGW + +YK I
Sbjct:  595 SNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKG---LPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAV-PIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAI 1024          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1s (calcium channel, voltage-dependent, L type, alpha 1S subunit [Source:MGI Symbol;Acc:MGI:88294])

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 355/793 (44.77%), Postives = 520/793 (65.57%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--------------------MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E++LK+IAF  R YF D  N+FDF++V+GS +DVI                      N +P     +    FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  749 EPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1534          

HSP 2 Score: 387.882 bits (995), Expect = 6.757e-109
Identity = 264/636 (41.51%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     IV  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDFIIV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M+ +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF+II +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG
Sbjct:   26 RPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-RTGS-GRPC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGG 629          

HSP 3 Score: 97.8265 bits (242), Expect = 1.312e-19
Identity = 76/279 (27.24%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQP--NTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  ++     + I+L+ I ++C+ +A + P+    N T    L   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DFI+VF+G+  VIL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   + +G+ D+L+   DA+
Sbjct:   30 ALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSP---CARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAI 305          

HSP 4 Score: 88.9669 bits (219), Expect = 5.938e-17
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 930          

HSP 5 Score: 77.0258 bits (188), Expect = 2.906e-13
Identity = 57/219 (26.03%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFTIE+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LRL K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W+ +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWNSVMYNGI--------MAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662          

HSP 6 Score: 72.4034 bits (176), Expect = 7.060e-12
Identity = 105/437 (24.03%), Postives = 195/437 (44.62%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGN-SWPWV----FFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESS----------------------VKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----------IIKTRYYFIVILVLVFINSLIMATE-YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFIS-------------------EDGSLYRT------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            ++FDN   A+++VFQ++T E W  +MY     YG  ++P V    +FI L + G+Y LLN+ + I      + +     Q    +E++  K +       D  E+    + + L++ S                      VK  +   D    D+E   +I  +   R L +L+   K + P    +  ++ +           I+   ++   IL+ + ++S  +A E  I    + +Q  +Y +  F  +FT+E++LK+ + G    K  F +  FNI D +++ VS+I M L  + +       ILR +R+LR  +       LK +V  +  +I++I +++L+  L   + + +G+QLF GKF S                   +DG   +             +FD++L A++++F + T EGW + +YK I
Sbjct:  595 SNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKMSKG---LPDKSEEERATVTKKLEQKSKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAV-PIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAI 1024          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Match: Cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:MGI Symbol;Acc:MGI:103013])

HSP 1 Score: 637.876 bits (1644), Expect = 0.000e+0
Identity = 357/773 (46.18%), Postives = 516/773 (66.75%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV------------DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNK-------SRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L LK+K   +P AS+ FIFS +N+FR+ CHR++N ++   ++L  I+ S I +A  +P+Q  + +  IL   DY+FT  FTLE+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG  Y CSD S++TE  CKG YI Y  DG     ++  R+W N++F++DNVL  MM LF VSTF+G+ ++L+ +ID+  E +GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P +++++++W +V S  F   +F++I+LNTI +++       L     +I N +F  LFT+E+ILK+IAF  + YF D  N+FDF++V+GS +DVI     PA             +  + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALN+T +EI  NNNFQT   + ++L RC TGE W  IM++C+   K       S        CG+ FA FYFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR IIK++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  895 LHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYK-DGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDT-TEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1659          

HSP 2 Score: 379.793 bits (974), Expect = 5.553e-106
Identity = 266/656 (40.55%), Postives = 395/656 (60.21%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ--------GK---VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNN---VTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVK----TTFEIQ----DNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KK+      +P R+       N +R     IV  K FE  I++ IF +C+ L++   +P +DSN  N  LE  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +        GK    D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCYN    +      +P PC                L  G    C    N ++    + GP  GIT+FDN  FAMLTVFQ IT EGWTD++Y + D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     +E +DE   +     T E +    +N+   D +     EN   R+  ++  +  S+    +    +      +K+  ++ +++ LVF+N+L +A+E+  QP+ L++ QD +N   L LFT E+LLK++SLG + YF+  FN +D  I+   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:  120 KKQGGTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCA---------------LETGHGRQC---QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDIDPENEDEGMDEDKPRNMSMPTSETESVNTENVAGGDIEG----ENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 751          

HSP 3 Score: 97.0561 bits (240), Expect = 2.512e-19
Identity = 74/281 (26.33%), Postives = 136/281 (48.40%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNI--FDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD----ISQRTEDNCKGTYIYYAYDGSYQ-AKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            +L   +  N  R  C  ++     + I+L+ I ++C+ +A + P   + + A   N+   +Y+F + FT+E  + +I+YG++FH  +YLRN +N +DFI+V +G+   IL     +              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +  C +    I    E++     +   +    Q   V    W   +    N+DN    M+T+F   T +G+ D+L+   DA+  YE P+
Sbjct:  133 ALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIIDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAM-GYELPW 412          

HSP 4 Score: 89.7373 bits (221), Expect = 4.480e-17
Identity = 85/282 (30.14%), Postives = 143/282 (50.71%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVY 1037
            P+ S F+ F   NR R+   +IVN   F   I+  I  S   +SL    P   ++  N  L N +     IF +E I+K+  YG  LH  S+ RN++N+LD ++V + ++++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +F+ +G+ LF G   +TC ++ +KQ  +  K      N + Y  D   + P+ Q  S    + NS    +F         FDN+  AM+ +F + T EGW +++Y   D +
Sbjct:  905 PEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLS--SISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISF--GIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKL-YTC-SDSSKQTEAECK-----GNYITYK-DGEVDHPIIQPRS----WENS----KF--------DFDNVLAAMMALFTVSTFEGWPELLYRSIDSH 1158          

HSP 5 Score: 77.7962 bits (190), Expect = 1.663e-13
Identity = 57/220 (25.91%), Postives = 112/220 (50.91%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D  N   + LFT E++LK+ +   + YF    N FD  +V G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   +   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  578 QPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 784          

HSP 6 Score: 58.5362 bits (140), Expect = 1.242e-7
Identity = 65/255 (25.49%), Postives = 128/255 (50.20%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM--------------NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++ VL+ +N++ +A ++ GQ  +     +  NM F  LFT+E++LKL +   K YF  P+N++DF+I+  S+I++ L  TN                ++I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   +++   + R  NF     A++ +F+  T E W 
Sbjct: 1201 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQ 1449          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|P22316|CAC1S_CYPCA (Dihydropyridine-sensitive L-type skeletal muscle calcium channel subunit alpha-1 OS=Cyprinus carpio OX=7962 PE=2 SV=1)

HSP 1 Score: 940.258 bits (2429), Expect = 0.000e+0
Identity = 623/1580 (39.43%), Postives = 947/1580 (59.94%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ---------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY---NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVL------EILNSKNDEEPKKIKXXXXXXXXXXXSELEVPVTKELVM--INDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIA--SSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVD--GAL-----------------------RINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG-----TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            +P RS F+F   N  R     IV  K FE  I++ IF +C+ L++    P  D+N+ N  LE+ E   ++IF +E  +KI+ YG + H  +YLRN WN+LDF+IV +G+ T ++   +          G  D+KALRAFRVLRPLRL+S +PSLQ+V++SI+ ++ PL +I LLV F++ I++I+G+ LF    H TCY    N+   R  N KP               P    G    C    N +     +PGPN GIT FDN  FAMLTVFQ IT E WTD++Y ++D  GN WPW++F+ L+++GS+F+LNL++G L G+FTKE+ +   + E+ K ++  +  +D   Y +WI        E++D  S       +D     D +++ +Y+ +  +++   +   +     + K   +    +K++++   +L++V +N+L++A E+  Q   L+ FQD +N+  L  FTIE+++K+++ G + YF+  FN +D  ++T+ ++E+ LV++N+M  +G S++R +RLLR+FKLT++W +L  +V +++ S+KSI SLLLL+ LF++I +LLGMQ+FGGKF   D  + R+NFD+   A+I+VFQ++T E W+  MY GI   GG  S G LVSIY+I++ V GN++LLNVF AI +      E L +   E+ ++           + SE E  +  + +M   +    MP      I+           NVN    V+  F  A+      E                       ++ ++ I+P    + +L+ K   +PIA  SS FIF   +KFR  CHR++NH+    I+L+ I+ S I +A  +P+ P + +  +L   D +FT  FT+E+++ M  YG   H GS+ RN+FN +D IVV + +L + +    +S +K LRVLRV++ LR IN+AK LKH++  + + +  I  I+L+ +L  F+F+ IGV  FKG  Y C+D  Q+T + C+GT++ +  +  +  +V  R W N+ FN+DNVLNGM+ LF +STF+G+ +IL+  ID+     GP +NN   I  F++IY+II  FF++NIF+GFV++++Q+  E EYK  ELDKNQ++C+   LK++P+  Y+P + +++R+W  VTS  F   +F +I+LNT+ + +        I  +SD  N IF  LFT E+I+K+IAF  + YF D  N+FDFI+V+GS VDV+    + A++  G L                        I  FRLFR LRL+KLL +++ IR +LWTFI +F  LP V LL++M+ +IYA+IGMQ FGK+AL + G+EI  NNNFQT   + ++L R  TGE+W K++++ +       +   G     TCG+  A FYF+SF IL  +LI+NLF+A+I++  DYLT+D S LGPHHL+ F + W+ YD  A GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK +W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:   45 RPPRSLFFFTLKNPFRKTCINIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNNTNLTLESLEYIFLVIFTLECFLKIVAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLVVDTINTIAGVPTEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHIALLVFFMVHIYAIMGLELFKCKMHKTCYYQGTNIIAVREGNEKPS--------------PCAQAGHGRRC--TINGTECRAGWPGPNFGITHFDNSCFAMLTVFQCITTESWTDVLYWINDAMGNDWPWIYFLTLILVGSFFILNLVLGALSGEFTKEREESRSRGEYQKLRERQQMDEDLEGYMEWITHA-----EVMDGDSEALLLLRKDT----DSESDSLYQMLDQQVIYFYRLARRWNVVLRRKCHVW----VKSKFFNWWVLLVVLLNTLVIAMEHHNQTEGLTSFQDTANVILLACFTIEMVMKMYAFGPRAYFMSIFNRFDCFVVTIGILEIILVVSNIMTPLGISVMRCIRLLRLFKLTRYWTSLNNLVASLLNSVKSIASLLLLLFLFIVIFALLGMQVFGGKFNFPDRVIQRSNFDNFPQALISVFQVLTGEEWDSIMYNGIMAHGGPQSPGILVSIYFIILYVCGNFVLLNVFLAIAVDNLAEAESLTAAQKEKAEEKARRKLMRTLPEKSEEEKALMAKRLMESRSKAEGMPTTAKLKIDEFE-------SNVN---EVKDPFPPADFPGDHEE-----------------------VEPEIPISPRPRPMADLQLKETVVPIAEASSFFIFGPQHKFRKLCHRIVNHTTFTNIILLFILLSSISLAAEDPIDPRSFRNKVLAYADIVFTTVFTIEIVLKMTVYGAFLHTGSFCRNSFNILDLIVVGVSLLSMGMESSTISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAIKTIGNIVLVTMLLDFMFACIGVQLFKGKLYYCTDPLQKTAEECQGTFLKHVPNSLHDIEVHQRMWVNSDFNFDNVLNGMLALFTISTFEGWPEILYKAIDSNAVDTGPLYNNRVGISIFFIIYIIIIAFFMMNIFVGFVIVTFQKQGEQEYKDCELDKNQRQCVQYALKARPLKCYIPKNPHQYRVWYFVTSCYFEYLMFFLIMLNTLCLGIQHCNQSDHITKLSDTLNLIFTVLFTGEMIVKLIAFKAKGYFGDPWNVFDFIIVVGSIVDVVLSEVDAALEARGGLWCLHGCAEVNPMQAIAEAENVRVSITFFRLFRVLRLIKLLNRSEGIRNLLWTFIKSFQALPHVGLLIVMLFFIYAVIGMQMFGKVALVD-GTEINRNNNFQTFPQAVLLLFRVATGEQWPKVILASMYGKLCDAKSDYGPGEEYTCGSSIAVFYFLSFYILCAFLIINLFVAIIMDNVDYLTRDWSILGPHHLDEFKKIWAEYDPEATGRIKHLDVVTLLRRIQPPLGFGKFCPHRSACKRLISMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKSIWKRTSMKLLDQVIPPIGEDEVTVGKFYATFLIQEHFR 1555          

HSP 2 Score: 109.383 bits (272), Expect = 2.660e-22
Identity = 83/301 (27.57%), Postives = 151/301 (50.17%), Query Frame = 3
Query: 2478 DEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA-----------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQF-----KGSFYACSDISQRTEDNCKGTYIYYAYDG---SYQAKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +E+LK   +  KL +L+    N     SLF F+  N FR  C  ++     + I+L+ I ++C+ +A F P+    T      L   +YIF V FTLE  + +++YG++FH+G+YLRN +N +DF++VF+G+  +++  +   A           +K LR  RV++ LR ++    L+ +++S+  +M  ++ I L+      I++++G+  F     K  +Y  ++I    E N K +    A  G   +         W    F   ++DN    M+T+F   T + + D+L+   DA+
Sbjct:   23 EEELK-RKQREKLKKLQATGGNPRPPRSLFFFTLKNPFRKTCINIVEWKPFEIIILLTIFANCVALAVFLPMPEEDTNNTNLTLESLEYIFLVIFTLECFLKIVAYGLLFHEGAYLRNCWNILDFVIVFMGLFTLVVDTINTIAGVPTEKGGGFDMKALRAFRVLRPLRLVSGVPSLQVVMSSILKSMLPLFHIALLVFFMVHIYAIMGLELFKCKMHKTCYYQGTNIIAVREGNEKPSPCAQAGHGRRCTINGTECRAGWPGPNFGITHFDNSCFAMLTVFQCITTESWTDVLYWINDAM 322          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q25452|CAC1M_MUSDO (Muscle calcium channel subunit alpha-1 OS=Musca domestica OX=7370 PE=2 SV=1)

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 359/788 (45.56%), Postives = 525/788 (66.62%), Query Frame = 3
Query: 2472 NIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFM---NQEPAV---DGA-----------LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT---CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
             + +++   P  N   ++ +   +IP  +S FIFS +N+FRIFCHR+ NHS     +L  I+ S  M+A  NPL+ + ++  +LN FDY FT  FT+EL++ +ISYG + H G++ R+AFN +D +VV + ++ +      +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F++CSD S+  E +C GTY++Y      + ++  R W NN+F++D+V   M+TLF VSTF+G+  +L+ +ID+ +E  GP +N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ ELDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F K P+  ++I D  N IF  +F++E I K+ AF F+NYF D  N FDFI+VLGSF+D+++     +E A+   DG            + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKI L   G+ I  NNNFQT   + +VL R  TGE W +IM++C   +  +C   S     CG+  A+ YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR      LPL  K   +I+E N ELR  IK++W++T+  +L++++ +   + VTVGKFYAT+LIQD+FR
Sbjct:  740 GVKQRVSSLPRRNTNTDMDRIKKDIPYGTSFFIFSHTNRFRIFCHRLCNHSNFGNFILCCIMFSSAMLAAENPLKADASRNIVLNKFDYFFTAVFTIELVLKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISIFFNSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFSCSDGSKVYESDCHGTYLFYENGDINKPRLKEREWKNNKFHFDDVAKAMLTLFTVSTFEGWPTLLYVSIDSNKENGGPIYNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCELDKNQRNCIEFALKAKPVRRYIPKHSIQYKVWWFVTSSSFEYSIFVLIMINTVTLAMKFYKQPEYYSEILDALNMIFTAVFSLEFIFKLAAFRFKNYFGDAWNTFDFIIVLGSFIDIVYSEIKTKEQALATCDGQSCNKAKGGSTLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIMLEE-GTSIDRNNNFQTFPQAVLVLFRSATGEAWQEIMMACSPRDDVKCDPESDAVNNCGSSIAFPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVR------LPLAIKTDGNIDEANAELRATIKQIWKRTNPRLLDQVVLTGNDDEVTVGKFYATYLIQDYFR 1520          

HSP 2 Score: 419.853 bits (1078), Expect = 8.377e-119
Identity = 276/628 (43.95%), Postives = 407/628 (64.81%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI-------INELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-ISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P+R+ F     N LRIF  KIV++K FE FI++ IF +C+ L++   YP+ DSN  N  LE  E   ++IF  E +MKII YGFVLH  SYLRN WN LDF IVV+G+++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H TC ++ T + +++    +  A  +G+ C      P G  + C D +          GPN GIT+FDN G +MLTVFQ IT EGWTD++Y + D  G+SW W++F+ +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I       I E   ++ VK    I DNL        K +EN   +     +S  K +E    + +      +K++ ++ +I++LVF+N+ ++ATE+  QP  L QFQ+Y+N+FF+ LFT E++LK++SLGF+ YF+  FN +D  ++  S+ EM L  + +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I  LLGMQ+FGG+F    +    R+NFD    +++TVFQ++T E WN  MY GI+  GG +S
Sbjct:   36 RPERALFCLTLKNPLRIFCIKIVDSKLFEYFILLTIFANCVALAVYTPYPSGDSNITNQMLEKIEYIFLVIFTSECVMKIIAYGFVLHTGSYLRNGWNFLDFFIVVIGMISTALSNLVKEGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMIPLLHIALLVLFVIIIYAIIGLELFSGKLHKTCRHSNTGEYLNDLDELH--ACGVGFKC------PSG--YECFDDW---------VGPNDGITNFDNFGLSMLTVFQCITLEGWTDVLYSIQDAMGSSWEWIYFVSMVILGAFFVMNLILGVLSGEFSKERTKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDPDAQIIEDCHKNKVKEVVSI-DNL--------KDHENETQQTDSWFRSQKKYLERINRRIRRACRKAVKSQAFYWLIILLVFLNTGVLATEHYRQPIWLDQFQEYTNIFFIALFTCEMILKMYSLGFQGYFVSLFNRFDCFVVIGSISEMVLTSSELMAPLGVSVLRCVRLLRVFKVTKYWHSLSNLVASLLNSIQSIASLLLLLFLFIVIFGLLGMQVFGGRFTFKPEEEKPRSNFDSFYQSLLTVFQILTGEDWNVVMYDGIRAYGGVFS 635          

HSP 3 Score: 112.464 bits (280), Expect = 3.015e-23
Identity = 88/299 (29.43%), Postives = 151/299 (50.50%), Query Frame = 3
Query: 2472 NIDEKLK-ITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPL---QPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--EMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTE-----DNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV-REYEGPYF 3332
            N+  K K  TP+  +    KQ+L     A  LF  +  N  RIFC ++++  L +  +L+ I ++C+ +A + P      N T   +  I +YIF V FT E ++ +I+YG + H GSYLRN +N++DF +V IG++   L ++  E   +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +     S   E     D      + +     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+   +E  YF
Sbjct:   12 NVQNKQKATTPKRTQRRGGKQQLDRPERA--LFCLTLKNPLRIFCIKIVDSKLFEYFILLTIFANCVALAVYTPYPSGDSNITNQMLEKI-EYIFLVIFTSECVMKIIAYGFVLHTGSYLRNGWNFLDFFIVVIGMISTALSNLVKEGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMIPLLHIALLVLFVIIIYAIIGLELFSGKLHKTCRHSNTGEYLNDLDELHACGVGFKCPSGYECFDDWVGPNDGITNFDNFGLSMLTVFQCITLEGWTDVLYSIQDAMGSSWEWIYF 307          

HSP 4 Score: 92.8189 bits (229), Expect = 2.871e-17
Identity = 55/157 (35.03%), Postives = 84/157 (53.50%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            S F F  TNR RIF  ++ N   F  FI+ CI FS   L+     P       N  L   +     +F IE ++K+I YGFVLH  ++ R+ +N+LD ++V + +++   +      V  K LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct:  769 SFFIFSHTNRFRIFCHRLCNHSNFGNFILCCIMFSSAMLAAEN--PLKADASRNIVLNKFDYFFTAVFTIELVLKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISIFFNSNAISVV--KILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 921          

HSP 5 Score: 81.2629 bits (199), Expect = 9.120e-14
Identity = 57/218 (26.15%), Postives = 110/218 (50.46%), Query Frame = 3
Query: 3648 KNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + P  ++   +  N  FI LFT E+ILK+ +  F+ YF    N FD  VV+GS  +++  + E  +   L +++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I+ ++GMQ FG         E    +NF + + S + + + +TGE W+ +M   +             C       Y+I   I  NY+++N+FLA+ ++
Sbjct:  457 RQPIWLDQFQEYTNIFFIALFTCEMILKMYSLGFQGYFVSLFNRFDCFVVIGSISEMVLTSSE--LMAPLGVSVLRCVRLLRVFKVTKYWHSLSNLVASLLNSIQSIASLLLLLFLFIVIFGLLGMQVFGG-RFTFKPEEEKPRSNFDSFYQSLLTVFQILTGEDWNVVMYDGIRAYGGVFSFGIVAC------IYYIILFICGNYILLNVFLAIAVD 665          

HSP 6 Score: 65.4698 bits (158), Expect = 5.987e-9
Identity = 91/386 (23.58%), Postives = 163/386 (42.23%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQ-------------------IGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++  AMLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N +                                       +D  Q N I          K K   + +  + ++ + +    + +  +   I VL+ IN++ +A ++  QP   S+  D  NM F  +F++E + KL +  FKNYF   +N +DFII+  S I++         Q                   I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + E  S+ R  NF     A++ +F+  T E W   M
Sbjct:  988 FDDVAKAMLTLFTVSTFEGWPTLLYVSIDSNKENGGPIYNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCE---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHSIQYKVWWF--VTSSSFEYSIFVLIMINTVTLAMKFYKQPEYYSEILDALNMIFTAVFSLEFIFKLAAFRFKNYFGDAWNTFDFIIVLGSFIDIVYSEIKTKEQALATCDGQSCNKAKGGSTLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIMLEEGTSIDRNNNFQTFPQAVLVLFRSATGEAWQEIM 1317          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02789|CAC1S_MOUSE (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Mus musculus OX=10090 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 640.958 bits (1652), Expect = 0.000e+0
Identity = 355/793 (44.77%), Postives = 520/793 (65.57%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--------------------MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISC-----VDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ ++P    L  L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E++LK+IAF  R YF D  N+FDF++V+GS +DVI                      N +P     +    FRLFR +RLVKLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      D           TCGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  749 EPEIPVSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRAYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1534          

HSP 2 Score: 388.652 bits (997), Expect = 3.528e-108
Identity = 264/636 (41.51%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     IV  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDFIIV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M+ +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LF+II +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG
Sbjct:   26 RPPRALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-RTGS-GRPC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGG 629          

HSP 3 Score: 98.2117 bits (243), Expect = 7.860e-19
Identity = 76/279 (27.24%), Postives = 140/279 (50.18%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQP--NTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  ++     + I+L+ I ++C+ +A + P+    N T    L   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DFI+VF+G+  VIL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   + +G+ D+L+   DA+
Sbjct:   30 ALFCLTLQNPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSP---CARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAI 305          

HSP 4 Score: 89.3521 bits (220), Expect = 3.932e-16
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 930          

HSP 5 Score: 77.0258 bits (188), Expect = 1.859e-12
Identity = 57/219 (26.03%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFTIE+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LRL K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W+ +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTHLQDVANRVLLTLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMSPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWNSVMYNGI--------MAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q24270|CAC1D_DROME (Voltage-dependent calcium channel type D subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1D PE=1 SV=2)

HSP 1 Score: 639.802 bits (1649), Expect = 0.000e+0
Identity = 360/789 (45.63%), Postives = 523/789 (66.29%), Query Frame = 3
Query: 2493 ITPEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN---------------------QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            IT    ++ E+    K+  IP  +S F+FSQ+N+FR+FCH + NHS    I+L  I+ S  M+A  NPL+ N     +LN FDY FT  FT+ELI+ +ISYG + H G++ R+AFN +D +VV + ++ ++     +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  FKG F+ C+D S+ T+D C GTY+ Y     ++ ++  R WSNN+F++D+V  GM+TLF VSTF+G+  +L+ +ID+ +E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KP+ RY+P    ++++W  VTS  F   IF++I++NT+T+++ F   P    ++ D  N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++                       ++ A    + IN FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++++ +IYA++GMQ FGKIAL+  G+ IT NNNFQT   + +VL R  TGE W +IM+SC      +C ++S T    CG+  AY YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L IK   N      I++ N ELR  IK++W++T+  +L++++ P    + VTVGKFYAT+LIQD+FR
Sbjct: 1299 ITARPRRMSEVNTATKILPIPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRANDDLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLFKGKFFKCTDGSKMTQDECYGTYLVYDDGDVHKPRLREREWSNNRFHFDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPVRRYIPKHGIQYKVWWFVTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGKIALDG-GNAITANNNFQTFQQAVLVLFRSATGEAWQEIMMSCSAQPDVKCDMNSDTPGEPCGSSIAYPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFIRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRMACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLSIKTDGN------IDDANSELRATIKQIWKRTNPKLLDQVVPPPGNDDEVTVGKFYATYLIQDYFR 2080          

HSP 2 Score: 407.912 bits (1047), Expect = 1.084e-113
Identity = 272/627 (43.38%), Postives = 398/627 (63.48%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI----INELLDESSVKTTFEIQDNLIVDDEQNN-KIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDG--SLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N LR    +IV  K FE  I++ IF +C+ L++   YP +DSN  N  LE  E   ++IF  E +MKI+ YGFVLH  +YLRN WN+LDF IVV+G ++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H  C + +T +   N +PC      +GY C      P G  + C   ++         GPN GIT+FDN G AMLTVFQ +T EGWTD++Y + D  G+ W W++FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  +  +D   Y DWI Q + I    +  L+ +   K   E+     + +E    ++ E+ + ++       +++M     KA       +K++ ++ +I+VLVF+N+ ++ATE+ GQ   L  FQ+Y+N+FF+ LFT E+LLK++SLGF+ YF+  FN +D  ++  S+ E  L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF + DG    YR NFD    A++TVFQ+MT E WN  MY GI   GG  S
Sbjct:  590 RPQRALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPC-----GVGYQC------PPG--YKCYGGWD---------GPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAMGSDWQWMYFISMVILGAFFVMNLILGVLSGEFSKERNKAKNRGDFQKLREKQQIEEDLRGYLDWITQAEDIEPDAVGGLISDGKGKQPNEMDSTENLGEEMPEVQMTESRWRKMKKDFDRVNRRMRRACRKA-------VKSQAFYWLIIVLVFLNTGVLATEHYGQLDWLDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNTGMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKF-NFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSS 1186          

HSP 3 Score: 113.235 bits (282), Expect = 1.986e-23
Identity = 75/256 (29.30%), Postives = 135/256 (52.73%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFY-ACSD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  S  N  R  C R++     + ++L+ I ++CI +A + P   + +      L   +Y+F V FT E ++ +++YG + H G+YLRN +N +DF +V IG +   L  +   A  +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  F G  + AC D I+   E+N +   + Y     Y+        ++   N+DN    M+T+F   T +G+ D+L++  DA+
Sbjct:  594 ALFCLSVKNPLRALCIRIVEWKPFEFLILLTIFANCIALAVYTPYPGSDSNVTNQTLEKVEYVFLVIFTAECVMKILAYGFVLHNGAYLRNGWNLLDFTIVVIGAISTALSQLMKDAFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILKAMVPLFHIALLVLFVIIIYAIIGLELFSGKLHKACRDEITGEYEENIRPCGVGYQCPPGYKCYGGWDGPNDGITNFDNFGLAMLTVFQCVTLEGWTDVLYSIQDAM 849          

HSP 4 Score: 94.3597 bits (233), Expect = 1.010e-17
Identity = 59/162 (36.42%), Postives = 89/162 (54.94%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P  S F F +TNR R+F   + N   F   I+ CI FS   L+       ND  DLN  L   +     +F IE I+K+I YGFVLH  ++ R+ +N+LD ++V + +++ + S      V I  LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct: 1318 IPPGTSFFLFSQTNRFRVFCHWLCNHSNFGNIILCCIMFSSAMLAAENPLRAND--DLNKVLNKFDYFFTAVFTIELILKLISYGFVLHDGAFCRSAFNLLDLLVVCVSLISLVSSSNAISVVKI--LRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 1475          

HSP 5 Score: 85.8853 bits (211), Expect = 4.600e-15
Identity = 62/231 (26.84%), Postives = 117/231 (50.65%), Query Frame = 3
Query: 3663 INDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF---DYLTKDSSNLGPH 4346
            +++  +  N  FI LFT E++LK+ +  F+ YF    N FD  VV+GS  + +  N    +   L +++ R  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    N  G E     NF   + + + + + +TGE W+ +M   ++         +  C       YFI   I  NY+++N+FLA+ ++     D L++      PH
Sbjct: 1013 LDNFQEYTNVFFIGLFTCEMLLKMYSLGFQGYFVSLFNRFDCFVVIGSITETLLTNT--GMMPPLGVSVLRCVRLLRVFKVTKYWRSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGG-KFNFDGKEEKYRMNFDCFWQALLTVFQIMTGEDWNAVMYVGINAYGGVSSYGALAC------IYFIILFICGNYILLNVFLAIAVDNLADADSLSEVEKEEEPH 1234          

HSP 6 Score: 55.4546 bits (132), Expect = 6.420e-6
Identity = 90/392 (22.96%), Postives = 162/392 (41.33%), Query Frame = 3
Query:  945 FDNMGFAMLTVFQIITKEGWTDIMYM-VDDVYGNSWPWVFFIPLVILGS--------YFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEM-----------------------SLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGS---LYRTNFDDMLIAIITVFQLMTIEGWNREM 2015
            FD++   MLT+F + T EGW  ++Y+ +D    N  P   F P+V            +F++N+ +G +   F         QNE  +E +N                                         +D  Q N I          K K   + +  + ++ + +    + +  +   I +L+ IN++ +A ++  QP   ++  D  NM F  +F +E + KL +  FKNYF   +N++DFII+  S I++                       S   +   N I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIVL   I +++GMQ+FG   I+ DG        NF     A++ +F+  T E W   M
Sbjct: 1542 FDDVAKGMLTLFTVSTFEGWPGLLYVSIDSNKENGGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTF---------QNEGEQEYKNCD---------------------------------------LDKNQRNCI------EFALKAKPVRRYIPKHGIQYKVWWF--VTSSSFEYTIFILIMINTVTLAMKFYNQPLWYTELLDALNMIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEIKSKDTSQIAECDIVEGCKSTKKSAGSNLISINFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVLLFFIYAVVGMQVFGK--IALDGGNAITANNNFQTFQQAVLVLFRSATGEAWQEIM 1875          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Match: sp|Q02485|CAC1S_RAT (Voltage-dependent L-type calcium channel subunit alpha-1S OS=Rattus norvegicus OX=10116 GN=Cacna1s PE=1 SV=2)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 354/780 (45.38%), Postives = 514/780 (65.90%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--------------------MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG-------TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            L+LK+K   IP ASS FIFS +NK R+ CHR++N +     +L+ I+ S   +A  +P++ ++ +  IL  FDY+FT  FT+E+++ M +YG   HKGS+ RN FN +D +VV + ++ + L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+ IGV  FKG FY+C+D+S+ TE+ C+G Y  Y      Q ++  R W +N F++DNVL+ MM+LF VSTF+G+  +L+  ID+  E  GP +NN   +  F++IY+I+  FF++NIF+GFV++++Q+  E+EYK+ ELDKNQ++C+   LK++P+  Y+P + Y++++W +VTS  F   +F +I+LNTI + +      + +N ISDI N  F  +FT+E+ILK+IAF  R YF D  N+FDF++V+GS +DVI                      N +P     +    FRLFR +RL+KLL + + +R +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +I+++C      RC   S         CGT FAY+YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N       E+ NEELR IIK++W++TS  +L+++IP    + VTVGKFYATFLIQ+ FR
Sbjct:  764 LQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDLSKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILSEIDTLLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLAC--SYGKRCDPESDYAPGEEYACGTNFAYYYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGN------FEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFR 1534          

HSP 2 Score: 391.734 bits (1005), Expect = 2.971e-109
Identity = 264/636 (41.51%), Postives = 396/636 (62.26%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS-----------VTDQGK-VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCY----NNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            +P R+ F     N LR     +V  K FE  I++ IF +C+ L++    P +D+N LN  LE  E   +++F+IE+ MKII YGF+ H  +YLR+ WNVLDFIIV LG+ T IL            ++ +G  +D+KALRAFRVLRPLRL+S +PSLQ+VLNSI  A+ PL +I LLVLF++II++I+G+ LF G  H TCY    + V       P PC  R  S G  C                  N S     +PGPN GIT FDN GF+MLTV+Q I+ EGWTD++Y V+D  GN WPW++F+ L++LGS+F+LNL++G+L G+FTKE+ K + +  F  ++EKQ L+  +D   Y  WI QG     E++D   ++   E + +L         +YE    ++I+  ++   +    ++ K      +++K++ ++ +++++V +N+L +A+E+  QP  L+  QD +N   L LFTIE+L+K++ LG + YF+  FN +D  ++   ++E+ LV +  M  +G S+LR +RLLR+FK+TK+W +L  +V +++ SI+SI SLLLL+ LFMII +LLGMQLFGG++  ED  + R+NFD+   A+I+VFQ++T E WN  MY GI   GG
Sbjct:   26 RPPRALFCLTLQNPLRKACISVVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSPCA-RTGS-GRPC----------------TINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE--EDLRGYMSWITQG-----EVMDVDDLR---EGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRVFRWKCH----DLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFMIIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWNSVMYNGIMAYGG 629          

HSP 3 Score: 97.0561 bits (240), Expect = 1.522e-18
Identity = 76/279 (27.24%), Postives = 139/279 (49.82%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQP--NTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--------EMSA------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKG-----SFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----WSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            +LF  +  N  R  C  V+     + I+L+ I ++C+ +A + P+    N T    L   +Y F + F++E  + +I+YG +FH+ +YLR+ +N +DFI+VF+G+   IL  V         MS+      +K LR  RV++ LR ++    L+ ++NS+   M  ++ I L+ L    I+++IG+  FKG      ++  +DI    E+         A  GS +   +N +     W        ++DN    M+T++   + +G+ D+L+   DA+
Sbjct:   30 ALFCLTLQNPLRKACISVVEWKPFETIILLTIFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFIIVFLGVFTAILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEKPSP---CARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYWVNDAI 305          

HSP 4 Score: 89.3521 bits (220), Expect = 4.016e-16
Identity = 50/161 (31.06%), Postives = 87/161 (54.04%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            P+ S F+ F  TN++R+   +IVN   F  FI++ I  S   L+     P    +  N  LE  +     +F +E ++K+  YG  LH  S+ RN++N+LD ++V + +++  + +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  774 PEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAED--PIRADSMRNQILEYFDYVFTAVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLIS--MGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 930          

HSP 5 Score: 79.337 bits (194), Expect = 4.391e-13
Identity = 57/219 (26.03%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFTIE+++K+     R YF    N FD  VV    ++++ +  E      L I++ R  R LRL K+     S+  ++ + +N+  ++  ++LL+ + + I+A++GMQ FG    +   +E+   +NF     + I + + +TGE W+ +M + +        ++ G    P      YFI   +  NY+++N+FLA+ ++
Sbjct:  456 QPLWLTHLQDVANRVLLALFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLV--ESGAMTPLGISVLRCIRLLRLFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFMIIFALLGMQLFGG-RYDFEDTEV-RRSNFDNFPQALISVFQVLTGEDWNSVMYNGI--------MAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIAVD 662          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: G0YP31 (Voltage-dependent L-type calcium channel subunit alpha OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1219.91 bits (3155), Expect = 0.000e+0
Identity = 752/1567 (47.99%), Postives = 1046/1567 (66.75%), Query Frame = 3
Query:  144 INDKFSSKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD-QGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVLEILNSK-------NDEEPKKIKXXXXXXXXXXXSELEVPVTKELVMINDLPIMPPNVPN-DIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLK----ITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF----MNQEPAVDGA--LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD-DNKSRCQLSS---GTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + D+  +K+R +    KPDRS F  KK N LR+FI +IV++K FE  I+  IF +C+ L + + YPNNDSN  N  LE  EL  ++IF  ES++KII YGF+LH  SYLRN WN+LDF IV++G+VT  L+ T  + KVDIK+LRAFRVLRPLRL+S +PSLQIVLNSII A+KPL +I LLV FL++I+SI+G+ LF G  H TCYNNVT + M +PKPC       GY C  + +L  GQ W C + YN S    R+ GPN GIT+FDN G AMLTVFQ +T EGWT +MY ++D  GN WPW++F+ L++LGS+F+LNLI+G+L G+F+KEK K++R+  F KE++  +   DY+ YK+WIE+ D++ +E  D +S     EI  +L  +      I E    R    LK   K    ++     Y+    K++ +FI+IL LVF+N+L++ TE+  QP  L +FQD +N+ F+ LFT E+++K+ +LG   YF K FN +DF ++  S+IE+SL    ++N IG S+LR  RLLRVFKLT++W++L+ +V  +++S+KSI SLLLL+ LF++I +LLGMQ+FGGK+  E  S  R+NFD    +IITVFQ++T E WN EMY GI+  GG   LG+LVS+Y++V+ +VGNY+LLNVF AI ++ L+         ND + K           +  SE E     E+V   D       +PN  +   N +   N G ++  +R+R+ F+      K                  EE+   FN D+ LK      P  N L  +K +   IP  S+ FIFS +NKFR+FCH V+ HS    I+LV I+ S +M+A  +P++ ++ +  ILN FDYIFT  FT+E+ + MI+YG + H G++ RN FN +D +VVF+ ++   + +  +SA+K LRVLRV++ LR IN+AK LKH++  V + + +I KI+L+  L  F+F+V+ V  FKG FY+C+D S+ T D CKG +I Y         V NRTW NN  NYDNVL+GM+TLFVV+TF+G+  +L+ +IDA +E  GP +N N+ +  FY+ Y+II  FF+INIF+GFV++++Q+  ESEYK+ EL KNQ+KCI   LK++P  RY P    R++IW +V S+KF   I  +I+ NTI ++  FD+ P+   +  DI N IF  +FT+E ILK+ AF+F+NYF D  NIFDFIVVLGS+VD+I      N  P V     + IN FRLFR +RLVKLL K  SIR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIALNN+ S I+ NNNFQT   + +VL R  TGE W +IM+SC   D KS C+  +   G CG+  AY YFISF ++ ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ FI +W+ YDI A+GRI  LDVV +L KI+PPLGFG MCP  +   KL+ MNMPL+ DGT+ F ATLFALVRRNL+IK+P +  D KS++++NEELR +IK++W++TS  +L++IIP    +TVTVGKFYATFLIQ++FR
Sbjct:   44 LKDREGAKRRQLCTSFKPDRSLFCLKKKNVLRVFIARIVDSKPFEILILFTIFANCVVLGMNRPYPNNDSNSTNKILEKLELVFVIIFTFESLLKIISYGFILHPNSYLRNAWNILDFFIVLIGLVTEFLAWTSVEAKVDIKSLRAFRVLRPLRLVSGLPSLQIVLNSIITAMKPLFHIALLVFFLVVIYSIIGMELFMGKLHATCYNNVTNEIMEDPKPCMVGVVDEGYTCSGIGSLDDGQSWVCRE-YNASE---RWVGPNDGITNFDNFGLAMLTVFQAMTMEGWTQVMYWINDAQGNKWPWIYFVSLILLGSFFVLNLILGVLSGEFSKEKEKIDRKELFQKERELKRQQQDYIGYKEWIEKADELSDEENDGNS-DDYREINASLDHNQNAEAAIEEIAKSRCHKLLKRFRKTRNRWRRSVIIYM----KSKQFFILILSLVFLNTLVLTTEHHKQPIWLDRFQDIANIVFVALFTFEMVIKILALGLGEYFSKAFNKFDFFVVLCSIIELSLTRPKIINPIGLSVLRCARLLRVFKLTQYWNSLRSLVEKLLKSMKSIFSLLLLMGLFIVIFALLGMQMFGGKYNLEKKS--RSNFDHFWQSIITVFQILTGEDWNEEMYNGIRSFGGVKGLGALVSLYFVVLFIVGNYILLNVFLAIAVDNLSDDDEEEEEGNDAKSKN----------NNKSEDE---NAEMVDNQDAVSKDEKLPNGSVGDNNCINNSNTGALSKMERIRMHFESDNTQDKR----------TYEEIYAEEEEEFFN-DDDLKRGASACPRRNDLENMKTESQTIPPYSAFFIFSDTNKFRVFCHNVVCHSYFGNIVLVCILVSSVMLAAEDPIRTSSRRNKILNYFDYIFTTVFTIEITLKMIAYGFLLHPGAFCRNTFNLLDLLVVFVALVSFTIENEAISAVKILRVLRVLRPLRAINRAKGLKHVVQCVVVAVKSIGKIMLVTFLLVFMFAVMAVQLFKGRFYSCTDNSKLTNDTCKGQFINYKGLRGNIPTVENRTWENNALNYDNVLSGMLTLFVVATFEGWPGLLYKSIDAYKEDFGPVYNYNQGVAIFYVTYIIIIAFFMINIFVGFVIVTFQKEGESEYKNCELSKNQRKCIEFALKARPRKRYTPQGHLRYKIWSMVCSKKFEYVILSLILANTICLAARFDQQPKPYTETLDILNIIFTVVFTLEFILKLSAFSFKNYFSDAWNIFDFIVVLGSYVDIIISKANTNSSPQVGKTKFISINFFRLFRVMRLVKLLSKEDSIRKLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALNNSDSAISRNNNFQTFPAAVLVLFRSATGESWQEIMLSCTGTDEKSHCEPGTNEHGLCGSWVAYPYFISFYMICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFITRWADYDIEAKGRIKHLDVVTMLGKISPPLGFGNMCPHTRACHKLVRMNMPLQSDGTVLFNATLFALVRRNLKIKIPADD-DKKSMDQWNEELRAVIKKVWKRTSPQLLDQIIPPKDSDTVTVGKFYATFLIQNWFR 1574          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A0V1ME06 (Voltage-dependent L-type calcium channel subunit alpha OS=Trichinella papuae OX=268474 GN=Ca-alpha1D PE=3 SV=1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 666/1549 (43.00%), Postives = 985/1549 (63.59%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIK--EKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----IIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSL--YRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVLE-------ILNSKNDEEPKKIKXXXXXXXXXXXSELEVPVTKELVMINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG----TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            +P+RS       N +R     IV  K FE  I+  I  +C+ L++ + +P +DS+  N  LE  E   I++F IE +MK+I YGF+ H  +YLRN WN+LDF+IVV+G+++  LS  +    D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LF G  H TC +  T + + +P PC     S  + CD   NL       C + +        +PGPN GIT+FDN G AMLTVFQ I+ EGWTD+MY V+D  G  WPW++FI LVILGS+F+LNL++G+L G+F+KE+ K   +  F K  EKQ L+D  D   Y DWI Q + I  +L++E       E Q+ +  ++   +              + +   M+  +LK  N         I+K++ ++ +++VLVF+N++++ +E+ GQP  L  FQ+ +N+FF++LFT+E+ LK++SLGF NYF+  FN +D  ++  S++E +L    +M  +G S+LRS RLLR+FK+TK+W++L+ +V +++ S++SI SLLLL+ LF++I +LLGMQ+FGGKF + D ++   R NFD  + A++TVFQ++T E WN  MY GI   GG +S+G +V IY+IV+ + GNY+LLNVF AI ++       +  ++ +EE K++ + D D    +    E  V+ E    +    +P N P D E       ++  + + +Q      +E E  S+                             K    P     L L +K   IP ASSLF+FS +NK RI C++VINHS     +LV I+ S  M+A  +PLQ ++ +  +LN FDY FT  FT+E+ + ++ YG+I HKGS+ RNAFN +D +VV + +    L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  +  F+F++IGV  FKG+F+ C+D ++ T + CKGT+I +      +  V +R W+N  FN+DNV N M+ LFVVSTF+G+ D+L   +D+  E  GP +N    +  F++ ++++  FF++NIF+GFV++++Q   E EY++ ELDKNQ+KCI   L +KP  RY+P +R++++IW  VTS+ F   IF+IIILNT+ + +   K+    ++  D+ N  F  +F +E I K+ A  F+NYF D  N+FDFI+VLGSF+D+I+   +P  +  + IN FRLFR +RLVKLL + + IR +LWTF+ +F  LP+V LL++++ +IYA+IGMQ FGKIALN + +EI  NNNFQT  ++ +VL R  TGE W  IM+SC +   + C   S      CG  FAY +FISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+CF +TLFALVR NL+I   ++S    +IEE NE+LR +IKR+W++T   +L+EI+ PS   + +TVGKFYAT+LIQD+FR
Sbjct:  112 RPERSLLCLGLKNPIRKLFISIVEWKPFEWLILCMICANCIALAVYQPFPAHDSDRKNAVLEQVEYIFIVVFTIECVMKVIAYGFLFHPGAYLRNGWNLLDFLIVVIGLISTALSTLNIHGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILRAMVPLFHIALLVLFVIIIYAIIGLELFCGKLHKTCVDQWTGEHVPDPGPCGESHTS--FHCDRSKNL------VCTENHT-------WPGPNDGITNFDNFGLAMLTVFQCISLEGWTDVMYWVNDSVGREWPWIYFITLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLED--DLKGYLDWITQAEDI--DLVNEED-----EEQEAMDREEFGADGEGGEEGGSKEEYQRQSWFSMKIKRLKKLNRRCRRSCRRIVKSQAFYWLVIVLVFLNTMVLTSEHYGQPEWLDHFQEIANLFFVVLFTLEMFLKMYSLGFVNYFVALFNRFDCFVVIGSILEFALTFAGLMKPLGVSVLRSARLLRIFKVTKYWNSLRNLVASLLNSLRSIASLLLLLFLFIVIFALLGMQVFGGKFNTIDPNMNKPRANFDTFVQALLTVFQILTGEDWNAVMYNGIAAFGGVHSIGVIVCIYFIVLFICGNYILLNVFLAIAVDNLADAESLTAAEKEEEGKRVNEADPDDAMVKVPADEDAVSVEQFHESGEVKLPFNEPTDAED------EHLASGDEDQE-----REMENQSQF----------------------------KPTARPHRQSELNLPKKTKPIPDASSLFLFSSTNKVRIICNKVINHSYFTNSVLVCILVSSAMLAAEDPLQASSFRNEVLNYFDYFFTTVFTIEISLKVLVYGLILHKGSFCRNAFNLLDMLVVGVSLTSFGLKSGAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLEFMFAIIGVQIFKGAFFRCTDRARLTAEECKGTFIEFEGGDVTRPHVRSREWTNYDFNFDNVQNAMVALFVVSTFEGWPDLLHVAMDSSDEGIGPQYNARVSVAIFFITFIVVIAFFMMNIFVGFVIVTFQSEGEREYENCELDKNQRKCIEFALTAKPQRRYIPKNRFQYKIWWFVTSQPFEYAIFIIIILNTLILGMKHYKSSAAFDEALDVLNLFFTTVFALEFICKLFALTFKNYFGDAWNVFDFIIVLGSFIDIIY--GKPGSN-IISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQIFGKIALN-SNTEIHRNNNFQTFPSAVLVLFRSATGEAWQLIMLSCANTPTAMCDPESDDRGQPCGNDFAYPFFISFFMLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNSTLFALVRTNLKIYTEVSS----NIEEANEQLRAVIKRIWKRTPQRLLDEIVPPSGRDDEITVGKFYATYLIQDYFR 1589          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A182J4Y3 (Voltage-dependent L-type calcium channel subunit alpha OS=Anopheles atroparvus OX=41427 PE=3 SV=1)

HSP 1 Score: 1040.02 bits (2688), Expect = 0.000e+0
Identity = 678/1571 (43.16%), Postives = 981/1571 (62.44%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNL-PNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKI--INEL--LDESSVKTTFEIQ--DNLIVDDEQNNKIY----ENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF-ISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVLEIL------------NSKNDEEPKKIKXXXXXXXXXXXSELEVPVTKELVMINDLPIMPPNVPN-----DIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVM-NRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--MNQEPAVDGA---LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD-------DNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            +P R  F   +TN LR     IV  K FE  I++ IF +C+ L++   +PN+DSN  N  LE  E   ++IF  E +MK+I YGF+LH  SYLRN WN+LDF IVV+G+++  LS   +   D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LFSG  H +C++N T + M +P PC       G+ CD + P +     W                GPN GIT+FDN G +MLTVFQ +T EGWTD++Y ++D  G+SW WV+FI +VILG++F++NLI+G+L G+F+KE+ K + + +F K ++  ++ +D+  Y DWI Q + I   NE   L E   K T E+   DNL  D E   + +       F+R+  +L+   +K               +K++ ++ +I++LVF+N+ ++ATE+  QP  L  FQ+ +NMFF+ LFT+E+LLK++SLGF+ YF   FN +D  ++  S+ EM L  T +M  +G S+LR VRLLRVFK+TK+W +L  +V +++ SI+SI SLLLL+ LF++I +LLGMQ+FGGKF  +      R+NFD  + +++TVFQ++T E WN  MY GIQ  GG  S+G + SIY+I++ + GNY+LLNVF AI ++ L              +N EE  +    +    +  D          L   ND    P N+ +     D ES  PV   + G    + +   TF E    S  P  L                    ++ +  K  P+ N LL                IFS +N+FRIFCH + NHS    I+LV I+ S  M+A  +PL  N+ +  ILN FDY FT  FT+EL++ ++SYG +FH G++ R+AFN +D +VV + ++ +      +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  L  F+F+VIGV  +KG F++CSD S+  E  C GTY+ Y  DG+    V   R WS N+F++D+V   M+TLF VSTF+G+  +L+ +ID+  E  GP  N    +  +Y+IY+II  FF++NIF+GFV++++Q   E EYK+ +LDKNQ+ CI   LK+KPI RY+P  R ++++W  VTS+ F   IF++I++NTIT+S+ F + P++  ++ D+ N IF  +F +E + K+ AF F+NYF D  N+FDFI+VLGSF+D+++  +N    + G    + IN FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+++  S I  NNNFQT   + +VL R  TGE W  IM+ C         D KS    S   CG+  A+ YFISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFA+VR +L+IK   N      I++ N ELR  IK++W++T+  +L++++ P  V + VTVGKFYATFLIQD+FR
Sbjct:  196 RPLRVLFCLTRTNPLRKLCIAIVEWKPFEYLILLTIFANCVALAVYTPFPNSDSNSTNAALEKIEYIFLVIFTAECMMKLIAYGFILHPGSYLRNGWNILDFTIVVIGMISTALSNLMKEGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILRAMVPLLHIALLVLFVIIIYAIIGLELFSGKLHKSCFHNETGEIMDDPHPCGED----GFHCDTISPEMVCRYYWE---------------GPNFGITNFDNFGLSMLTVFQCVTLEGWTDMLYYIEDAMGSSWQWVYFISMVILGAFFVMNLILGVLSGEFSKERTKAKNRGDFQKLREKQQNDEDFCGYLDWITQAEDIDPDNEASGLQEGKTKNTIELDSTDNLGEDGEVRQESWCARKRKSFERVNRRLRRACRKA--------------VKSQAFYWLIIILVFLNTGVLATEHYRQPPWLDDFQENTNMFFVALFTMEMLLKMYSLGFQVYFASLFNRFDCFVVIGSIGEMVLTSTQIMPPLGVSVLRCVRLLRVFKVTKYWQSLSNLVASLLNSIQSIASLLLLLFLFIVIFALLGMQVFGGKFNFNSSVDKPRSNFDSFVQSLLTVFQILTGEDWNMVMYDGIQAYGGVASMGIIASIYFIILFICGNYILLNVFLAIAVDNLADADSLTTVEKDEGENPEEGDEKLSHEPTPTEHGDDGFMEHDKDNLDSDND----PMNMSDEYEGHDSESKIPVADDDEGYEEQDTQGE-TFDEPPTASARPRRLSE-----------------LSVKKSKKPIPKANSLL----------------IFSPTNRFRIFCHWLCNHSTFGNIILVCIMFSSAMLAAEDPLNANSERNQILNYFDYFFTSVFTIELLLKLVSYGFLFHDGAFCRSAFNLLDLLVVCVSLISMFFSSGAISVIKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIVLVTCLLQFMFAVIGVQLYKGKFFSCSDGSKMQESECHGTYLVYE-DGNVDKPVSKERYWSRNRFHFDDVSKAMLTLFTVSTFEGWPGLLYVSIDSHEEDSGPIHNFRPIVAAYYIIYIIIIAFFMVNIFVGFVIVTFQNEGEQEYKNCDLDKNQRNCIEFALKAKPIRRYIPKHRIQYKVWWFVTSQPFEYMIFILIMINTITLSMKFYRQPEIYTEVLDLLNLIFTAVFALEFVFKLAAFRFKNYFGDAWNVFDFIIVLGSFIDIVYSEVNVSKGMKGGSSIISINFFRLFRVMRLVKLLARGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAMDDETS-IHRNNNFQTFPQAVLVLFRSATGEAWQDIMLDCSSRPGEVNCDAKSDDAGSPEGCGSSIAFPYFISFYVLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVLFNATLFAVVRTSLKIKTEGN------IDDANAELRTTIKQIWKRTNPKLLDQVVPPPGVDDEVTVGKFYATFLIQDYFR 1687          

HSP 2 Score: 91.6633 bits (226), Expect = 1.971e-14
Identity = 57/172 (33.14%), Postives = 94/172 (54.65%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVD-IKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            S K++  P  K + S   F  TNR RIF   + N   F   I++CI FS   L+     P N +++ N  L   +     +F IE ++K++ YGF+ H  ++ R+ +N+LD ++V + +++   S    G +  IK LR  RVLRPLR I++   L+ V+  +I+A+K + N
Sbjct:  930 SVKKSKKPIPKAN-SLLIFSPTNRFRIFCHWLCNHSTFGNIILVCIMFSSAMLAAED--PLNANSERNQILNYFDYFFTSVFTIELLLKLVSYGFLFHDGAFCRSAFNLLDLLVVCVSLISMFFS---SGAISVIKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGN 1095          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A0V1A834 (Voltage-dependent L-type calcium channel subunit alpha OS=Trichinella patagoniensis OX=990121 GN=CACNA1F PE=3 SV=1)

HSP 1 Score: 1038.48 bits (2684), Expect = 0.000e+0
Identity = 663/1547 (42.86%), Postives = 977/1547 (63.15%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIK--EKQNLKDTDDYLFYKDWIEQGDKI--INELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSL--YRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVLEIL--------NSKNDEEPKKIKXXXXXXXXXXXSELEVPVTKELVMINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG----TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            +P+RS       N +R     IV  K FE  I+  I  +C+ L++ + +P +DS+  N  LE  E   I++F IE +MK+I YGF+ H  +YLRN WN+LDF+IVV+G+++  LS  +    D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LF G  H TC +  T + + +P PC     S  + CD   NL       C + +        +PGPN GIT+FDN G AMLTVFQ I+ EGWTD+MY V+D  G  WPW++FI LVILGS+F+LNL++G+L G+F+KE+ K   +  F K  EKQ L+  DD   Y DWI Q + I  +NE   E   +   + ++     +       +  F R         K+++    + +     I+K++ ++ +++VLVF+N++++ +E+ GQP  L  FQ+ +N+FF++LFT+E+ LK++SLGF NYF+  FN +D  ++  S++E +L    +M  +G S+LRS RLLR+FK+TK+W++L+ +V +++ S++SI SLLLL+ LF++I +LLGMQ+FGGKF + D ++   R NFD  + A++TVFQ++T E WN  MY GI   GG +S+G +V IY+IV+ + GNY+LLNVF AI ++ L          K +E  +  +    D    + +  E  V+      +    +P N P D E  +  L     +   E   +  FK      +  E                      N+ +K K  P+ + L                F+FS +NK RIFC++VINHS     +LV I+ S  M+A  +PLQ ++ +  +LN FDY FT  FT+E+ + ++ YG+I HKGS+ RNAFN +D +VV + +    L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  +  F+F++IGV  FKGSF+ C+D ++ T + CKGT+I +      +  V NR W+N  FN+DNV N M+ LFVVSTF+G+ D+L   +D+  E  GP +N    +  F++ ++++  FF++NIF+GFV++++Q   E EY++ ELDKNQ+KCI   L +KP  RY+P +R++++IW  VTS+ F   IF+IIILNT+ + +   K  +  +D+ D  N IF  +F +E ILK++AF  +NYF D  N+FDFI+VLGSF+D+I+   +P  +  + IN FRLFR +RLVKLL + + IR +LWTF+ +F  LP+V LL++++ +IYA+IGMQ FGKIAL N+ +EI  NNNFQT  ++ +VL R  TGE W  IM+SC +   + C   S      CG  FAY +FISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+CF +TLFALVR NL+I   ++S    +IEE NE+LR +IKR+W++T   +L+EI+ PS   + +TVGKFYAT+LIQD+FR
Sbjct:  119 RPERSLLCLGLKNPIRKLFISIVEWKPFEWLILCMICANCIALAVYQPFPAHDSDRKNAVLEQVEYIFIVVFTIECVMKVIAYGFLFHPGAYLRNGWNLLDFLIVVIGLISTALSTLNIHGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILRAMVPLFHIALLVLFVIIIYAIIGLELFCGKLHKTCVDQWTGEHVPDPGPCGESHTS--FHCDRSKNL------VCTENHT-------WPGPNDGITNFDNFGLAMLTVFQCISLEGWTDVMYWVNDSVGREWPWIYFITLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLE--DDLKGYLDWITQAEDIDLVNE---EDEEQEAMDREEFGADGEGGEEGGSKEEFQR-QSWFSMKIKRLKKLNRRCRRSCRRIVKSQAFYWLVIVLVFLNTMVLTSEHYGQPEWLDHFQEIANLFFVVLFTLEMFLKMYSLGFVNYFVALFNRFDCFVVIGSILEFALTFAGLMKPLGVSVLRSARLLRIFKVTKYWNSLRNLVASLLNSLRSIASLLLLLFLFIVIFALLGMQVFGGKFNTIDPNMNKPRANFDTFVQALLTVFQILTGEDWNAVMYNGIAAFGGVHSIGVIVCIYFIVLFICGNYILLNVFLAIAVDNLADAESLTAAEKEEENKRANEADPEDDMVVKATADEDAVSVGQFHESGEVKLPFNEPTDAEDEH--LASGDDDHEREMENQSQFKPTARPHRQSE---------------------LNLPKKTKPIPDASSL----------------FLFSSTNKVRIFCNKVINHSYFTNSVLVCILVSSAMLAAEDPLQASSFRNEVLNYFDYFFTTVFTIEISLKVLVYGLILHKGSFCRNAFNLLDMLVVGVSLTSFGLKSGAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLEFMFAIIGVQIFKGSFFRCTDRARLTAEECKGTFIEFEGGDVTRPHVRNREWTNYDFNFDNVQNAMVALFVVSTFEGWPDLLHVAMDSSDEGIGPQYNARVSVAIFFITFIVVIAFFMMNIFVGFVIVTFQSEGEREYENCELDKNQRKCIEFALTAKPQRRYIPKNRFQYKIWWFVTSQPFEYAIFIIIILNTLILGMKHHKMTRTFDDVLDTMNLIFTGIFAMEFILKVMAFRCKNYFGDAWNVFDFIIVLGSFIDIIY--GKPGSN-IISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQIFGKIAL-NSNTEIHRNNNFQTFPSAVLVLFRSATGEAWQLIMLSCANTPAAMCDPESDDRGQPCGNDFAYPFFISFFMLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNSTLFALVRTNLKIYTEVSS----NIEEANEQLRAVIKRIWKRTPQRLLDEIVPPSGRDDEITVGKFYATYLIQDYFR 1597          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Match: A0A0V1MD94 (Voltage-dependent L-type calcium channel subunit alpha OS=Trichinella papuae OX=268474 GN=Ca-alpha1D PE=3 SV=1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 667/1563 (42.67%), Postives = 985/1563 (63.02%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIK--EKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLN-----IIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSL--YRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYSLXXXXXXXXXXXXXXXXXXXXXXFFAIVLE-------ILNSKNDEEPKKIKXXXXXXXXXXXSELEVPVTKELVMINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG----TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRI--------------KLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            +P+RS       N +R     IV  K FE  I+  I  +C+ L++ + +P +DS+  N  LE  E   I++F IE +MK+I YGF+ H  +YLRN WN+LDF+IVV+G+++  LS  +    D+KALRAFRVLRPLRL+S +PSLQ+VLNSI+ A+ PL +I LLVLF+III++I+G+ LF G  H TC +  T + + +P PC     S  + CD   NL       C + +        +PGPN GIT+FDN G AMLTVFQ I+ EGWTD+MY V+D  G  WPW++FI LVILGS+F+LNL++G+L G+F+KE+ K   +  F K  EKQ L+D  D   Y DWI Q + I  +L++E       E Q+ +  ++   +              + +   M+  +LK  N         I+K++ ++ +++VLVF+N++++ +E+ GQP  L  FQ+ +N+FF++LFT+E+ LK++SLGF NYF+  FN +D  ++  S++E +L    +M  +G S+LRS RLLR+FK+TK+W++L+ +V +++ S++SI SLLLL+ LF++I +LLGMQ+FGGKF + D ++   R NFD  + A++TVFQ++T E WN  MY GI   GG +S+G +V IY+IV+ + GNY+LLNVF AI ++       +  ++ +EE K++ + D D    +    E  V+ E    +    +P N P D E       ++  + + +Q      +E E  S+                             K    P     L L +K   IP ASSLF+FS +NK RI C++VINHS     +LV I+ S  M+A  +PLQ ++ +  +LN FDY FT  FT+E+ + ++ YG+I HKGS+ RNAFN +D +VV + +    L    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+  +  F+F++IGV  FKG+F+ C+D ++ T + CKGT+I +      +  V +R W+N  FN+DNV N M+ LFVVSTF+G+ D+L   +D+  E  GP +N    +  F++ ++++  FF++NIF+GFV++++Q   E EY++ ELDKNQ+KCI   L +KP  RY+P +R++++IW  VTS+ F   IF+IIILNT+ + +   K+    ++  D+ N  F  +F +E I K+ A  F+NYF D  N+FDFI+VLGSF+D+I+   +P  +  + IN FRLFR +RLVKLL + + IR +LWTF+ +F  LP+V LL++++ +IYA+IGMQ FGKIALN + +EI  NNNFQT  ++ +VL R  TGE W  IM+SC +   + C   S      CG  FAY +FISF +L ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ F+  WS YD  A+GRI  LDVV LL KI+PPLGFGK+CP     ++L+ MNMPL  DGT+CF +TLFALVR NL+I              K+   S    +IEE NE+LR +IKR+W++T   +L+EI+ PS   + +TVGKFYAT+LIQD+FR
Sbjct:  112 RPERSLLCLGLKNPIRKLFISIVEWKPFEWLILCMICANCIALAVYQPFPAHDSDRKNAVLEQVEYIFIVVFTIECVMKVIAYGFLFHPGAYLRNGWNLLDFLIVVIGLISTALSTLNIHGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSILRAMVPLFHIALLVLFVIIIYAIIGLELFCGKLHKTCVDQWTGEHVPDPGPCGESHTS--FHCDRSKNL------VCTENHT-------WPGPNDGITNFDNFGLAMLTVFQCISLEGWTDVMYWVNDSVGREWPWIYFITLVILGSFFVLNLVLGVLSGEFSKEREKARARGLFQKFREKQQLED--DLKGYLDWITQAEDI--DLVNEED-----EEQEAMDREEFGADGEGGEEGGSKEEYQRQSWFSMKIKRLKKLNRRCRRSCRRIVKSQAFYWLVIVLVFLNTMVLTSEHYGQPEWLDHFQEIANLFFVVLFTLEMFLKMYSLGFVNYFVALFNRFDCFVVIGSILEFALTFAGLMKPLGVSVLRSARLLRIFKVTKYWNSLRNLVASLLNSLRSIASLLLLLFLFIVIFALLGMQVFGGKFNTIDPNMNKPRANFDTFVQALLTVFQILTGEDWNAVMYNGIAAFGGVHSIGVIVCIYFIVLFICGNYILLNVFLAIAVDNLADAESLTAAEKEEEGKRVNEADPDDAMVKVPADEDAVSVEQFHESGEVKLPFNEPTDAED------EHLASGDEDQE-----REMENQSQF----------------------------KPTARPHRQSELNLPKKTKPIPDASSLFLFSSTNKVRIICNKVINHSYFTNSVLVCILVSSAMLAAEDPLQASSFRNEVLNYFDYFFTTVFTIEISLKVLVYGLILHKGSFCRNAFNLLDMLVVGVSLTSFGLKSGAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLEFMFAIIGVQIFKGAFFRCTDRARLTAEECKGTFIEFEGGDVTRPHVRSREWTNYDFNFDNVQNAMVALFVVSTFEGWPDLLHVAMDSSDEGIGPQYNARVSVAIFFITFIVVIAFFMMNIFVGFVIVTFQSEGEREYENCELDKNQRKCIEFALTAKPQRRYIPKNRFQYKIWWFVTSQPFEYAIFIIIILNTLILGMKHYKSSAAFDEALDVLNLFFTTVFALEFICKLFALTFKNYFGDAWNVFDFIIVLGSFIDIIY--GKPGSN-IISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGMQIFGKIALN-SNTEIHRNNNFQTFPSAVLVLFRSATGEAWQLIMLSCANTPTAMCDPESDDRGQPCGNDFAYPFFISFFMLCSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTVCFNSTLFALVRTNLKIYTEERPFLFLKKSEKVESQSLVSSNIEEANEQLRAVIKRIWKRTPQRLLDEIVPPSGRDDEITVGKFYATYLIQDYFR 1607          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 348/765 (45.49%), Postives = 510/765 (66.67%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  IL  FDY FT  FT+E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ +E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++      Q  N + DI N  F  +FT+E++LK+IAF  R YF D  N+FD +VV+GS VD++    +   D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGK+A+ + G++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  721 PAISELVK-KEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1477          

HSP 2 Score: 368.237 bits (944), Expect = 1.328e-102
Identity = 255/639 (39.91%), Postives = 382/639 (59.78%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQG-----DKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IV+             G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC+  V  + +S  +P     N  G  C  +      + W                GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q      D    E   + +        +++  ++E+           +  K+  +  S++   +    +      +K+  ++ ++++LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   55 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFL-VGSEMISEDEPAPCAVNGHGRTC-TINGTECREGWH---------------GPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEEEEEDSKRNPSVPASETESVNTENEKGEDEKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSS 674          

HSP 3 Score: 83.1889 bits (204), Expect = 2.679e-15
Identity = 78/299 (26.09%), Postives = 133/299 (44.48%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     IF +E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y  D   N P  Q       +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  728 KKEKITPI--PEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYILYK-DGDVNQPTLQK---RHWHNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 987          

HSP 4 Score: 83.1889 bits (204), Expect = 2.841e-15
Identity = 69/276 (25.00%), Postives = 130/276 (47.10%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA---LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYA------CSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V I +               +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A         IS+     C       A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   62 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIV-IPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPC-------AVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 329          

HSP 5 Score: 80.8777 bits (198), Expect = 1.569e-14
Identity = 61/219 (27.85%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  498 QPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNVVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 704          

HSP 6 Score: 58.5362 bits (140), Expect = 8.948e-8
Identity = 65/250 (26.00%), Postives = 105/250 (42.00%), Query Frame = 3
Query: 3678 DIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKI--------------------ALNNTGSEITTNN---------------NFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            +   Y F+ +FTIE  LKIIA+        Y  +  N+ DF++V+           +P   G   +   R FR LR ++L+    S++ +L + I A   L  + LLVL ++ IYAIIG++ F GK+                    A+N  G   T N                NF     + + + +CIT E W  ++    D             G    + YF+S +I  ++ ++NL L V+  +F
Sbjct:  126 ETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVIPLAAATHAHGGKP---GGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMND-----------AMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEF 361          

HSP 7 Score: 57.3806 bits (137), Expect = 1.860e-7
Identity = 63/247 (25.51%), Postives = 123/247 (49.80%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYF------------IVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLV-ITNVMN--QIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNREM 2015
            EQ  K Y+N       +L    ++   Y LKA+     I K  Y +             ++ VL+ +N+L +A ++ GQ    +   D  NM F  +FT+E++LKL +   + YF   +N++D +++  S++++ L  I N  +  +I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLI +   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W   M
Sbjct: 1032 EQGEKEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIM 1272          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 347/765 (45.36%), Postives = 508/765 (66.41%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  IL  FDY FT  FT+E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ +E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++      Q  N + DI N  F  +FT+E++LK+IAF  R+YF D  N FD ++V+GS VD+         D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGK+A+ + G++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  758 PAISELVK-KEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1514          

HSP 2 Score: 364.77 bits (935), Expect = 2.057e-101
Identity = 266/688 (38.66%), Postives = 395/688 (57.41%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ------------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDK-----------------IINELLDESSVKTTF-----EIQDNLIVDDEQN----NKIYENVFDRILGKL-KSTSKKMEPYKLKAQNYLLN-----IIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L V  +                        G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC+  V       P PC    N  G  C  +      + W                GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q +                   + +L+D+     +F     E   ++   + ++    N+  E+      G L +  SK     + +  N          +K+  ++ ++++LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   45 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFL-VEMISEDEPAPCA--VNGHGRTC-TINGTECREGWH---------------GPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEEEEEDSKRNRVTLADLMDKKKKGFSFFSQSSETHASVPASETESVNTENEKGEDEKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSS 711          

HSP 3 Score: 93.5893 bits (231), Expect = 1.903e-18
Identity = 74/294 (25.17%), Postives = 141/294 (47.96%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------------VDVEMSA-------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYA-CSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L             V++ ++A             +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A C  +   +ED         A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   52 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPC----AVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 341          

HSP 4 Score: 83.9593 bits (206), Expect = 1.768e-15
Identity = 78/299 (26.09%), Postives = 133/299 (44.48%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     IF +E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y  D   N P  Q       +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  765 KKEKITPI--PEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYILYK-DGDVNQPTLQK---RHWHNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1024          

HSP 5 Score: 80.8777 bits (198), Expect = 1.511e-14
Identity = 61/219 (27.85%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  535 QPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNVVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 741          

HSP 6 Score: 54.299 bits (129), Expect = 1.854e-6
Identity = 43/173 (24.86%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIV----TYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +VN+  FE  + + I  + L L++        S   N  ++   +    +F +E ++K+I +      + Y  + WN  D +IVV  +V    T + +  D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1082 KNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHY---GQSQTFNYVMDILNMAFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL 1247          

HSP 7 Score: 53.5286 bits (127), Expect = 3.256e-6
Identity = 70/269 (26.02%), Postives = 112/269 (41.64%), Query Frame = 3
Query: 3678 DIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDF-IVVLGSFVDVIFM------NQEPAVD--------------GALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKI------------------ALNNTGSEITTNN---------------NFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            +   Y F+ +FTIE  LKIIA+        Y  +  N+ DF IVV+G F  V+ +       ++  V+              G   +   R FR LR ++L+    S++ +L + I A   L  + LLVL ++ IYAIIG++ F GK+                  A+N  G   T N                NF     + + + +CIT E W  ++    D             G    + YF+S +I  ++ ++NL L V+  +F
Sbjct:  116 ETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMND-----------AMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEF 373          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 345/765 (45.10%), Postives = 507/765 (66.27%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  +L   DY+FT  FT E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ +E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++      Q  N + DI N  F  +FT+E++LK+IAF  R+YF D  N FD ++V+GS VD+         D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGK+A+ + G++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  735 PAISELVK-KEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1491          

HSP 2 Score: 360.533 bits (924), Expect = 3.894e-100
Identity = 266/668 (39.82%), Postives = 390/668 (58.38%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKL---------ENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ------------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQG---DKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  L         E  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L V  +                        G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC+  V  + +S  +P     N  G  C  +      + W                GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q    D    E  ++S    +    +   V+ E  N+  E+      G L    ++    +   +   L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   45 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFL-VGSEMISEDEPAPCAVNGHGRTC-TINGTECREGWH---------------GPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEEEEEDSKRNPSVPASETESVNTE--NEKGEDEKATCCGPLCRRWRRWN--RFCRRKCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSS 688          

HSP 3 Score: 88.5817 bits (218), Expect = 7.286e-17
Identity = 74/308 (24.03%), Postives = 141/308 (45.78%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF-----------ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------------VDVEMSA-------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYA------CSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +            I+   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L             V++ ++A             +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A         IS+     C       A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   52 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPC-------AVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 352          

HSP 4 Score: 81.6481 bits (200), Expect = 9.847e-15
Identity = 77/299 (25.75%), Postives = 132/299 (44.15%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     +F  E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y  D   N P  Q       +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  742 KKEKITPI--PEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYILYK-DGDVNQPTLQK---RHWHNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1001          

HSP 5 Score: 80.8777 bits (198), Expect = 1.426e-14
Identity = 61/219 (27.85%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  512 QPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNVVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 718          

HSP 6 Score: 54.299 bits (129), Expect = 1.734e-6
Identity = 43/173 (24.86%), Postives = 79/173 (45.66%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIV----TYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +VN+  FE  + + I  + L L++        S   N  ++   +    +F +E ++K+I +      + Y  + WN  D +IVV  +V    T + +  D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1059 KNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHY---GQSQTFNYVMDILNMAFTAVFTVEMVLKLIAF----KPRHYFTDAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL 1224          

HSP 7 Score: 53.9138 bits (128), Expect = 2.510e-6
Identity = 69/286 (24.13%), Postives = 110/286 (38.46%), Query Frame = 3
Query: 3633 SLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDFIVVLGSFVDVIF---------------------MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKI--------------------ALNNTGSEITTNN---------------NFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            S   D N      I +   Y F+ +FTIE  LKIIA+        Y  +  N+ DF++V+     V+                       +      G   +   R FR LR ++L+    S++ +L + I A   L  + LLVL ++ IYAIIG++ F GK+                    A+N  G   T N                NF     + + + +CIT E W  ++    D             G    + YF+S +I  ++ ++NL L V+  +F
Sbjct:  110 STNHDLNCPSPQSIIETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVGSEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMND-----------AMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEF 384          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1c (calcium channel, voltage-dependent, L type, alpha 1C subunit [Source:ZFIN;Acc:ZDB-GENE-020129-1])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 347/773 (44.89%), Postives = 514/773 (66.49%), Query Frame = 3
Query: 2478 DEKLKITPEINKL--LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGT----CGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            + ++ + P    L  ++LK+K   +P A + FIFS +NKFR+ CH+++NH++   ++L  I+ S I +A  +P++ ++ +  IL   D++FT  FT+E+I+ M +YG   HKGS+ RN FN +D +VV + ++   +    ++ +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG F+ C+D S++T   C+GTYI Y      + +   R+W N+ FN+D+VL GMM LF VSTF+G+  +L+  ID+  E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y++++W +V S  F   +F +I+LNTI +++         N   +I N +F  LFT+E+ILK+IAF  R YF D  N+FDF++V+GS +DVI        D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIAL +  ++I  NNNFQT   + ++L RC TGE W +IM++C  +         G     CG+ FA  YF+SF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  LRIK   N      +E+ NEELR I+K++W++TS  +L++++P    + VTVGKFYATFLIQ++FR
Sbjct:  666 EPEMPVGPRPRPLSDIQLKEKAVPMPEARAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLSSISLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKFFYCTDSSKQTHTECRGTYILYKDGNVGKPERAQRSWENSDFNFDDVLQGMMALFAVSTFEGWPGLLYRAIDSHAEDVGPIYNYRVVISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSPSFNKAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALRDN-TQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACSPNRPCEKGSEEGPTTEECGSHFAIIYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGN------LEQANEELRAIVKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR 1431          

HSP 2 Score: 344.354 bits (882), Expect = 3.106e-95
Identity = 244/588 (41.50%), Postives = 358/588 (60.88%), Query Frame = 3
Query:  375 ENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGK-----------VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSN-PKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDES-----------------SVKTTFEIQDNLIVDDEQNNKIYENVFDRIL-GKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            E  E   ++IF +E+ +K+I YG + H  +YLRN WN+LDFIIVV+G+ + IL    +G             D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC+N     +    P PC P + + G  C                 +N++  ++ + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y + D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I  E  DE                  SV T     DN    D +       + +RI   K    S++   +    +      +K+  ++ +++ LVF+N+L +A+E+  QP  L+  QD +N   L LFT E+LLK++SLG + YF+  FN +D  ++   ++E  LV T +M+ +G S+LR VRLLR+FK+T++W++L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG
Sbjct:    1 ERVEYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFNYKDGHKAEEKPAPCAPNS-AHGRHCTP---------------HNSTQCLMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPENDDEGLDDDKPRNLSIPASENESVNT-----DNAPAGDMEGETCCTRLANRISKSKFSRYSRR---WNRLCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHHQQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDGFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDE--TRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGG 560          

HSP 3 Score: 82.4185 bits (202), Expect = 5.445e-15
Identity = 61/220 (27.73%), Postives = 115/220 (52.27%), Query Frame = 3
Query: 3648 KNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTP--FAYFYFISFIILSNYLIMNLFLAVIIE 4301
            + PQ + D+ DI N + + LFT E++LK+ +   + YF    N FD  VV G  ++ I +  E  +   L I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG    N   +  +T +NF     S + + + +TGE W+ +M   +        ++ G    P      YFI   I  NY+++N+FLA+ ++
Sbjct:  388 QQPQWLTDVQDIANKVLLALFTGEMLLKMYSLGLQAYFVSLFNRFDGFVVCGGILETILV--ETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGG-KFNFDETRRSTFDNFP---QSLLTVFQILTGEDWNSVMYDGI--------MAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVD 593          

HSP 4 Score: 78.5666 bits (192), Expect = 7.341e-14
Identity = 58/221 (26.24%), Postives = 105/221 (47.51%), Query Frame = 3
Query: 2733 DYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMS-------------ALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSF------YACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTW---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            +Y+F + FT+E  + +I+YG++ H  +YLRN +N +DFI+V +G+   IL                    +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G        Y     ++     C     +  +   + +      W   ++   N+DN    M+T+F   T +G+ D+L+   DA+  YE P+
Sbjct:    4 EYLFLIIFTVEAFLKVIAYGLLCHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKGDGGTPIGGKAAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHRTCFNYKDGHKAEEKPAPCAPNSAHGRHCTPHNSTQCLMGWEGPNDGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAM-GYELPW 223          

HSP 5 Score: 77.0258 bits (188), Expect = 2.509e-13
Identity = 53/163 (32.52%), Postives = 81/163 (49.69%), Query Frame = 3
Query:  201 RSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLD-----FIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            R+ F F  TN+ R+   KIVN   F   I+  I  S   +SL    P    +  N  L   +     +F IE I+K+  YG  LH  S+ RN++N+LD       ++  GI +  ++V       +K LR  RVLRPLR I++   L+ V+  + +AI+ + N
Sbjct:  694 RAFFIFSHTNKFRVLCHKIVNHNIFTNLILFFILLS--SISLAAEDPVKSDSFRNQILGYADHVFTGLFTIEIILKMTAYGAFLHKGSFCRNYFNILDLVVVSVSLISSGIQSSAINV-------VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGN 847          

HSP 6 Score: 59.3066 bits (142), Expect = 4.717e-8
Identity = 64/247 (25.91%), Postives = 129/247 (52.23%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKA------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLV-ITNVMN--QIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWNREM 2015
            EQ  + Y+N       +L    ++   Y LKA            Q  +  ++ + Y+  ++  L+ +N++ +A ++ GQ    ++  +  NM F  LFT+E++LKL +   + YF  P+N++DF+I+  S+I++ L  I N  +  +I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLIV+   I +++GMQ+FG   + ++  + R  NF     A++ +F+  T E W   M
Sbjct:  987 EQGEQEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLAMQHHGQSPSFNKAMNILNMLFTGLFTVEMILKLIAFKPRGYFSDPWNVFDFLIVIGSIIDVILSEINNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALRDNTQINRNNNFQTFPQAVLLLFRCATGEAWQEIM 1227          

HSP 7 Score: 57.3806 bits (137), Expect = 1.955e-7
Identity = 47/173 (27.17%), Postives = 80/173 (46.24%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS----VTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +VN+  FE  +   I  + + L+   M  +  S   N  +    +    +F +E I+K+I +      + Y  + WNV DF+IV+  I+  ILS      D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1000 KNQRQCVEYALKARPLRRYIPKNPYQYKVWYVVNSTYFEYLMFTLILLNTICLA---MQHHGQSPSFNKAMNILNMLFTGLFTVEMILKLIAF----KPRGYFSDPWNVFDFLIVIGSIIDVILSEINNTEDNARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL 1165          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Match: cacna1da (calcium channel, voltage-dependent, L type, alpha 1D subunit, a [Source:ZFIN;Acc:ZDB-GENE-030616-135])

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 346/776 (44.59%), Postives = 509/776 (65.59%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN----QEPAVD--------GALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCV-----DDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I++L++ K+K+  IP  S+ FIFS +N  R+ CH++INH +   ++LV I+ S   +A  +P++  + +  +L   DY+FT  FT E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ +E  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++      Q  N + DI N  F  +FT+E++LK+IAF  R+YF D  N FD ++V+GS VD+        + P VD          + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGK+A+ + G++I  NNNFQT   + ++L RC TGE W +IM++C+     D           TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  733 PAISELVK-KEKITPIPEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLSSASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCNDEAKSSPEECKGTYILYKDGDVNQPTLQKRHWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNKENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSQTFNYVMDILNMAFTAVFTVEMVLKLIAFKPRHYFTDAWNTFDALIVVGSVVDIAITEVNPTEAPQVDESGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQIFGKVAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACMAGKLCDPESDYNPGEEMTCGSSFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1500          

HSP 2 Score: 367.081 bits (941), Expect = 3.837e-102
Identity = 260/663 (39.22%), Postives = 388/663 (58.52%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ------------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQG-----DKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKST--SKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN  N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L V  +                        G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TC+  V       P PC    N  G  C  +      + W                GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q      D    E   + +        +++  ++E+           +  K+  +  S++   +    +      +K+  ++ ++++LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   45 SKKQGSSANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFL-VEMISEDEPAPCA--VNGHGRTC-TINGTECREGWH---------------GPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEEEEEDSKRNPSVPASETESVNTENEKGEDEKATCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNVVMYDGIMAYGGPSS 686          

HSP 3 Score: 93.9745 bits (232), Expect = 1.837e-18
Identity = 74/294 (25.17%), Postives = 141/294 (47.96%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------------VDVEMSA-------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYA-CSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQF--------NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L             V++ ++A             +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A C  +   +ED         A +G  +   +N T     +        N+DN +  M+T+F   T +G+ D+L+   DA+
Sbjct:   52 ANTRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSTNHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPC----AVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMNDAM 341          

HSP 4 Score: 81.2629 bits (199), Expect = 1.078e-14
Identity = 77/299 (25.75%), Postives = 132/299 (44.15%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+   K++N   F   I++ I  S    SL    P  + +  N  L   +     +F  E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +     +  S+P+ C  +   + Y  D   N P  Q       +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  740 KKEKITPI--PEGSAFFIFSNTNPIRVACHKLINHHIFTNLILVFIMLS--SASLAAEDPIRNFSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCNDEAKSSPEEC--KGTYILYK-DGDVNQPTLQK---RHWHNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 999          

HSP 5 Score: 80.8777 bits (198), Expect = 1.447e-14
Identity = 61/219 (27.85%), Postives = 112/219 (51.14%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  510 QPMWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNVVMYDGIMAYGGPSSSGMIVC------IYFIILFICGNYILLNVFLAIAVD 716          

HSP 6 Score: 53.5286 bits (127), Expect = 3.365e-6
Identity = 70/269 (26.02%), Postives = 112/269 (41.64%), Query Frame = 3
Query: 3678 DIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDF-IVVLGSFVDVIFM------NQEPAVD--------------GALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF-GKI------------------ALNNTGSEITTNN---------------NFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            +   Y F+ +FTIE  LKIIA+        Y  +  N+ DF IVV+G F  V+ +       ++  V+              G   +   R FR LR ++L+    S++ +L + I A   L  + LLVL ++ IYAIIG++ F GK+                  A+N  G   T N                NF     + + + +CIT E W  ++    D             G    + YF+S +I  ++ ++NL L V+  +F
Sbjct:  116 ETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLEVLTKDGGQEDEGVEIPLAAATHAHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCFLVEMISEDEPAPCAVNGHGRTCTINGTECREGWHGPNGGITNFDNFMFAMLTVFQCITMEGWTDVLYWMND-----------AMGMELPWVYFVSLVIFGSFFVLNLVLGVLSGEF 373          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005302.1 (pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gene:ENSPMAG00000004828.1 transcript:ENSPMAT00000005302.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.411 bits (716), Expect = 2.824e-85
Identity = 150/303 (49.50%), Postives = 209/303 (68.98%), Query Frame = 3
Query: 3819 IFMNQEPAVDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG-----TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIP 4706
            +  N   A +   RI+I  FRLFR LRLVKLL + + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + GS+I  NNNFQT   + ++L RC TGE W  IM++C+   +      +      +CG+ FA FYF+SF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   W+ YD  A+GRI  +DVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR +L+IK   N      +E+ NEELR +IK++W++T+  +L++++P
Sbjct:    3 LLQNSGSAAEDNNRISITFFRLFRVLRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMQD-GSQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGRRCDPDADASVGEEFSCGSSFAIFYFVSFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHVDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTSLKIKTDGN------LEQANEELRAVIKKIWKRTNMKLLDQVVP 298          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010500.1 (pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 gene:ENSPMAG00000009511.1 transcript:ENSPMAT00000010500.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.994 bits (528), Expect = 1.389e-60
Identity = 116/265 (43.77%), Postives = 168/265 (63.40%), Query Frame = 3
Query: 3954 AFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSS----GTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVG 4736
            +   LP+V LL+ M+ +IYAI+GMQ FG + L++ G  IT +NNFQT F + ++L R  TGE W +IM+SC+  +K  C+  S      CG+ FAYFYF+SFI L ++L++NLF+AVI++ F+YLT+DSS LGPHHL+ F+  W  YD  A GRIT   + +LL  ++PPLG GK CP     ++L+ M+MP+ +D T+ F  TL AL+R  L IK+     D     E + ELR  +  +W   S   L+ ++P +    +TVG
Sbjct:    1 SLQALPYVCLLIAMLFFIYAIVGMQVFGNVKLDDEGG-ITEHNNFQTFFQALMLLFRSATGEAWQEIMLSCL--SKKPCEQHSLNGENVCGSDFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWGDYDPAATGRITYTKMYELLRHMSPPLGLGKKCPVRIAYKRLVRMDMPIAEDNTVHFTTTLMALIRTALDIKIAKAGADKF---ECDSELRKEMMAIWPTLSQKTLDILVPPHRAVDLTVG 259          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003634.1 (pep scaffold:Pmarinus_7.0:GL483626:1829:10505:1 gene:ENSPMAG00000003326.1 transcript:ENSPMAT00000003634.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 3.298e-45
Identity = 93/185 (50.27%), Postives = 124/185 (67.03%), Query Frame = 3
Query: 3822 FMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSG-------TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLE 4355
            F+ Q       + I  FRLFR +RLVKLL K + IR +LWTFI +F  LP+V LL++M+ +IYA+IGMQ FGKIA+ + G +I  NNNFQT   + ++L RC TGE W +I++ C+     RC   S        TCG+ FA  YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+
Sbjct:   17 FIRQSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIVMMFFIYAVIGMQIFGKIAMQD-GMQINRNNNFQTFPQAVLLLFRCATGEAWQEILLGCMSGR--RCDPESDYNVGEEFTCGSNFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLD 198          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007697.1 (pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007697.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.42 bits (337), Expect = 1.462e-32
Identity = 117/319 (36.68%), Postives = 181/319 (56.74%), Query Frame = 3
Query: 1173 IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSV--KTTFEIQDNLIVDDEQ--------NNKIYENVFDRILGKLKSTSKKMEPYKLKA----------------QNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            ++EKQ L++  D   Y DWI Q + I  E  DE+    K    I    + D ++        +N+ + ++       + + +   E   L                  +   L +  T +Y++VI +LVF+N+L +A+E+  QP  L+Q QD +N   L +FT+E+L K++SLG + YF+  FN +D  ++   +IE  LV   VM+ +G S+LR VRLLR+FK+TK+W  L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG  S
Sbjct:    3 LREKQQLEE--DLKGYLDWIMQAEDIDPENEDETGGDGKPRSRITLADLTDKKKGRFAWFSHSNETHASIPASDADSVNTENTGHEAESLCCCVRLARRWRRWNRFCRRKTRLTVKSTGFYWVVI-ILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSS 318          

HSP 2 Score: 132.109 bits (331), Expect = 8.375e-32
Identity = 64/152 (42.11%), Postives = 100/152 (65.79%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELK 2972
            L LK+K+  IP  S+ FIFS +N  R+ CHR+I+H +   ++L +I+ S + +A  +P++ ++ +  IL  FDY FT  FT+E+++ M SYG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LK
Sbjct:  429 LNLKEKVVPIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLK 580          

HSP 3 Score: 75.0998 bits (183), Expect = 8.644e-14
Identity = 56/218 (25.69%), Postives = 111/218 (50.92%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + DI N + + +FT+E++ K+ +   + YF    N FD  VV G  ++ I +  E  V   L I++ R  R LR+ K+     ++  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF     S + + + +TGE W+ +M   +             C       YFI   I  N +++N+FLA+ ++
Sbjct:  142 QPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILV--EFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFP---QSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGMLVC------IYFIILFICGNCILVNVFLAIAVD 348          

HSP 4 Score: 72.0182 bits (175), Expect = 8.426e-13
Identity = 44/147 (29.93%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQI 632
            P+ S F+ F  TN +R+   ++++   F   I+  I  S   +SL    P  + +  N+ L   +     IF +E ++K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L++
Sbjct:  439 PEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLS--SVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKV 581          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007700.1 (pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 gene:ENSPMAG00000006953.1 transcript:ENSPMAT00000007700.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 3.271e-32
Identity = 94/204 (46.08%), Postives = 142/204 (69.61%), Query Frame = 3
Query: 1440 IKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +K+  ++ V+++LVF+N+L +A+E+  QP  L+Q QD +N   L +FT+E+L K++SLG + YF+  FN +D  ++   +IE  LV   VM+ +G S+LR VRLLR+FK+TK+W  L  +V +++ S++SI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   +++TVFQ++T E WN  MY GI   GG  S
Sbjct:   15 VKSTGFYWVVIILVFLNTLTIASEHYNQPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILVEFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQSLLTVFQILTGEDWNAVMYDGIMAYGGPSS 218          

HSP 2 Score: 129.798 bits (325), Expect = 1.474e-31
Identity = 64/152 (42.11%), Postives = 100/152 (65.79%), Query Frame = 3
Query: 2517 LELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELK 2972
            L LK+K+  IP  S+ FIFS +N  R+ CHR+I+H +   ++L +I+ S + +A  +P++ ++ +  IL  FDY FT  FT+E+++ M SYG   HKGS+ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LK
Sbjct:  310 LNLKEKVVPIPEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLSSVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLK 461          

HSP 3 Score: 77.411 bits (189), Expect = 1.284e-14
Identity = 57/218 (26.15%), Postives = 112/218 (51.38%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + DI N + + +FT+E++ K+ +   + YF    N FD  VV G  ++ I +  E  V   L I++ R  R LR+ K+     ++  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF     S + + + +TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:   42 QPDWLTQVQDIANKVLLAMFTVEMLTKMYSLGLQAYFVSLFNRFDCFVVFGGIIETILV--EFGVMSPLGISVLRCVRLLRIFKVTKYWAALSNLVASLLNSMRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFP---QSLLTVFQILTGEDWNAVMYDGIMAYGGPSSTGMLVC------IYFIILFICGNYILLNVFLAIAVD 248          

HSP 4 Score: 72.0182 bits (175), Expect = 7.180e-13
Identity = 45/153 (29.41%), Postives = 80/153 (52.29%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSII 650
            P+ S F+ F  TN +R+   ++++   F   I+  I  S   +SL    P  + +  N+ L   +     IF +E ++K+  YG  LH  S+ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L++    +I
Sbjct:  320 PEGSAFFIFSSTNPVRVCCHRLIHHHIFTNLILAMIMLS--SVSLAAEDPIRNHSFRNNILGYFDYAFTAIFTVEILLKMTSYGAFLHKGSFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKVKCRPVI 468          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Match: CCH1 (Voltage-gated high-affinity calcium channel; involved in calcium influx in response to some environmental stresses as well as exposure to mating pheromones; interacts and partially co-localizes with Mid1p; however, evidence suggests CCH1 is not required for Mid1p function [Source:SGD;Acc:S000003449])

HSP 1 Score: 113.235 bits (282), Expect = 3.030e-25
Identity = 157/688 (22.82%), Postives = 298/688 (43.31%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKI----------------------------------LLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVV---FIGILDVILVDVEMSAL-KTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMN-RTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKP--IFRYVPMDRYRFRIWQLVTSEK--XXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMIS-------CVDDNKSRCQLSSGTCGTP-FAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDS---SNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGF 4460
            S + FS  ++FR FC R++  S  K+                                    +++IV SC +   +       T  +  +  D  F   F++E I+  ++ G I+   +YLRN +N+IDF V+   +I ++  +  +  +S + K L  LR ++ L   N A++  +L+  +   +  I++  LI L   F F+V G+  FKG    C+D S    D C   Y     +  +Q  +M+ R +     + D+  +   +L+ + + +G+ D+L   +++           +     F +++  +   F++N+F+ F+V +  +   S Y + E +K   +   L+ ++KP  I   + + R R   +QL   +K  +      +++   I M L    NP  +     ++      +F I+  L +     R YF  K N     +++ +F+        PA       NI   F  +  + ++ +N ++  +L T   A  +LP ++ L      ++ +  +       L   GS  T N NF+T+  S IVL RC  GE W+ IM         C  D+ S    +   CG+  +AY   +S+ I+S Y+ +N+F+++II  F Y+ +     S +    ++ +IE WS +D    G +    +  ++   + PL F
Sbjct: 1155 SYYFFSPQHRFRRFCQRLVPPSTGKRTDGSRFFEDSTDLYNKRSYFHHIERDVFVFIFALATILLIVCSCYVTPLYRMHHKMGTWNWS-SALDCAFIGAFSIEFIVKTVADGFIYSPNAYLRNPWNFIDFCVLISMWINLIAYLKNNGNLSRIFKGLTALRALRCLTISNTARQTFNLV--MFDGLNKIFEAGLISLSLLFPFTVWGLSIFKGRLGTCNDGSLGRAD-CYNEY----SNSVFQWDIMSPRVYQQPYLHLDSFASAFSSLYQIISLEGWVDLLENMMNSSGIGTPATVMGSAGNALFLVLFNFLSMVFILNLFVSFIVNNQARTTGSAYFTIE-EKAWLESQKLLSQAKPKAIPNLIELSRVRQFFYQLAVEKKNFYYASFLQVVLYLHIIMLLSRSYNPGNLIGYQGVYFMFSTSVFLIQEALHMCGEGPRLYFRQKWNSIRLSIIIIAFIMNAVAFHVPASHYWFH-NIKGFFLLVIFLFIIPQNDTLTELLET---AMASLPPILSLTYTWGVLFLVYAIALNQIFGLTRLGSNTTDNINFRTVIKSMIVLFRCSFGEGWNYIMADLTVSEPYCSSDDNS----TYTDCGSETYAYLLLMSWNIISMYIFVNMFVSLIIGNFSYVYRSGGSRSGINRSEIKKYIEAWSKFDTDGTGELELSYLPRIMHSFDGPLSF 1825          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU9])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 357/754 (47.35%), Postives = 509/754 (67.51%), Query Frame = 3
Query: 2544 IPIASSLFIFSQSNKFRIFCHRVINHS-LTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDV--EMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRC------QLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEII-PSNVMNTVTVGKFYATFLIQDFFR 4775
            +P  SSLFIFS +N FR+ CHR+  +S     ILL+IIVSSC M+A  +PL  N+ +  +LN FDY FT  FT+E+ I +I+YGVI HKGS+ R+AFN +DF+VV + I+ + L D   ++S ++ LRVLRV++ LR IN+AK LKH++  V + +  I  I+L+ +LF F+F+VIGV  FKG+F++C+D  + T+  C+G YI +   G     V +R W    FN+++V   M+TLF V TF+G+  IL +++D+    EGP+ NN  ++  +Y+IY+II  FF+INIF+GFV++++Q   E E+K  ELDKNQ+KC+   LK++P  RY+P +R +F +W++VTS+ F   IF  I  NTI + + +   P+L   + D FN  F  +F +E ILK+ AF  +NYF D+ N+FDF+VV+GS VD+  MN E + +       FRLFR+LRLVKLL +   I+ +LWTFI +F  LP+V LL++M  +IYA++GMQ FG+IA++   ++I  NNNFQT   S +VL R  TGE W  IM++C D   ++C      Q + G CGT FAY YF SF  + ++LI+NLF+AVI++ FDYLT+D S LGPHHL+ F+  WS YD  A G +  +D+V +L +I PPLGFGK CP  +  ++L+ MNMPL +DGT+ F ATLF LVR +L IK P   +   S+E+ NEE+R II ++W KTS   L+EII P    + VTVGKFYAT+LIQ++FR
Sbjct:  807 MPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSC-MLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGWPGILESSMDSTDVDEGPFLNNRPWVAIYYVIYIIIIAFFMINIFVGFVIVTFQNEGEEEFKDCELDKNQRKCVEFALKARPTRRYIPTNRLQFHVWRVVTSQPFEYLIFAFITGNTILLMMQYYNEPKLYTRVLDGFNIGFTSVFLLECILKLFAFKPKNYFLDRWNLFDFVVVVGSVVDIT-MN-EVSSEQMFAFGFFRLFRALRLVKLLNQGSGIKTLLWTFIKSFQALPYVGLLIIMTFFIYAVVGMQMFGRIAIDPE-TQINRNNNFQTFPQSLMVLFRSATGENWQLIMLACTDTPNAKCDPNAYPQDTDGLCGTDFAYAYFCSFYAICSFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFVRVWSEYDPEASGCVKHVDIVTVLKRIAPPLGFGKFCPHREACKRLVSMNMPLNRDGTVNFNATLFGLVRTSLSIKRP---EGKGSLEKANEEMRAIIMKVWPKTSQEFLDEIIQPPGGDDEVTVGKFYATYLIQEYFR 1553          

HSP 2 Score: 422.165 bits (1084), Expect = 1.408e-120
Identity = 279/645 (43.26%), Postives = 401/645 (62.17%), Query Frame = 3
Query:  168 KRNMFP--CLKPDRSCFYFKKTNRLR--------IFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELL----DESSVKTTFEIQDNLIVDDEQNNKIYENVFDRIL---GKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQ--IGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGG 2042
            KR   P   ++P R+ F     N +R        +F   +  T  F+  I+I IF +C  L+  +  P  DS+ +N++LE  E   + IF +ES++KII YGFV+H  +YLRN WN+LDF+IVV+G+ T I+ +      D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLV+F++II++I+G+ LF G  H TCY+NVT Q     P PC+    S GY C N      GQV  CL          ++ GPN GIT+FDN+G A LTVFQ IT EGWTD+MY ++D  GNSWPW++F+ L+I GS+F+LNL++G+L G+F KEK + ++  EF K ++     D Y  Y DWI Q + I  +      +E         +     DD   NK  EN  D      G +    K ++ +  + +      +KT++++  ++V VF+NSL +A E+  QP  L+QF D +N  FL LFT+E+++K++ LGF  YF   FN +D +++  S++E+ L  T  M+Q  IG S+LR VRLLR+FK+T++W +L  +V +++ S++SI+ LLLL+ LFM+I SLLGMQ+FGGKF   D  + R+NFD    A++TVFQ++T E WN  MY GIQ  GG
Sbjct:   32 KRQKKPTNAVRPKRALFCLTLGNPIRSTAISLFTVFFLDVFRT-PFDVMILITIFANCAALAAFQPLPEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCS--TESEGYSCSNAGP---GQV--CLK---------KWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEFAKEKARAQKSGEFQKLREKQLVDDAYHGYLDWISQAEDIEGDSSAGEDEEGKADRKPSFRRRKENDDISKNK--ENQEDSAASDQGWIDRKKKILKRFHHRLRRSCRKAVKTQWFYWTVIVFVFLNSLTLALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGL--TEAMDQRPIGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFGGKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGG 655          

HSP 3 Score: 101.293 bits (251), Expect = 3.509e-21
Identity = 67/238 (28.15%), Postives = 128/238 (53.78%), Query Frame = 3
Query: 2637 ILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVI--LVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYA-CSD--ISQRTEDN---CKGTYIYYAYDGSYQAKVMNRTWSNNQF---NYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            ++L+ I ++C  +A F PL P    + I   L + +++F   FT+E ++ +I+YG + H G+YLRN +N +DF++V +G+  +I  L   +   +K LR  RV++ LR ++    L+ ++NS+   +  ++ I L+ +    I+++IGV  F G  ++ C D    Q T D    C      Y+   +   +V  + W    +   N+DN+    +T+F   T +G+ D++++  DA+
Sbjct:   79 MILITIFANCAALAAFQPL-PEQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTPDSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSINDAI 315          

HSP 4 Score: 90.5077 bits (223), Expect = 5.865e-18
Identity = 59/227 (25.99%), Postives = 124/227 (54.63%), Query Frame = 3
Query: 3630 MSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF---MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
            ++L     P+ +    D  N +F+ LFT+E+++K+    F  YF    N FD +VV+ S +++     M+Q P     + I++ R  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG     N G E    +NF + + + + + + +TGE W+ +M + +   +S   ++      P  YF F+  +++ NY+++N+FLA+ ++
Sbjct:  475 LALEHYNQPEFLTQFLDKANKLFLALFTLEMVVKMYCLGFHGYFASLFNRFDCLVVISSLLELGLTEAMDQRP-----IGISMLRCVRLLRIFKVTRYWSSLSNLVASLLNSMRSIMGLLLLLSLFMVIFSLLGMQIFG--GKFNLGDEDVPRSNFDSFWRALVTVFQILTGEDWNAVMYTGI---QSWGGITESLSAIPILYFIFL--VVVGNYILLNVFLAIAVD 689          

HSP 5 Score: 89.7373 bits (221), Expect = 1.112e-17
Identity = 53/162 (32.72%), Postives = 85/162 (52.47%), Query Frame = 3
Query:  189 LKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + P+ S F F  TN  R+   +I     F  FI++ I  S   L+     P N ++  N  L   +     +F IE  +KII YG +LH  S+ R+ +N+LDF++V + IV+  L  +      ++ LR  RVLRPLR I++   L+ V+  + +A+K + N
Sbjct:  807 MPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAED--PLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIVSIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGN 966          

HSP 6 Score: 61.2326 bits (147), Expect = 4.978e-9
Identity = 109/446 (24.44%), Postives = 202/446 (45.29%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYG------NSWPWVFFIPLVILGSYFLLNLIIGILCGQFT-KEKLKV--------------------ERQNEFIKEKQNLKDT----DDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQN----------NKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLL------------NIIKTRYYFI-VILVLVFINSLIMATE-YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXG---FKNYFIK-PFNIYDFIIITVSVIEMSLVITNVMNQIG-FSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRT-------------------------------NFDDMLIAIITVFQLMTIEGW 2003
            ++FD+   A++TVFQI+T E W  +MY     +G      ++ P ++FI LV++G+Y LLN+ + I        E L                      E+++   K+ +N + +      +   K W        NELL  +       ++ + I D E            N+ +E+V      +  ++++ M+   +  ++ L             + I T  YF+  IL+L+ ++S ++A E  +      +Q  +Y + FF  +FTIE+ +K+ + G    K  F +  FN+ DF+++ VS++  S+ + +  +QI    ILR +R+LR  +       LK +V  +  ++K+I +++L+ VLF  + +++G+QLF G F S   +   T                               NF+D+  A++T+F +MT EGW
Sbjct:  621 SNFDSFWRALVTVFQILTGEDWNAVMYTGIQSWGGITESLSAIPILYFIFLVVVGNYILLNVFLAIAVDNLADAESLTEMEEEKKKEREEELEMKLRMEEKESSSNKDLENKRASTSSGKSHRLIKIW------KTNELLHLAGKIRVSRLRKHPITDAESPSLAEDSKATLNRDHESV------RSATSTEVMDHEPMPPESSLFIFSNTNCFRVVCHRIATNSYFVNFILLLIIVSSCMLAAEDPLNSNSKRNQVLNYFDYFFTAVFTIEITIKIIAYGVILHKGSFCRSAFNLLDFLVVAVSIV--SIALRDSSSQISVVRILRVLRVLRPLRAINRAKGLKHVVQCVFVAVKTIGNIMLVTVLFNFLFAVIGVQLFKGTFFSCTDAEKITKRECQGQYIEFKGPGLTNPVVKDREWQPQTFNFNDVPQAMLTLFTVMTFEGW 1052          

HSP 7 Score: 60.8474 bits (146), Expect = 5.890e-9
Identity = 64/263 (24.33%), Postives = 115/263 (43.73%), Query Frame = 3
Query: 3645 DKNPQLINDISDIFNYIFICLFTIEVILKIIAFNF----RNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFF--------------------------------------GKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            +++  LIN+  ++  ++F+ +FT+E +LKIIA+ F      Y  +  NI DF++V+     +I     P    +  +   R FR LR ++L+    S++ +L + I A   L  + LLV+ ++ IYAIIG++ F                                      G++ L           NF  +  + + + +CIT E W  +M S  D             G  + + YF++ II  ++ ++NL L V+  +F
Sbjct:   99 EQDSSLINEELEVAEFVFLGIFTMESVLKIIAYGFVMHPGAYLRNGWNILDFVIVVVGLATIIVKLYTP---DSFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKALIPLFHIALLVVFVVIIYAIIGVELFMGKLHSTCYDNVTGQPTFDEPHPCSTESEGYSCSNAGPGQVCLKKWEGPNYGITNFDNIGLACLTVFQCITLEGWTDVMYSIND-----------AIGNSWPWLYFVTLIIWGSFFVLNLVLGVLSGEF 347          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO46797 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP56])

HSP 1 Score: 172.94 bits (437), Expect = 4.607e-43
Identity = 177/678 (26.11%), Postives = 347/678 (51.18%), Query Frame = 3
Query: 2586 KFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFN---PLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGI-LDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEE-------LDKNQKKCIALILKSK----PIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDV-IFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQ-----LSSGTCGTPF-AYFYFISFIILSNYLIMNLFLAVIIEKFDYLTK-DSSNLGPHHLETFIEQWSYYDIGARGRITPLDVV-DLLTKINPPLGFGKMCPQDKCLRKLMHMNMPL-EKDGTICF 4544
            KFR      + H   +  +L  ++ S   + F +     +P+  +A  LN  +++F   F+LE I+ +I +G +    SY  + +N +D ++V + + +  +  +  +S  ++ R +R ++ LR I++   +K +IN++   +  I  ++++ +LF  +FS+ GV  F G FY C +     ED      +             +  W N   N+DNV+NG + L  V+T++G+ +++   +D+ +  + P +  N   + ++++++I+  FF++N+F+G ++ ++   ++   K EE       L ++Q+K + +++ +     P  R  P D +R +++ LV+S +F  FI  +I+ N   M +     P L   I    NY+ + +F +E I+KIIA    +YF    +IFDF+VV+ S V + + M+ E AV     + + R+FR  RL++++   K IR +L   I +   L  +  L+ ++++IYAIIGM  FG I      +++    NF+T  +S I++ R  TG  W+ I+ + V      C      L +G CG P  A FY +++I+    +I+N+++AV+++  +   + D   L     +++   ++ + +G   +  PL V+ + L  ++ P       P ++ +RK   M +P+ E D   CF
Sbjct:  781 KFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERA--LNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLFENPNLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVN----AEDEKLSPSVIPNKTACLDHP--DYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKK---KYEEINSMGMLLTESQRKWVQILMAAAKRKPPSNRLRPTDCFRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVIG---NYVLVGIFLLEAIIKIIAMRL-HYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGNIKKQGALNDLV---NFETFSSSIILIFRLGTGTGWNDILDALV-VQPPHCDPNFGGLPNGNCGFPIGAVFYLVTYIVSVFLIIVNMYIAVLLDNVNRAHENDEFGLSKDKFKSYYHTFANFSMGK--QFLPLRVLPEFLAALDKPFKIAH--PSEELIRK---MKIPVREGDLVHCF 1428          

HSP 2 Score: 115.546 bits (288), Expect = 1.305e-25
Identity = 154/669 (23.02%), Postives = 296/669 (44.25%), Query Frame = 3
Query:  186 CLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC-YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVE---RQNEFIKEKQNLKDTDDYLFYKDWIEQG---------DKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFD------RILGKLKS----------TSKKMEPYKL----------------------KAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISED-GS--LYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQ 2030
            CL P          + LR+F   ++    FE  + + I  +C+ L L            ND  E  E     I+ +E I KII  GFV  + +YLR+ WN LD ++V L   +Y+    D     +  +R  RVLR  R IS +  L+ ++NS++ ++K L ++L+L LF + + +++G+ LF+G     C         ++NP     R      LC             C   Y    +V   P P+ G T+FD++G++++  FQI+T + W ++   V    G  W  ++F+  +   S++LLNL++ ++   +  E    +    Q++                 + W+             ++   L+ +S +  +   Q  +       +++ ++         ++L  L+S           +K + P  L                      +A + L+  I+   +  +I  L+ +N++++   Y G P  L+   D  N  F  LF +E+++K+F+ G   Y    +N++D +II  S +   L  +      G SI R +RLLRV  L + W+ + K++  +  S+  I ++  ++ + + + +++GM++FG  + +E  GS  + R NF D   + + VF+++  E W   ++  ++
Sbjct:   43 CLGP---------VHPLRMFCILLITHPYFEIIVTLVILVNCIILGL------------NDPPEEAEYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFL---SYLSLAPDIA--SLSGIRTLRVLRAFRTISALKGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALIGLQLFTGELRNKCVLETANATTINNPSSWYHREGE-PLLCGF-----SSTAGRCPANYTCVAHV--GPNPDHGFTNFDDIGWSLVMAFQILTMDFWENLYDRVLRSMGE-WYMMYFVVGIFSCSFYLLNLVLAVVYMSYHHEMNLTDNEVTQSQVTHSPVTQSQVTHSPVTQSWVTHSPVTQSRVSQSRVTQSLVTQSWLMQSLVTQSPVTESRVSQSRVTQSRAHPKTDTIQVLEPLESHLYPPDEEEEETKPLTPPSLNGIVLGEDQEKGVLCPKYPRLSRACSALVEFIQRPLFDGIIAGLILLNTVVLTMYYHGMPDDLTFVLDILNAIFTGLFILEMIVKIFAFGLVKYICNKWNLFDSVIIITSAVAYFLGTST-----GVSIFRILRLLRVLYLAQSWETMAKLIRAIAHSVDPIFNITCILGVIIYVFAVVGMRVFGPHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCSE-WVEPLWDCMR 670          

HSP 3 Score: 105.916 bits (263), Expect = 1.188e-22
Identity = 154/650 (23.69%), Postives = 278/650 (42.77%), Query Frame = 3
Query:  105 NQKYYINTFLNYDINDKFSSKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMY-MVDDVYGNSWP--------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRIL---GKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKL---TKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            N K YI      +I+D F     N   C    +   + K   R+R F    V  + FE FI+  +  S   L    ++ +    DL   L         IF++E I+K+I +GFV    SY  + WN LD +IV + +    L       V  ++ R  R LRPLR IS++  +++V+N++  AI P    +L+V  L  +   +          + C N       +  +  +P           +PN       +CLD  +      R+   N+   +FDN+    L + Q+ T EGW ++M   VD    +  P        + +F+  +I+GS+F+LNL +G++   F   K K E  N                            +  LL ES  K                       + +IL    K K  S ++ P     +  L +++ +  + + IL ++  N  +M  ++  QP + +   +Y  +   +L  I  ++ +      +YF K ++I+DF+++  S++ M L ++     +   +LR +R+ RV +L    +    +++++  ++ S+ ++ ++  L+ L M I +++GM  FG   I + G+L    NF+    +II +F+L T  GWN
Sbjct:  748 NTKRYI-----VEIDDCFPECCMNACGCTSGQQHFCWLKFRCRVRCF----VEHRYFEWFILFTVMVSSFTLVFEDIHLHQKP-DLERALNFLNFLFAAIFSLEFILKVIGFGFV----SYFTSVWNCLDALIVSVCVSVACLFENPNLSV-FRSFRTVRGLRPLRAISRLGGMKVVINALFAAI-PGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVN-------AEDEKLSPSV---------IPNKT-----ACLDHPD-----YRWVNANV---NFDNVINGFLALLQVATYEGWMEVMADAVDSTKIDQQPSYEANLIAYAYFVVFIIVGSFFVLNLFVGVIIDNFNTLKKKYEEINS---------------------------MGMLLTESQRK-----------------------WVQILMAAAKRKPPSNRLRPTDC-FRGKLFDLVSSNQFEVFILTVIMCNMGMMMVQHYDQPPLTTVIGNYVLVGIFLLEAIIKIIAMRL----HYFKKAWSIFDFVVVVSSIVGMYLGMSTESAVVSPGLLRVLRVFRVARLLRVVQFAKRIRQLLVAIIISMPALFNIGTLLFLVMFIYAIIGMSSFGN--IKKQGALNDLVNFETFSSSIILIFRLGTGTGWN 1295          

HSP 4 Score: 82.4185 bits (202), Expect = 1.616e-15
Identity = 45/145 (31.03%), Postives = 83/145 (57.24%), Query Frame = 3
Query: 2556 SSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSV 2990
            +SL      +  R+FC  +I H   + I+ ++I+ +CI++   +P +            +YIFT  +TLE+I  +IS G +    +YLR+ +NW+D +VVF+  L    +  ++++L  +R LRV++  RTI+  K L+ ++NS+
Sbjct:   39 ASLLCLGPVHPLRMFCILLITHPYFEIIVTLVILVNCIILGLNDPPEEA----------EYIFTAIYTLEMICKIISRGFVKDSYAYLRDTWNWLDSLVVFLSYLS---LAPDIASLSGIRTLRVLRAFRTISALKGLRAMVNSL 170          

HSP 5 Score: 61.2326 bits (147), Expect = 4.960e-9
Identity = 99/415 (23.86%), Postives = 186/415 (44.82%), Query Frame = 3
Query:  909 LRFPGPNIGITSFDNMGF----------AMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIY----ENVF-DRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATE--YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFI----SEDGSL----------------YR-----TNFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            +R  GP+    +F + G           + + VF+I+  E W + ++    V  N+   +FF+P +I+G++ +LNL + +L   F K++  + R+      +Q   +    L +              L  +     +  Q    V++ +N K Y    ++ F +  +     TS +     LK +  +   ++ RY+   IL  V ++S  +  E  ++ Q   L +  ++ N  F  +F++E +LK+   GF +YF   +N  D +I++V V  ++ +  N  N   F   R+VR LR  +       +K ++N +  +I  I S+L++ +LF ++ S+ G+QLF GKF     +ED  L                YR      NFD+++   + + Q+ T EGW   M   +
Sbjct:  621 MRVFGPHYTAEAFGSRGIPRWNFTDFTHSFMMVFRILCSE-WVEPLWDCMRV-TNTAALLFFLPALIVGNFIVLNLFVALLLNSFAKKEEDLHRE----ASEQPYVNPCSCLAH--------------LTRTRKTRMYYTQA---VNNNKNTKRYIVEIDDCFPECCMNACGCTSGQQHFCWLKFRCRVRCFVEHRYFEWFILFTVMVSSFTLVFEDIHLHQKPDLERALNFLNFLFAAIFSLEFILKVIGFGFVSYFTSVWNCLDALIVSVCV-SVACLFENP-NLSVFRSFRTVRGLRPLRAISRLGGMKVVINALFAAIPGIGSVLVVSMLFWLMFSISGVQLFAGKFYKCVNAEDEKLSPSVIPNKTACLDHPDYRWVNANVNFDNVINGFLALLQVATYEGWMEVMADAV 1010          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35661 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKR1])

HSP 1 Score: 162.155 bits (409), Expect = 9.550e-40
Identity = 196/701 (27.96%), Postives = 354/701 (50.50%), Query Frame = 3
Query: 2604 HRVINHSLTKKILLVIIVSSCIMIAFFNP-LQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGI---LDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYI---YYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELD-------KNQKKCIALILKSKPIFRY-VPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN-QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKI----MISCVDDNKSRCQLSSGTCGTPF-AYFYFISFIILSNYLIMNLFLAVIIEKFD-YLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEE 4640
             R++ H + + I+L +I +S I +AF +  L    T   +L I + +F V FT+E+++  I  G      +Y  N +N +DF++V + I   L  I  + +++ +++LR LR  + LR I++ + +K +I S+   +  I  ++L+ L+F  IFS++GV  F G F  C D      + C  + +          Y+       W N+  N+D V  G + L  V+TF+G+ +I+   +DA +  E P   NN   + F+++++I+  FF +N+FIG ++ ++ Q ++       +D       +N    +      KP  R   P ++++  ++ +V S KF  FI L I +N + M +       L      I N IF  +F +E IL+IIA   + YF +  N+FDF++V+ S + +I  N Q   V     + + R+FR  RL++     + IR +L++ + +   L  +  L+ +I++IYAIIGM  FG +      +++    NF+T  +SF++L R +T   W+ I    MIS  D + +   L SG CG  + A  Y  SF+++   +++N+++AVI+E ++  + ++   +    +E F + W  +D  A   I   D+ D + ++   L   K    +K    L  +N+PL K   I     L ALV+R +     ++S+  K + +  EE
Sbjct:  821 RRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPTLKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFGKCVD---EGGEKCPASVVPNKTVCLSNGYR-------WENSNINFDTVDQGFLALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQRNWMNALKSAATKKPKKRIRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMV--QHYDHLAVWSKQILNLIFTSVFILEAILRIIALR-KGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVINPSLLRVVRVFRVGRLLRFFEAARGIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFGHVKKTEALNDVV---NFETFGSSFVLLFRLMTSAGWNDILDPLMISEPDCDPNYRGLPSGNCGNKYMAPIYLGSFVVIIFLILINMYIAVILENYNQVMEQEKIGITNEDIELFYQMWELFDPNATQYIPYADLSDFVHQMEGNLRIPK---PNKAACAL--LNIPLVKGDKIHCLDLLQALVKRIVSGFEDVDSEGFKIVMQRMEE 1496          

HSP 2 Score: 113.235 bits (282), Expect = 8.169e-25
Identity = 105/341 (30.79%), Postives = 174/341 (51.03%), Query Frame = 3
Query:  198 DRSCFYFKKTNRLRIFIGKIVNTKA------FEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPG-PNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPW--VFFIPLVILGSYFLLNLIIGILCGQFTKE--KLKVERQNEFIKEKQ 1187
             +S + F   N +R F  K++  +          F+++ I  +C+ L++T            +  E  E     I+ IE   KII  GF LH  +YLR+ WN LDFI+V+LG VT    V      ++  +  FRV R LR IS +  L+ ++N++++++K L ++++L LF I IF+++G+ LF G     C   V  + +S P       +S+ YL DN P L  G          N   +    G PN G TSFD+ G+A+LT FQ+IT + W ++    ++V     PW  V+F  ++  G +FL+NL++ ++   +  E    K+E + E  ++K+
Sbjct:   21 SKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVNCVFLAMT------------NPPEQPEYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTISPDVA-----NLSGIPTFRVFRALRTISAVKGLKAMVNTLLVSMKMLWDVMVLTLFFICIFALIGMQLFIGELRNKCALPV-PENLSVPYRTYASNSSIWYLEDNEPIL-CGNTTGSRTCPTNYTCLPHAGGNPNFGYTSFDHFGWALLTGFQLITLDFWENVY---NNVIYTMGPWYVVYFAVVIFFGPFFLVNLVLAVVAASYENEVKASKMETEEERKEQKR 339          

HSP 3 Score: 93.5893 bits (231), Expect = 7.934e-19
Identity = 154/612 (25.16%), Postives = 288/612 (47.06%), Query Frame = 3
Query:  234 LRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVD-IKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMY-MVDDVYGNSWP--------WVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVE---RQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSV-------IEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            +R  + ++V  K FE  I+  I  S + L+   +Y ++    L   L+   +   +IF +E ++K I  GF    K+Y  N WN+LDF+IV++ I+  + ++    ++  I++LR  R  RPLR IS+   +++V+ S++ AI  + N+LL+ L   +IFSI+G+ +F G F   C +   ++  ++  P      S GY  +N                            NI   + D  GF  L + Q+ T EGW +IM   VD    +  P        ++FF+  +ILG++F LNL IG++   F + K ++E     + F+   Q           ++W       +N L   ++                                 K   K++   + K Q  L +++++R + + I++ + IN ++M  ++     V S  +   N+ F  +F +E +L++ +L  K YF+ P+N++DF+I+  S+       ++ SLVI N        + R  RLLR F+  +    +++++ ++V S  ++ ++  L+ L + I +++GM +FG   + +  +L    NF+    + + +F+LMT  GWN
Sbjct:  816 MRYKVRRLVEHKVFEGIILFLIAASSISLAFEDVYLDSKPT-LKQVLQILNILFAVIFTVEMLLKWIGLGF----KTYFTNPWNILDFVIVIVSIMVSLATIFGNDQIAFIRSLRTLRAFRPLRAISRFEGMKVVITSLLHAIPGIGNVLLVCLMFWLIFSIMGVQIFGGKFG-KCVDEGGEKCPASVVPNKTVCLSNGYRWEN---------------------------SNINFDTVDQ-GF--LALLQVATFEGWMEIMEDAVDATKIDEQPIEENNVSAYLFFVVFIILGTFFTLNLFIGVIIDNFNQLKQQMEAVGSMDVFLTSTQ-----------RNW-------MNALKSAAT---------------------------------KKPKKRIRRPQNKFQGELYDMVQSRKFEVFIMLFITINMVVMMVQHYDHLAVWS--KQILNLIFTSVFILEAILRIIALR-KGYFLNPWNVFDFVIVISSIIGIIVENLQTSLVI-NPSLLRVVRVFRVGRLLRFFEAAR---GIRRLLFSLVISTPALFNIGALLFLIIFIYAIIGMSIFG--HVKKTEALNDVVNFETFGSSFVLLFRLMTSAGWN 1331          

HSP 4 Score: 80.1073 bits (196), Expect = 9.930e-15
Identity = 50/158 (31.65%), Postives = 85/158 (53.80%), Query Frame = 3
Query: 2553 ASSLFIFSQSNKFRIFCHRVIN-------HSLTKKILLVIIVSSCIMIAFFNPL-QPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITM 3002
            + SL++F   N  R F  ++I        H+    +LL I+V+ C+ +A  NP  QP           +Y+F   +T+E+   +I+ G   H+ +YLR+ +NW+DFIVV +G + +      +S + T RV R    LRTI+  K LK ++N++ ++M
Sbjct:   21 SKSLYLFGPENPIRQFSLKLITNQYPLQLHNRHMFVLLTILVN-CVFLAMTNPPEQP-----------EYVFAAIYTIEMFCKIIAKGFALHRYAYLRDKWNWLDFIVVILGNVTISPDVANLSGIPTFRVFR---ALRTISAVKGLKAMVNTLLVSM 163          

HSP 5 Score: 72.4034 bits (176), Expect = 2.113e-12
Identity = 63/202 (31.19%), Postives = 106/202 (52.48%), Query Frame = 3
Query: 3672 ISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMN 4277
            + +I N +F  +F +E+ILK+IA  F  Y     NIFD IVV+ S VD I +N+     G   I++ R FR LR++KL     ++  +L T   +   L  + +++ +I+YI+A++GMQ  G     +         NF+   +SF+++ R + GE W + +  C+        L++G    P A   F+   IL N++I+N
Sbjct:  534 VVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDFI-VNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE-WIEPLWDCM--------LATG----PVAMLLFVPAFILGNFIILN 721          

HSP 6 Score: 66.6254 bits (161), Expect = 1.019e-10
Identity = 47/151 (31.13%), Postives = 77/151 (50.99%), Query Frame = 3
Query:  252 KIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLI--------LIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS--VTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            K  N K  E FI++CI  + L +S+            + +LE+  L ++         IF +E I+K+I  GF+     Y+R  WN+ D I+V++ IV +I++  V D G   I  LR FR+LR L+L     ++  +L +I  ++  L N
Sbjct:  498 KFTNGKVMEIFIIVCILLNTLVMSIE-----------HPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFL----GYIRVAWNIFDGIVVIISIVDFIVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGN 633          

HSP 7 Score: 62.003 bits (149), Expect = 2.747e-9
Identity = 61/213 (28.64%), Postives = 113/213 (53.05%), Query Frame = 3
Query: 1377 KSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVM----NQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISE--DGSLYRTNFDDMLIAIITVFQLMTIE 1997
            K  S  M     + +  LL     +   I I+V + +N+L+M+ E+      L    + SN  F  +F +E++LKL +LGF  Y    +NI+D I++ +S+++    I N         G S+LR+ RLLRV KL K W  +  ++  + +S+ ++ +L +++ + + I +++GMQL G  +  +   GS+ R NF D   + + +F+++  E
Sbjct:  479 KKRSSIMARRWKRFRRRLLKFTNGKVMEIFIIVCILLNTLVMSIEHPRLEDPLLTVVNISNEVFTFIFLLEMILKLIALGFLGYIRVAWNIFDGIVVIISIVDF---IVNKFVPDAGGTGISVLRTFRLLRVLKLAKSWSTMNSLLATIGKSLGALGNLTVILAIIVYIFAVMGMQLLGNSYTPDKFGGSIPRWNFKDFPHSFMMIFRVLCGE 688          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO36844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI0])

HSP 1 Score: 162.155 bits (409), Expect = 1.021e-39
Identity = 156/565 (27.61%), Postives = 289/565 (51.15%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNP-LQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRT------INKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSD--ISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARE--------SEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--MNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTG---SEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSR 4187
            SL++F+  N+FR+    +  +    + +L+ I+ +C+++A   P + P + +  +++I  Y+F   FT+E+++ +I+ G+     +YLR+ +N +D  +V I  +DVI+          L VLRV + LRT      I++A  LK ++ ++  ++  I  I+LI   F  IF ++GV  FKG F+ C+D  +   T+  C          GS         W N ++N+DN+   ++TLFV ST  G+ +I++  IDAV   + P  N+ RY   +++ +L++  F ++N+ +G VV ++Q+ R          E K  + ++  ++ IA   + + +  + P  R R  I  + T   F+  I  +I LN + M+L   + P  +       NY+F  +F +E ILKI A   + Y  D+ N  D ++V+ S V +    M  E  ++  + I + R+ R  R++KLL   + IR +L T   A   +  + +L L++ +I++ +G++ FGKI     G     +  + NF++   + + L R  TG+ W+ I+   +  +  R
Sbjct:  910 SLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEGPSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGNIVLIAATFFIIFGILGVQLFKGKFHYCTDATVPVTTKTEC------LENGGS---------WVNREYNFDNLAKALLTLFVFSTKDGWVNIMYDGIDAVGIDKQPIRNHARYNVIYFVGFLLLAGFVVLNMLVGVVVENFQKCRTLIEMEKKIDEEKKNKKEEKMRREIA---EDEALSEHYP--RPRKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTI-IRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWNGILKDTISPDVCR 1453          

HSP 2 Score: 110.923 bits (276), Expect = 4.123e-24
Identity = 88/243 (36.21%), Postives = 142/243 (58.44%), Query Frame = 3
Query: 1314 VDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGK--FISEDGSL--YRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQ 2030
            V     N + E+  D  L   + TS+       K ++   + + ++++  VI+  +F+N+L M  EY GQP  ++   +  N  F  +F IE+++KL  LGF  Y    FNI+D  I+ +SV+E+        +  G S+LRS RLLRVFKL +    L++ +  M+ ++ ++++ L L+V+FM  AS+LGM LFGGK  F +++G +   R NFDD+  AI+TVFQ++T E WN  MY G++
Sbjct:  368 VSGVSGNSLAESETD--LSDDEDTSESSPRRCAKFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVELF-----GDDDSGISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMR 603          

HSP 3 Score: 92.8189 bits (229), Expect = 1.304e-18
Identity = 67/228 (29.39%), Postives = 120/228 (52.63%), Query Frame = 3
Query: 3630 MSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIAL--NNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKF 4307
            M + +   PQ + D+ +IFNYIF  +F IE+I+K+I   F  Y  D  NIFD  +V+ S V+ +F + +        I++ R FR LR+ KL+    ++R  L   I+  + +   + L+++ ++  +I+GM  FG      N+ G   T+  NF  LF + + + + +T E W+ +M    D  ++  +         +A  YFI  + + NY++ NL +A+++E F
Sbjct:  428 MGIEYYGQPQKMTDVLEIFNYIFTAIFGIEMIMKLIGLGFYGYIKDAFNIFDGTIVIISVVE-LFGDDDSG------ISVLRSFRLLRVFKLVRFLPALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPNDEGVMETSRANFDDLFWAIVTVFQVLTQEDWNIVM---YDGMRATSK---------WAGLYFILLMTIGNYILFNLLVAILVEGF 636          

HSP 4 Score: 90.1225 bits (222), Expect = 9.364e-18
Identity = 53/166 (31.93%), Postives = 94/166 (56.63%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLIL-IFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDI----KALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            + D S + F   NR R+   ++   K F+  +++ I  +C+ ++L    P+     L  ++ +  + + L IF IE ++K+I  G  +   +YLR+ WNV+D  +VV+  V  I++ T  G+  I    +  RA R LRPLR+IS+ P L+IV+ ++I ++KP+ N
Sbjct:  906 RADWSLYVFAPDNRFRMLNKELYQNKWFDRTVLLFILLNCVVMALEG--PSVLPGSLERRVIDICMYVFLGIFTIEMMVKVIALGLWIGPDAYLRSGWNVMDGFLVVISWVDVIVTATTNGQNSILGVLRVFRALRTLRPLRVISRAPGLKIVVETLISSLKPIGN 1069          

HSP 5 Score: 75.485 bits (184), Expect = 2.391e-13
Identity = 33/82 (40.24%), Postives = 58/82 (70.73%), Query Frame = 3
Query:  942 SFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQ 1187
            SFDN+  A + +FQ+IT EGWTDIMY + D +G  W +++F+ L+++GSYF+ NL + ++  QF + K   +R+N+ +++ +
Sbjct:  161 SFDNILIAWVAIFQVITLEGWTDIMYYIQDAHG-FWNFIYFVVLIVIGSYFMTNLCLVVITTQFQETK---QRENDLMRQSR 238          

HSP 6 Score: 60.4622 bits (145), Expect = 9.821e-9
Identity = 57/206 (27.67%), Postives = 112/206 (54.37%), Query Frame = 3
Query: 1413 KAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSL---VITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGG-----KFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWN 2006
            + + ++  +    Y+ + I  ++ +N L MA E+  QP  L+ F   +N  F  +F +E +LK+F+LG K Y    +N  D +I+ +S++ ++L    +   +N     ++R +R+ RV KL K  + ++K+++ + +++  + +L +L +L   I S LG++LFG        I+  G     NF    IA++T+F++ T + WN
Sbjct: 1235 RPRKFIHAVCTHGYFDLGIAAVIALNVLCMALEHYQQPDGLTAFLKCANYVFTAVFILEAILKIFALGIKRYIKDRWNQLDMLIVILSIVGIALEEMTMELPINPTIIRVMRVLRIARVLKLLKTAEGIRKLLDTVAQALPQVGNLGMLFLLMFFIFSALGIELFGKIDCEKPGITCQGMDEHANFRSFGIAMLTLFRISTGDNWN 1440          

HSP 7 Score: 55.8398 bits (133), Expect = 2.425e-7
Identity = 62/252 (24.60%), Postives = 121/252 (48.02%), Query Frame = 3
Query: 2586 KFRIFCHRVINHSLTKKILL-VIIVSSCIM-IAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-VDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYF 3332
            KFR  C   ++      +++  I V++  M I ++   Q  T    +L IF+YIFT  F +E+I+ +I  G  F+   Y+++AFN  D  +V I ++++    D  +S L++ R+LRV K +R +     L+  +  +  TM N+   + + ++F F  S++G+  F G +   +D                         VM      ++ N+D++   ++T+F V T + +  +++  + A  ++ G YF
Sbjct:  399 KFRDGCASSVDSKWFMYVIMGAIFVNTLTMGIEYYGQPQKMTD---VLEIFNYIFTAIFGIEMIMKLIGLG--FY--GYIKDAFNIFDGTIVIISVVELFGDDDSGISVLRSFRLLRVFKLVRFL---PALRRQLLVMIHTMDNVMTFLALLVIFMFTASILGMNLFGGKYRFPND-----------------------EGVME----TSRANFDDLFWAIVTVFQVLTQEDWNIVMYDGMRATSKWAGLYF 613          

HSP 8 Score: 52.7582 bits (125), Expect = 1.889e-6
Identity = 26/79 (32.91%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNS-WPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF 1172
             +FD++ +A++TVFQ++T+E W  +MY  D +   S W  ++FI L+ +G+Y L NL++ IL   F       + +  +
Sbjct:  573 ANFDDLFWAIVTVFQVLTQEDWNIVMY--DGMRATSKWAGLYFILLMTIGNYILFNLLVAILVEGFASAPAGYDSEGNY 649          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Match: EDO35497 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLD1])

HSP 1 Score: 151.369 bits (381), Expect = 3.719e-38
Identity = 152/539 (28.20%), Postives = 274/539 (50.83%), Query Frame = 3
Query: 2586 KFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNP-LQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV---DVEMSALKTLRVLRVIKT---LRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQR-TEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIF--RYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRL---VKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNN--TGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIM 4157
            +FR     V +H     ++LV I+ SC ++A   P +     +  I++I   +FT+ FT+E++I +++ G++   G+YLR+ ++ +D  +V +  +D+I+     V    L TLRV R ++T   LR I +A  LK ++ ++  ++  I   +LI  +F  +F ++GV  FKG FY C   S   ++  C              A      W N ++N+D++L  +++LFVVST  G+ +I+   IDAV     P  N   +   +++ +L++  F ++N+ +G VV ++Q+ RE   + E+   ++K   A       ++   Y P+   R +I  + T   ++  I  II +N I MSL   K PQ+  + +   NY F  +F IEV++K+IA  F  Y  D+ N+ D  +VL S   ++ +     VD      + R  R LR+   +KL+   K +R +L T   A   +P + LL  ++ +IY+ +G+Q FG +  ++         + +F+    + + L R  TG+ W+ I+
Sbjct:    7 RFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQEC--------------ANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCRERMDEEEQARPHRKGKKARNQMQDSLYYESYGPL---RLKIHFICTHRNWDITIAAIICINVICMSLEHYKMPQVFVETT---NYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIV-LELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWNGIL 524          

HSP 2 Score: 87.4261 bits (215), Expect = 2.296e-17
Identity = 54/171 (31.58%), Postives = 95/171 (55.56%), Query Frame = 3
Query:  177 MFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKL-ENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLG----IVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLAN 674
            M PCL        F+   R+R     + + +AF+  I++ I FSC  L++    P+     L  ++ + + L   +IF IE ++K++  G VL   +YLR+ W+VLD  +V++     IVTY   V+ +    ++  RA R LRPLR+I + P L++V+ +++ ++KP+ N
Sbjct:    1 MSPCL--------FRFRQRMR----AVCSHRAFDYVILVFIIFSCAVLAIEA--PDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGN 157          

HSP 3 Score: 68.5514 bits (166), Expect = 1.593e-11
Identity = 96/372 (25.81%), Postives = 172/372 (46.24%), Query Frame = 3
Query:  942 SFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYG---------NSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSV----IEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISED----GSLYRTNFDDMLIAIITVFQLMTIEGWN 2006
            +FD++  A++++F + TK+GW +IM+   D              W  V+FIP ++LG + +LN+I+G++   F + +   ER +E  + + + K              G K  N++                     Q++  YE+                 P +LK       I   R + I I  ++ IN + M+ E+   P V   F + +N FF  +F IE+++K+ +LGF  Y    +N+ D  I+ +SV    +E+ + + ++ N      LR +R+ RV KL K    ++ +++ +  ++  + +L LL  L   I S LG+QLFG    S D    G     +F D   A++T+F++ T + WN
Sbjct:  210 NFDDLLQALISLFVVSTKDGWVEIMHHGIDAVDVDVQPIVNYAEWRLVYFIPFLLLGGFLVLNMIVGVVVENFQRCR---ERMDEEEQARPHRK--------------GKKARNQM---------------------QDSLYYES---------------YGPLRLKIHF----ICTHRNWDITIAAIICINVICMSLEHYKMPQV---FVETTNYFFTSVFVIEVVVKVIALGFVRYPKDRWNLIDLAIVLLSVTGIVLELLVKVDHLFNPTVIRTLRVLRITRVLKLVKLAKGVRSLLDTLFEALPQVPNLGLLFFLLFFIYSCLGIQLFGSLECSHDYPCQGFNRHAHFRDFGTAMLTLFRIATGDNWN 521          

HSP 4 Score: 51.9878 bits (123), Expect = 2.294e-6
Identity = 66/238 (27.73%), Postives = 122/238 (51.26%), Query Frame = 3
Query: 1395 MEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEY--IGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGF----KNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQ--IG-FSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLY------------------RTNFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            M P   + +  +  +   R +  VILV +  +  ++A E   I +  +  Q  D S + F I+FTIE+L+KL ++G       Y    +++ D  ++ VS I++ +  T+ ++   +G   + R++R LR  ++ +    LK +V  ++ S+K I + +L+  +F ++  +LG+QLF GKF   +G  +                  R NFDD+L A+I++F + T +GW   M+ GI
Sbjct:    1 MSPCLFRFRQRMRAVCSHRAFDYVILVFIIFSCAVLAIEAPDIAEQGLKRQIIDISMLVFTIIFTIEMLIKLVAMGLVLGPGTYLRDGWDVLDGFLVMVSWIDIIVTYTSHVSPEVLGTLRVFRALRTLRPLRVIRRAPGLKLVVQTLLYSLKPIGNTVLIAAIFFVMFGILGVQLFKGKFYYCEGDSHVISKQECANSTRGQWVNRRYNFDDLLQALISLFVVSTKDGWVEIMHHGI 238          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: CACNA1D (calcium voltage-gated channel subunit alpha1 D [Source:NCBI gene;Acc:101171831])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 355/771 (46.04%), Postives = 515/771 (66.80%), Query Frame = 3
Query: 2499 PEINKLLEL--KQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQ--EPA-VDGALRINI--FRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDN--KSRCQLSSG---TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P   +L EL  K+K   IP  S+ FIFS +N FR+ CH++INH +   ++LV I+ S + +A  +P++  + +  IL  FDY FT  FT+E+++ M ++G   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ + + CKGTYI Y+   +    +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++IILNT+ +++       L N   DI N +F  +FT+E+ILK+IAF  R Y  D  N+FD +VV+GS VD+I      EP   + + RI+I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W +IM++C+      S    + G   TCG+ FA  YFISF +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +++ NEELR++IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  710 PRPQRLSELTIKEKTPPIPQGSAFFIFSSTNPFRVLCHKLINHQIFTNLILVFIMLSSVSLAAEDPIRNFSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDDAKSSPEECKGTYILYSNGDTALPMIKERIWYNSDFNFDNVLMAMMALFTVSTFEGWPTLLYKAIDSNRENMGPIYNYRIEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYVMFVLIILNTLCLAIQHYGQSHLFNYAMDILNMVFTGVFTVEMILKLIAFKPRGYVGDAWNVFDALVVIGSVVDIILSQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLMLFRCATGEAWQEIMLACLPGKLCDSESDYNPGEERTCGSGFAIIYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LDQANEELRVVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1473          

HSP 2 Score: 368.237 bits (944), Expect = 1.311e-103
Identity = 258/636 (40.57%), Postives = 388/636 (61.01%), Query Frame = 3
Query:  192 KPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGK------------VDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQRMSN-PKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYE-NVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            +P R+ F     N +R     +V  K F+ FI++ IF +C+ L++   +P +DSN  N +LE  E   ++IF IE+ MKII YG V+H  SY+RN WN+LDF+IV++G+ + +L +  +               D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCY   T       P PC    +  G  C                ++N ++    + GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L++  D   Y DWI Q + I     D  + +           + ++N K  +   ++R+  +           K +A       +K+  ++ ++++LVF+N+L +A+E+  QP  L++ QD +N   L LFT+E+L+K++SLG + YF+  FN +D  ++   ++E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQLFGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   20 RPPRALFCLTLNNPIRRACISLVEWKPFDIFILLSIFANCVALAIYIPFPGDDSNSTNQELEKVEYAFLIIFTIETFMKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEMITKDADHGGQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVIQTGALAEEEPAPCAVSGH--GRHC----------------LFNGTICREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE--DLKGYLDWITQAEDI-----DPENDEEG-------DEEGKRNRKFRQWRRWNRLCRR-----------KCRAA------VKSVTFYWLVIILVFLNTLTIASEHYNQPDWLTEVQDVANKVLLALFTLEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIVETILVELAIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLTVFQILTGEDWNTVMYDGIMAYGGPAS 606          

HSP 3 Score: 96.6709 bits (239), Expect = 2.489e-19
Identity = 72/281 (25.62%), Postives = 137/281 (48.75%), Query Frame = 3
Query: 2559 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPL---QPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSA--------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQ----RTEDNCKGTYIYYAYDGSYQAKVMNRTW---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            +LF  + +N  R  C  ++        +L+ I ++C+ +A + P      N+T   +  + +Y F + FT+E  + +I+YG++ H+ SY+RN +N +DF++V +G+  V+L  +   A              +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A   + Q      E+        +     +   +    W   +N   N+DN L  M+T+F   T +G+ D+L+   DA+  +E P+
Sbjct:   24 ALFCLTLNNPIRRACISLVEWKPFDIFILLSIFANCVALAIYIPFPGDDSNSTNQELEKV-EYAFLIIFTIETFMKIIAYGLVMHQNSYVRNGWNMLDFVIVIVGLFSVVLEMITKDADHGGQSGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYVIQTGALAEEEPAPCAVSGHGRHCLFNGTICREGWQGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAM-GFELPW 302          

HSP 4 Score: 87.0409 bits (214), Expect = 2.155e-16
Identity = 75/291 (25.77%), Postives = 132/291 (45.36%), Query Frame = 3
Query:  195 PDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTC---------YNNVTKQRMSNPKPCNPRANSLGYLCDNLPNLPV--GQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            P  S F+ F  TN  R+   K++N + F   I++ I  S   +SL    P  + +  N  L   +     IF +E ++K+  +G  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C         +   T    S+P+ C  +   + Y  +    LP+   ++W     YN+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  728 PQGSAFFIFSSTNPFRVLCHKLINHQIFTNLILVFIMLS--SVSLAAEDPIRNFSARNIILGYFDYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYRCTDDAKSSPEEC--KGTYILY-SNGDTALPMIKERIW-----YNSDFN-------------FDNVLMAMMALFTVSTFEGWPTLLYKAID 979          

HSP 5 Score: 85.1149 bits (209), Expect = 6.727e-16
Identity = 63/219 (28.77%), Postives = 116/219 (52.97%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  + ++ D+ N + + LFT+E+++K+ +   + YF    N FD  VV G  V+ I +  E A+   L I++FR  R LR+ K+     S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C       YFI   I  NY+++N+FLA+ ++
Sbjct:  430 QPDWLTEVQDVANKVLLALFTLEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIVETILV--ELAIMSPLGISVFRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETVTKRSTFDNFPQALLTVFQIL----TGEDWNTVMYDGIMAYGGPASSGMVVC------IYFIILFICGNYILLNVFLAIAVD 636          

HSP 6 Score: 63.929 bits (154), Expect = 1.846e-9
Identity = 93/418 (22.25%), Postives = 180/418 (43.06%), Query Frame = 3
Query:  939 TSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWP-----WVFFIPLVILGSYFLLNLIIGILCGQFT-KEKL-KVERQNEFIKEKQNLKDTDDYLFYK---DWIEQGDKIINELLDESSVKTTFEIQDNLIVD---DEQNNKIYENVFDRILGKLKSTS-----KKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATE-----YIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKP-FNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKF--ISEDGS-----------LYRT------------------NFDDMLIAIITVFQLMTIEGWNREMYKGI 2027
            ++FDN   A+LTVFQI+T E W  +MY     YG          ++FI L I G+Y LLN+ + I        E L   +R+ E  K+++N  +    L  +   + + + DK      +        E  ++++ +     +  ++ E         +   S         P+++        +I  + +  +ILV + ++S+ +A E     +  +  +L  F DY+      +  +  +    +   K  F +  FN+ D +++ VS++   +  + +       ILR +R+LR  +       LK +V  +  +I++I +++++  L   + + +G+QLF GKF   ++D             LY                    NFD++L+A++ +F + T EGW   +YK I
Sbjct:  569 STFDNFPQALLTVFQILTGEDWNTVMYDGIMAYGGPASSGMVVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQREEEEAKKRRNSTNVHPLLTVQLPTETLLEADKEPYAAAESPGDDVDDEDNNDILPEVPTGPRPQRLSELTIKEKTPPIPQGSAFFIFSSTNPFRVLCH----KLINHQIFTNLILVFIMLSSVSLAAEDPIRNFSARNIILGYF-DYAFTAIFTVEILLKMTAFGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISV---VKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDDAKSSPEECKGTYILYSNGDTALPMIKERIWYNSDFNFDNVLMAMMALFTVSTFEGWPTLLYKAI 978          

HSP 7 Score: 54.6842 bits (130), Expect = 1.340e-6
Identity = 45/177 (25.42%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  192 KPDRSCF-YFKKTNRLRIFIGK---------IVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILS--------VTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPL 668
            K  R C  Y  K   LR +I K         +VN+  FE  + + I  + L L++        S+  N  ++   +    +F +E I+K+I +      + Y+ + WNV D ++V+  +V  ILS          D  ++ I   R FRV+R ++L+S+   ++ +L + I + + L
Sbjct: 1037 KNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYVMFVLIILNTLCLAIQHY---GQSHLFNYAMDILNMVFTGVFTVEMILKLIAF----KPRGYVGDAWNVFDALVVIGSVVDIILSQVIVEPGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQAL 1206          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1da (voltage-dependent L-type calcium channel subunit alpha-1D [Source:NCBI gene;Acc:101157531])

HSP 1 Score: 627.861 bits (1618), Expect = 0.000e+0
Identity = 351/773 (45.41%), Postives = 512/773 (66.24%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN---------QEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I+ L++ K+K+  IP  S+ FIFS +N  R+FCH++INH +   ++LV I+ S + +A  +P++  + +  IL  FDY FT  FT+E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ +++ CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++       L N + DI N +F  +FT+E+ LK+IAF  R YF D  N+FD +VV+GS VD++            Q       + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W  IM++C+     D +S   +    TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  803 PVISDLVK-KEKITPIPEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLSSVSLAAEDPIRNLSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSALFNYVMDILNMVFTTVFTVEMFLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDVSNPLSLQNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKLCDPESDYNIGEEMTCGSGFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1567          

HSP 2 Score: 374.4 bits (960), Expect = 1.875e-104
Identity = 266/659 (40.36%), Postives = 391/659 (59.33%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ-----------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKII---NELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN +N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L +  +                       G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCY   +       P PC    +  G  C      P+     C + ++         GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I     +  DE     +    +   V+ E  N   E+      G L    ++    +   +   L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:  112 SKKQGSNANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPCA--ISGHGRQC------PINGT-ECREGWH---------GPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEDEADEGKRNPSVPASETESVNTENQNG--EDEKTPCCGPLCRRWRRWN--RFCRRKCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 745          

HSP 3 Score: 88.9669 bits (219), Expect = 6.048e-17
Identity = 82/301 (27.24%), Postives = 135/301 (44.85%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN-NVTKQRMSNPKPCNPRANSLGYLC--------DNLPNLPVGQ--VWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+F  K++N   F   I++ I  S   +SL    P  + +  N  L   +     IF +E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C    + K +      C   A S   +C        D   N P  Q  VW     +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  810 KKEKITPI--PEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLS--SVSLAAEDPIRNLSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYR---CTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVW-----HNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1069          

HSP 4 Score: 88.5817 bits (218), Expect = 7.157e-17
Identity = 78/298 (26.17%), Postives = 139/298 (46.64%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------VDVEMSA------------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----W---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L         VE                     +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      SD I++     C       A  G  +   +N T     W   +N   N+DN L  M+T+F   T +G+ D+L+   DA+
Sbjct:  119 ANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPC-------AISGHGRQCPINGTECREGWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAM 409          

HSP 5 Score: 84.7297 bits (208), Expect = 1.066e-15
Identity = 62/219 (28.31%), Postives = 114/219 (52.05%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C      FYFI   I  NY+++N+FLA+ ++
Sbjct:  569 QPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSTGMIVC------FYFIILFICGNYILLNVFLAIAVD 775          

HSP 6 Score: 56.225 bits (134), Expect = 4.536e-7
Identity = 62/252 (24.60%), Postives = 122/252 (48.41%), Query Frame = 3
Query: 1323 EQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYF------------IVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMN-----------QIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYR-TNFDDMLIAIITVFQLMTIEGWN 2006
            EQ  K Y+N       +L    ++   Y LKA+     I K  Y +             ++ VL+ +N+L +A ++ GQ  + +   D  NM F  +FT+E+ LKL +   + YF   +N++D +++  S++++ L   +V N           +I  +  R  R++R+ KL    + ++ ++   ++S +++  + LLI +   I +++GMQ+FG   + +   + R  NF     A++ +F+  T E W 
Sbjct: 1114 EQGEKEYKNC------ELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSALFNYVMDILNMVFTTVFTVEMFLKLIAFKPRGYFGDAWNVFDALVVIGSIVDIVLSEIDVSNPLSLQNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQ 1359          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1da (voltage-dependent L-type calcium channel subunit alpha-1D [Source:NCBI gene;Acc:101157531])

HSP 1 Score: 625.165 bits (1611), Expect = 0.000e+0
Identity = 349/765 (45.62%), Postives = 511/765 (66.80%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGA-LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I+ L++ K+K+  IP  S+ FIFS +N  R+FCH++INH +   ++LV I+ S + +A  +P++  + +  +L   DY+FT  FT E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ +++ CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++       L N + DI N +F  +FT+E+ LK+IAF  R+YF D  N FD ++V+GS VD+         D A + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W  IM++C+     D +S   +    TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  786 PVISDLVK-KEKITPIPEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLSSVSLAAEDPIRNLSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSALFNYVMDILNMVFTTVFTVEMFLKLIAFKPRHYFADAWNTFDALIVVGSVVDIAITEVNNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKLCDPESDYNIGEEMTCGSGFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1542          

HSP 2 Score: 373.629 bits (958), Expect = 3.836e-104
Identity = 266/665 (40.00%), Postives = 393/665 (59.10%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ-----------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKII---NELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKL-KSTSKKMEPYKLKAQNYLLN-----IIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN +N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L +  +                       G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCY   +       P PC    +  G  C      P+     C + ++         GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I     +  DE     +    +   V+ E  N   E+      G L +  SK     + +  N          +K+  ++ ++++LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   64 SKKQGSNANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPCAISGH--GRQC------PINGT-ECREGWH---------GPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEDEADEGKRNPSVPASETESVNTENQNG--EDEKTPCCGPLCQKISKSKFSRRWRRWNRFCRRKCRLAVKSVPFYWLVIILVFLNTLTISSEHYNQPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 706          

HSP 3 Score: 88.1965 bits (217), Expect = 8.437e-17
Identity = 80/305 (26.23%), Postives = 143/305 (46.89%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------VDVEMSA------------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----W---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L         VE                     +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      SD I++     C       A  G  +   +N T     W   +N   N+DN L  M+T+F   T +G+ D+L+   DA+  +E P+
Sbjct:   71 ANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPC-------AISGHGRQCPINGTECREGWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAM-GFELPW 367          

HSP 4 Score: 86.6557 bits (213), Expect = 2.695e-16
Identity = 81/301 (26.91%), Postives = 134/301 (44.52%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN-NVTKQRMSNPKPCNPRANSLGYLC--------DNLPNLPVGQ--VWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+F  K++N   F   I++ I  S   +SL    P  + +  N  L   +     +F  E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C    + K +      C   A S   +C        D   N P  Q  VW     +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  793 KKEKITPI--PEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLS--SVSLAAEDPIRNLSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYR---CTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVW-----HNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1052          

HSP 5 Score: 84.3445 bits (207), Expect = 1.379e-15
Identity = 62/219 (28.31%), Postives = 114/219 (52.05%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C      FYFI   I  NY+++N+FLA+ ++
Sbjct:  530 QPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSTGMIVC------FYFIILFICGNYILLNVFLAIAVD 736          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1da (voltage-dependent L-type calcium channel subunit alpha-1D [Source:NCBI gene;Acc:101157531])

HSP 1 Score: 624.78 bits (1610), Expect = 0.000e+0
Identity = 351/774 (45.35%), Postives = 514/774 (66.41%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIF--MNQEPAVDGA--------LRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I+ L++ K+K+  IP  S+ FIFS +N  R+FCH++INH +   ++LV I+ S + +A  +P++  + +  IL  FDY FT  FT+E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ +++ CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++       L N + DI N +F  +FT+E+ LK+IAF  R+YF D  N FD ++V+GS VD+    +N     +G         + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W  IM++C+     D +S   +    TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  739 PVISDLVK-KEKITPIPEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLSSVSLAAEDPIRNLSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSALFNYVMDILNMVFTTVFTVEMFLKLIAFKPRHYFADAWNTFDALIVVGSVVDIAITEVNVSTCKNGGSLQADSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKLCDPESDYNIGEEMTCGSGFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1504          

HSP 2 Score: 374.4 bits (960), Expect = 7.024e-105
Identity = 262/656 (39.94%), Postives = 392/656 (59.76%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ-----------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN +N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L +  +                       G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCY   +       P PC    +  G  C      P+     C + ++         GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y V+D  G   PW++F+ L+ILGS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I  +  DE+              D+       +++  +++  L +  +     +   +   L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   64 SKKQGSNANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPCAISGH--GRQC------PINGT-ECREGWH---------GPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWVNDAIGFETPWIYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEDEA--------------DEGSAAATLQSI--KLINTLAAIRRWRRWNRFCRRKCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 682          

HSP 3 Score: 90.1225 bits (222), Expect = 2.309e-17
Identity = 82/301 (27.24%), Postives = 135/301 (44.85%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN-NVTKQRMSNPKPCNPRANSLGYLC--------DNLPNLPVGQ--VWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+F  K++N   F   I++ I  S   +SL    P  + +  N  L   +     IF +E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C    + K +      C   A S   +C        D   N P  Q  VW     +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  746 KKEKITPI--PEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLS--SVSLAAEDPIRNLSARNIILGYFDYAFTAIFTVEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYR---CTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVW-----HNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1005          

HSP 4 Score: 89.3521 bits (220), Expect = 3.860e-17
Identity = 80/305 (26.23%), Postives = 143/305 (46.89%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAF--ILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------VDVEMSA------------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----W---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPY 3329
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L         VE                     +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      SD I++     C       A  G  +   +N T     W   +N   N+DN L  M+T+F   T +G+ D+L+   DA+  +E P+
Sbjct:   71 ANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPC-------AISGHGRQCPINGTECREGWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWVNDAI-GFETPW 367          

HSP 5 Score: 83.5741 bits (205), Expect = 2.476e-15
Identity = 62/219 (28.31%), Postives = 114/219 (52.05%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C      FYFI   I  NY+++N+FLA+ ++
Sbjct:  506 QPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSTGMIVC------FYFIILFICGNYILLNVFLAIAVD 712          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Match: cacna1da (voltage-dependent L-type calcium channel subunit alpha-1D [Source:NCBI gene;Acc:101157531])

HSP 1 Score: 622.854 bits (1605), Expect = 0.000e+0
Identity = 350/776 (45.10%), Postives = 513/776 (66.11%), Query Frame = 3
Query: 2499 PEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMN----QEPAVD--------GALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVD----DNKSRCQLSSG-TCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFR 4775
            P I+ L++ K+K+  IP  S+ FIFS +N  R+FCH++INH +   ++LV I+ S + +A  +P++  + +  +L   DY+FT  FT E+++ M +YG   HKG++ RN FN +D +VV + ++   +    +S +K LRVLRV++ LR IN+AK LKH++  V + +  I  I+++  L  F+F+ IGV  FKG FY C+D ++ +++ CKGTYI Y      Q  +  R W N+ FN+DNVL  MM LF VSTF+G+  +L+  ID+ RE  GP +N    I  F++IY+II  FF++NIF+GFV++++Q+  E EYK+ ELDKNQ++C+   LK++P+ RY+P + Y+++ W +V S  F   +F++I+LNT+ +++       L N + DI N +F  +FT+E+ LK+IAF  R+YF D  N FD ++V+GS VD+        + P VD          + I  FRLFR +RLVKLL + + IR +LWTFI +F  LP+V LL+ M+ +IYA+IGMQ FGKIA+ + G++I  NNNFQT   + ++L RC TGE W  IM++C+     D +S   +    TCG+ FA  YFI+F +L  +LI+NLF+AVI++ FDYLT+D S LGPHHL+ F   WS YD  A+GRI  LDVV LL +I PPLGFGK+CP     ++L+ MNMPL  DGT+ F ATLFALVR  L+IK   N      +E+ NEELR +IK++W++TS  +L++++P    + VTVGKFYATFLIQD+FR
Sbjct:  755 PVISDLVK-KEKITPIPEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLSSVSLAAEDPIRNLSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVWHNSDFNFDNVLMAMMALFTVSTFEGWPALLYKAIDSNRENFGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWYVVNSTGFEYIMFVLIMLNTLCLAVQHYGQSALFNYVMDILNMVFTTVFTVEMFLKLIAFKPRHYFADAWNTFDALIVVGSVVDIAITEVNPTETPQVDEMGNTEDSARISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQVFGKIAMVD-GTQINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKLCDPESDYNIGEEMTCGSGFAIVYFITFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKIKTEGN------LEQANEELRAVIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFR 1522          

HSP 2 Score: 374.015 bits (959), Expect = 2.648e-104
Identity = 266/659 (40.36%), Postives = 391/659 (59.33%), Query Frame = 3
Query:  162 SKKRNMFPCLKPDRSCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQ-----------------------GKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYNNVTKQ-RMSNPKPCNPRANSLGYLCDNLPNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEKLKVERQNEF--IKEKQNLKDTDDYLFYKDWIEQGDKII---NELLDESSVKTTFEIQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIKTRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMXXXXXXXXXXXXXXXXXGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSVRLLRVFKLTKHWDNLKKMVNNMVRXXXXXXXXXXXXXXXXXXASLLGMQLFGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGAYS 2051
            SKK+      +P R+ F     N +R     +V  K F+ FI+I IF +C+ L++   +P +DSN +N  LE  E   ++IF IE+ +KII YG V+H  +Y+RN WN+LDF+IVV+G+ + +L +  +                       G  D+KALRAFRVLRPLRL+S +PSLQ+VLNSII A+ PL +I LLVLF+III++I+G+ LF G  H TCY   +       P PC    +  G  C      P+     C + ++         GPN GIT+FDN  FAMLTVFQ IT EGWTD++Y ++D  G   PWV+F+ LVI GS+F+LNL++G+L G+F+KE+ K + + +F  ++EKQ L+  +D   Y DWI Q + I     +  DE     +    +   V+ E  N   E+      G L    ++    +   +   L +    +Y++VI +LVF+N+L +++E+  QP  L+Q QD +N   L LFT E+L+K++SLG + YF+  FN +D  ++   + E  LV   +M+ +G S+ R VRLLR+FK+T+HW +L  +V +++ S+KSI SLLLL+ LF+II SLLGMQ+FGGKF  ++    R+ FD+   A++TVFQ++T E WN  MY GI   GG  S
Sbjct:   64 SKKQGSNANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPCAISGH--GRQC------PINGT-ECREGWH---------GPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLE--EDLKGYLDWITQAEDIDPDNEDEADEGKRNPSVPASETESVNTENQNG--EDEKTPCCGPLCRRWRRWN--RFCRRKCRLAVKSVPFYWLVI-ILVFLNTLTISSEHYNQPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGGPSS 697          

HSP 3 Score: 88.1965 bits (217), Expect = 8.131e-17
Identity = 78/298 (26.17%), Postives = 139/298 (46.64%), Query Frame = 3
Query: 2538 ANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQA--FILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVIL-------VDVEMSA------------------LKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYAC-----SD-ISQRTEDNCKGTYIYYAYDGSYQAKVMNRT-----W---SNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAV 3308
            AN     +LF  + +N  R  C  ++        +L+ I ++C+ +A + P   + + +    L   +Y F + FT+E  + +I+YG++ H+ +Y+RN +N +DF++V IG+  V+L         VE                     +K LR  RV++ LR ++    L+ ++NS+   M  +  I L+ L    I+++IG+  F G  +A      SD I++     C       A  G  +   +N T     W   +N   N+DN L  M+T+F   T +G+ D+L+   DA+
Sbjct:   71 ANSRPQRALFCLNLNNPIRRACISLVEWKPFDIFILIAIFANCMALAVYIPFPEDDSNSINHDLETVEYAFLIIFTIETFLKIIAYGLVMHQNAYVRNGWNMLDFVIVVIGLFSVVLELLTKEEPKVEGDGANNHPSMHGHGGKPGGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHATCYMPGSDLIAEEEPAPC-------AISGHGRQCPINGTECREGWHGPNNGITNFDNFLFAMLTVFQCITMEGWTDVLYWMNDAM 361          

HSP 4 Score: 86.6557 bits (213), Expect = 2.779e-16
Identity = 81/301 (26.91%), Postives = 134/301 (44.52%), Query Frame = 3
Query:  165 KKRNMFPCLKPDRSCFY-FKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANXXXXXXXXXXXXXXXXXXXXXXXXHFTCYN-NVTKQRMSNPKPCNPRANSLGYLC--------DNLPNLPVGQ--VWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITKEGWTDIMYMVDD 1031
            KK  + P   P+ S F+ F  TN +R+F  K++N   F   I++ I  S   +SL    P  + +  N  L   +     +F  E ++K+  YG  LH  ++ RN++N+LD ++V + +V++   +       +K LR  RVLRPLR I++   L+ V+  + +AI+ + NI+++   L  +              F C    + K +      C   A S   +C        D   N P  Q  VW     +N+  N             FDN+  AM+ +F + T EGW  ++Y   D
Sbjct:  762 KKEKITPI--PEGSAFFIFSNTNPVRVFCHKLINHHIFTNLILVFIMLS--SVSLAAEDPIRNLSARNIVLGYADYVFTSMFTFEIVLKMTTYGAFLHKGAFCRNYFNLLDLLVVGVSLVSF--GIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFM--------------FACIGVQLFKGKFYR---CTDEAKSSQEVCKGTYIVYKDGDVNQPTMQRRVW-----HNSDFN-------------FDNVLMAMMALFTVSTFEGWPALLYKAID 1021          

HSP 5 Score: 84.3445 bits (207), Expect = 1.264e-15
Identity = 62/219 (28.31%), Postives = 114/219 (52.05%), Query Frame = 3
Query: 3651 NPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFG-KIALNNTGSEITTNNNF-QTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIE 4301
             P  +  + D+ N + + LFT E+++K+ +   + YF    N FD  VV G   + I +  E  +   L I++FR  R LR+ K+    +S+  ++ + +N+  ++  ++LL+ + + I++++GMQ FG K   + T ++ +T +NF Q L   F +L    TGE W+ +M   +             C      FYFI   I  NY+++N+FLA+ ++
Sbjct:  521 QPLWLTQVQDVANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGITETILVELE--IMSPLGISVFRCVRLLRIFKVTRHWQSLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQVFGGKFNFDETQTKRSTFDNFPQALLTVFQIL----TGEDWNAVMYDGIMAYGGPSSTGMIVC------FYFIILFICGNYILLNVFLAIAVD 727          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000016040.1 (SMESG000016040.1)

HSP 1 Score: 1387.09 bits (3589), Expect = 0.000e+0
Identity = 793/873 (90.84%), Postives = 800/873 (91.64%), Query Frame = 3
Query: 2253 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRXXXXXXXXXXXXXXXXXXXTQEDDEVINISSM 4871
            MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLR  +     R  N  + L+   +                             QFKGSFYACSDISQRTEDNCKGTYIYYAYD +                            ++STFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM
Sbjct:    1 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRT-QTFDKFRRHNYGQYLEDYTH-----------------------------QFKGSFYACSDISQRTEDNCKGTYIYYAYDVT----------------------------IISTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM 815          

HSP 2 Score: 60.8474 bits (146), Expect = 9.855e-9
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSL-TKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFR 584
            S F F ++N+ RIF  +++N    +  +++ I  SC+ ++    + PN     +   L   +    + F +E I+ +I YG + H  SYLRN +N +DFI+V +GI+  IL       V++ AL+  R
Sbjct:  103 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV-----DVEMSALKTLR 222          

HSP 3 Score: 52.373 bits (124), Expect = 4.517e-6
Identity = 22/22 (100.00%), Postives = 22/22 (100.00%), Query Frame = 2
Query: 2966 TQTFDKFRRHNYGQYLEDYTHQ 3031
            TQTFDKFRRHNYGQYLEDYTHQ
Sbjct:  223 TQTFDKFRRHNYGQYLEDYTHQ 244          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000016040.1 (SMESG000016040.1)

HSP 1 Score: 1387.09 bits (3589), Expect = 0.000e+0
Identity = 793/873 (90.84%), Postives = 800/873 (91.64%), Query Frame = 3
Query: 2253 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRXXXXXXXXXXXXXXXXXXXTQEDDEVINISSM 4871
            MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLR  +     R  N  + L+   +                             QFKGSFYACSDISQRTEDNCKGTYIYYAYD +                            ++STFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM
Sbjct:    1 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRT-QTFDKFRRHNYGQYLEDYTH-----------------------------QFKGSFYACSDISQRTEDNCKGTYIYYAYDVT----------------------------IISTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM 815          

HSP 2 Score: 60.8474 bits (146), Expect = 1.029e-8
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSL-TKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFR 584
            S F F ++N+ RIF  +++N    +  +++ I  SC+ ++    + PN     +   L   +    + F +E I+ +I YG + H  SYLRN +N +DFI+V +GI+  IL       V++ AL+  R
Sbjct:  103 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV-----DVEMSALKTLR 222          

HSP 3 Score: 52.373 bits (124), Expect = 4.482e-6
Identity = 22/22 (100.00%), Postives = 22/22 (100.00%), Query Frame = 2
Query: 2966 TQTFDKFRRHNYGQYLEDYTHQ 3031
            TQTFDKFRRHNYGQYLEDYTHQ
Sbjct:  223 TQTFDKFRRHNYGQYLEDYTHQ 244          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000016040.1 (SMESG000016040.1)

HSP 1 Score: 1373.99 bits (3555), Expect = 0.000e+0
Identity = 786/866 (90.76%), Postives = 793/866 (91.57%), Query Frame = 3
Query: 2274 MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRXXXXXXXXXXXXXXXXXXXTQEDDEVINISSM 4871
            MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLR  +     R  N  + L+   +                             QFKGSFYACSDISQRTEDNCKGTYIYYAYD +                            ++STFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM
Sbjct:    1 MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRT-QTFDKFRRHNYGQYLEDYTH-----------------------------QFKGSFYACSDISQRTEDNCKGTYIYYAYDVT----------------------------IISTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM 808          

HSP 2 Score: 60.8474 bits (146), Expect = 9.502e-9
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSL-TKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFR 584
            S F F ++N+ RIF  +++N    +  +++ I  SC+ ++    + PN     +   L   +    + F +E I+ +I YG + H  SYLRN +N +DFI+V +GI+  IL       V++ AL+  R
Sbjct:   96 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV-----DVEMSALKTLR 215          

HSP 3 Score: 52.373 bits (124), Expect = 4.585e-6
Identity = 22/22 (100.00%), Postives = 22/22 (100.00%), Query Frame = 2
Query: 2966 TQTFDKFRRHNYGQYLEDYTHQ 3031
            TQTFDKFRRHNYGQYLEDYTHQ
Sbjct:  216 TQTFDKFRRHNYGQYLEDYTHQ 237          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000016040.1 (SMESG000016040.1)

HSP 1 Score: 1373.61 bits (3554), Expect = 0.000e+0
Identity = 786/866 (90.76%), Postives = 793/866 (91.57%), Query Frame = 3
Query: 2274 MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRXXXXXXXXXXXXXXXXXXXTQEDDEVINISSM 4871
            MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLR  +     R  N  + L+   +                             QFKGSFYACSDISQRTEDNCKGTYIYYAYD +                            ++STFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM
Sbjct:    1 MPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRT-QTFDKFRRHNYGQYLEDYTH-----------------------------QFKGSFYACSDISQRTEDNCKGTYIYYAYDVT----------------------------IISTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM 808          

HSP 2 Score: 60.8474 bits (146), Expect = 9.573e-9
Identity = 39/128 (30.47%), Postives = 68/128 (53.12%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSL-TKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFR 584
            S F F ++N+ RIF  +++N    +  +++ I  SC+ ++    + PN     +   L   +    + F +E I+ +I YG + H  SYLRN +N +DFI+V +GI+  IL       V++ AL+  R
Sbjct:   96 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV-----DVEMSALKTLR 215          

HSP 3 Score: 52.373 bits (124), Expect = 4.581e-6
Identity = 22/22 (100.00%), Postives = 22/22 (100.00%), Query Frame = 2
Query: 2966 TQTFDKFRRHNYGQYLEDYTHQ 3031
            TQTFDKFRRHNYGQYLEDYTHQ
Sbjct:  216 TQTFDKFRRHNYGQYLEDYTHQ 237          
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Match: SMESG000016040.1 (SMESG000016040.1)

HSP 1 Score: 1371.68 bits (3549), Expect = 0.000e+0
Identity = 786/873 (90.03%), Postives = 794/873 (90.95%), Query Frame = 3
Query: 2253 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVXXXXXXXXXXXXXXXFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLRTINKAKELKHLINSVAITMGNXXXXXXXXXXXXXXXSVIGVIQFKGSFYACSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMTLFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRXXXXXXXXXXXXXXXXXXNIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKXXXXXXXXXXXXXXXMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWXXXXXXXXXXXXXXXGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRXXXXXXXXXXXXXXXXXXXTQEDDEVINISSM 4871
            MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVE+   +T          R  N  + L+   +                             QFKGSFYACSDISQRTEDNCKGTYIYYAYD +                            ++STFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM
Sbjct:    1 MINDLPIMPPNVPNDIESLNPVLKKNRGNVNFEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKITPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEIKGTQTF------DKFRRHNYGQYLEDYTH-----------------------------QFKGSFYACSDISQRTEDNCKGTYIYYAYDVT----------------------------IISTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFLINIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDRYRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYIFICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAVDGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLMILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKWHKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVIIEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKINPPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLPLNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFYATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSM 810          

HSP 2 Score: 60.8474 bits (146), Expect = 1.215e-8
Identity = 40/131 (30.53%), Postives = 68/131 (51.91%), Query Frame = 3
Query:  204 SCFYFKKTNRLRIFIGKIVNTKAFEAFIMICIFFSCLGLSL-TKMYPNNDSNDLNDKLENTELPLILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTDQGKVDIKALRAFRVLR 593
            S F F ++N+ RIF  +++N    +  +++ I  SC+ ++    + PN     +   L   +    + F +E I+ +I YG + H  SYLRN +N +DFI+V +GI+  IL       V+IK  + F   R
Sbjct:  103 SLFIFSQSNKFRIFCHRVINHSLTKKILLVIIVSSCIMIAFFNPLQPNTTQAFI---LNIFDYIFTVFFTLELIINMISYGVIFHKGSYLRNAFNWIDFIVVFIGILDVILV-----DVEIKGTQTFDKFR 225          

HSP 3 Score: 56.9954 bits (136), Expect = 1.669e-7
Identity = 24/26 (92.31%), Postives = 25/26 (96.15%), Query Frame = 2
Query: 2954 QSKGTQTFDKFRRHNYGQYLEDYTHQ 3031
            + KGTQTFDKFRRHNYGQYLEDYTHQ
Sbjct:  214 EIKGTQTFDKFRRHNYGQYLEDYTHQ 239          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1C8.953e-10746.18calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1C8.953e-10746.18calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1S1.192e-10945.09calcium voltage-gated channel subunit alpha1 S [So... [more]
CACNA1C6.607e-10745.92calcium voltage-gated channel subunit alpha1 C [So... [more]
CACNA1C6.607e-10745.92calcium voltage-gated channel subunit alpha1 C [So... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-194.987e-10948.28Voltage-dependent L-type calcium channel subunit a... [more]
egl-192.849e-10948.28Voltage-dependent L-type calcium channel subunit a... [more]
unc-26.803e-14038.50High voltage activated calcium channel alpha-1 sub... [more]
unc-23.599e-13838.42High voltage activated calcium channel alpha-1 sub... [more]
unc-23.960e-13838.42High voltage activated calcium channel alpha-1 sub... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ca-alpha1D2.279e-11545.63gene:FBgn0001991 transcript:FBtr0332021[more]
Ca-alpha1D6.112e-11545.63gene:FBgn0001991 transcript:FBtr0090003[more]
Ca-alpha1D1.357e-11545.63gene:FBgn0001991 transcript:FBtr0332022[more]
Ca-alpha1D2.923e-11545.35gene:FBgn0001991 transcript:FBtr0332024[more]
Ca-alpha1D1.081e-11445.63gene:FBgn0001991 transcript:FBtr0090006[more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1da3.331e-10445.62calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da3.681e-10644.85calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1sa1.107e-11245.61calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.728e-10445.17calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c1.486e-10443.73calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frrs1l2.595e-7245.45ferric-chelate reductase 1-like [Source:Xenbase;Ac... [more]
frrs1l6.778e-11146.18ferric-chelate reductase 1-like [Source:Xenbase;Ac... [more]
CACNA1C2.440e-5946.06calcium channel, voltage-dependent, L type, alpha ... [more]
frrs1l1.194e-11046.18ferric-chelate reductase 1-like [Source:Xenbase;Ac... [more]
frrs1l1.369e-11046.18ferric-chelate reductase 1-like [Source:Xenbase;Ac... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cacna1s3.254e-1741.96calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s6.127e-10945.74calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s7.648e-10944.77calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1s6.757e-10944.77calcium channel, voltage-dependent, L type, alpha ... [more]
Cacna1c5.553e-10646.18calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22316|CAC1S_CYPCA2.660e-2239.43Dihydropyridine-sensitive L-type skeletal muscle c... [more]
sp|Q25452|CAC1M_MUSDO8.377e-11945.56Muscle calcium channel subunit alpha-1 OS=Musca do... [more]
sp|Q02789|CAC1S_MOUSE3.528e-10844.77Voltage-dependent L-type calcium channel subunit a... [more]
sp|Q24270|CAC1D_DROME1.084e-11345.63Voltage-dependent calcium channel type D subunit a... [more]
sp|Q02485|CAC1S_RAT2.971e-10945.38Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G0YP310.000e+047.99Voltage-dependent L-type calcium channel subunit a... [more]
A0A0V1ME060.000e+043.00Voltage-dependent L-type calcium channel subunit a... [more]
A0A182J4Y31.971e-1443.16Voltage-dependent L-type calcium channel subunit a... [more]
A0A0V1A8340.000e+042.86Voltage-dependent L-type calcium channel subunit a... [more]
A0A0V1MD940.000e+042.67Voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cacna1da1.328e-10245.49calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da2.057e-10145.36calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da3.894e-10045.10calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1c3.106e-9544.89calcium channel, voltage-dependent, L type, alpha ... [more]
cacna1da3.837e-10244.59calcium channel, voltage-dependent, L type, alpha ... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005302.12.824e-8549.50pep scaffold:Pmarinus_7.0:GL483978:134:5921:-1 gen... [more]
ENSPMAT00000010500.11.389e-6043.77pep scaffold:Pmarinus_7.0:GL477503:21958:35427:1 g... [more]
ENSPMAT00000003634.13.298e-4550.27pep scaffold:Pmarinus_7.0:GL483626:1829:10505:1 ge... [more]
ENSPMAT00000007697.11.462e-3236.68pep scaffold:Pmarinus_7.0:GL478030:18311:55165:1 g... [more]
ENSPMAT00000007700.13.271e-3246.08pep scaffold:Pmarinus_7.0:GL478030:35286:55231:1 g... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CCH13.030e-2522.82Voltage-gated high-affinity calcium channel; invol... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469911.408e-12047.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467974.607e-4326.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356619.550e-4027.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368441.021e-3927.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354973.719e-3828.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CACNA1D1.311e-10346.04calcium voltage-gated channel subunit alpha1 D [So... [more]
cacna1da1.875e-10445.41voltage-dependent L-type calcium channel subunit a... [more]
cacna1da3.836e-10445.62voltage-dependent L-type calcium channel subunit a... [more]
cacna1da7.024e-10545.35voltage-dependent L-type calcium channel subunit a... [more]
cacna1da2.648e-10445.10voltage-dependent L-type calcium channel subunit a... [more]
back to top
BLAST of Voltage-dependent L-type calcium channel subunit alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016040.19.855e-990.84SMESG000016040.1[more]
SMESG000016040.11.029e-890.84SMESG000016040.1[more]
SMESG000016040.19.502e-990.76SMESG000016040.1[more]
SMESG000016040.19.573e-990.76SMESG000016040.1[more]
SMESG000016040.11.215e-890.03SMESG000016040.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033439 ID=SMED30033439|Name=Voltage-dependent L-type calcium channel subunit alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=5891bp
TATAATAACTATTTTTACTCTAAATTTATATTTTTAAAATTTATATTTCA
TTAAAAATTCGAAATAAATTTTCAAGTGACAAAACTAATTTCCAGATGTC
GTCGAATCAGAAATATTACATAAATACGTTTCTTAATTATGATATCAATG
ATAAATTTTCAAGCAAGAAACGAAACATGTTTCCCTGTTTAAAACCTGAC
AGATCTTGTTTCTATTTCAAAAAAACGAATCGGTTGCGAATATTTATTGG
CAAAATTGTTAATACAAAAGCATTTGAGGCCTTTATTATGATTTGCATAT
TTTTCAGTTGTCTGGGGTTATCATTGACTAAAATGTATCCCAATAACGAT
TCAAATGATCTCAATGATAAATTGGAAAATACTGAATTGCCTTTAATTCT
AATTTTTGCCATTGAATCCATTATGAAAATAATTCTCTACGGATTCGTTC
TTCACGCTAAATCTTATCTGAGAAACTTTTGGAATGTTTTAGATTTTATA
ATTGTCGTTTTAGGAATTGTGACTTATATATTATCTGTGACTGATCAAGG
AAAAGTTGATATAAAAGCTTTAAGGGCATTTAGGGTTTTGAGGCCCCTTA
GACTAATATCAAAAATGCCAAGCTTACAGATTGTACTCAATTCAATCATA
ATTGCAATTAAGCCATTGGCTAACATTCTCTTGCTCGTTCTCTTTCTTAT
CATCATATTTTCCATTGTGGGAATCAGCCTCTTTTCTGGGATTTTCCATT
TCACGTGTTACAACAATGTCACCAAACAAAGAATGTCGAATCCCAAACCT
TGCAATCCACGTGCCAACAGTCTAGGATACTTGTGTGACAATCTACCAAA
TTTACCAGTTGGTCAAGTATGGAGTTGTCTTGACATGTATAATAATTCCT
TAAATGTTTTACGATTCCCTGGACCGAATATAGGAATAACGAGTTTTGAC
AACATGGGATTTGCGATGTTGACAGTTTTTCAAATAATTACGAAAGAAGG
ATGGACAGACATTATGTACATGGTCGATGATGTTTATGGGAATTCATGGC
CATGGGTGTTCTTTATTCCATTAGTTATTCTTGGATCTTATTTTCTTCTG
AATCTTATTATAGGCATTTTATGCGGACAATTTACTAAAGAAAAATTGAA
AGTTGAACGTCAAAATGAATTCATCAAGGAGAAACAAAATTTAAAAGATA
CAGATGATTATTTATTTTACAAAGATTGGATTGAACAAGGAGATAAAATT
ATTAACGAACTTTTGGACGAATCATCCGTTAAAACTACTTTTGAAATTCA
GGATAATCTTATTGTTGACGATGAGCAGAATAATAAAATATACGAAAATG
TATTTGATAGAATTTTGGGAAAATTAAAATCTACTTCCAAAAAAATGGAG
CCATATAAATTGAAAGCCCAAAATTATCTTCTTAACATTATCAAAACCAG
ATATTATTTCATAGTTATTTTGGTATTAGTGTTTATTAATTCTCTTATAA
TGGCGACAGAATATATTGGACAGCCTTATGTGTTGTCCCAATTTCAAGAT
TATTCCAATATGTTCTTTTTAATTCTTTTTACAATTGAGTTGCTATTAAA
GCTTTTTAGCTTGGGCTTCAAAAACTATTTTATAAAACCTTTCAATATTT
ATGATTTTATAATAATAACTGTAAGTGTTATTGAGATGTCTCTTGTAATA
ACAAATGTTATGAATCAAATTGGTTTTTCTATACTGAGAAGTGTTAGACT
ATTGAGGGTATTCAAATTGACAAAACATTGGGATAACCTGAAAAAGATGG
TTAATAATATGGTCCGTTCAATAAAGTCTATTCTCAGCTTGCTGCTTTTG
ATAGTATTATTCATGATTATAGCATCTTTGTTGGGCATGCAGTTATTTGG
GGGTAAATTTATTTCCGAAGACGGTTCATTATACCGGACGAATTTTGATG
ATATGTTAATCGCAATCATTACAGTATTTCAGCTTATGACAATTGAAGGA
TGGAATAGAGAAATGTATAAAGGTATTCAATTTCTTGGAGGAGCATACAG
TTTAGGATCCTTAGTATCTATATATTATATAGTAGTTATAGTAGTTGGTA
ATTATCTTCTATTGAATGTATTCTTTGCCATTGTTTTGGAAATTCTCAAT
AGCAAGAATGATGAGGAACCTAAGAAAATTAAAGACACTGATTCTGATTT
TGATGATGATCAAGATTCCGAACTCGAAGTTCCTGTGACAAAAGAATTAG
TGATGATAAATGACTTACCAATAATGCCACCTAATGTGCCAAACGATATT
GAATCACTCAATCCAGTTCTAAAGAAAAATAGGGGTAATGTGAATTTTGA
ACAGCGAGTACGAATTACTTTCAAAGAAGCAGAAGTTACTTCAAAGACTC
CAGAGCCTCTTTACCATAAGGTGGCATACAAAGAGATATATGCCGAAGAA
GAGGAGGATGCAATTATATTTAATATCGATGAAAAACTAAAAATAACACC
AGAAATAAATAAGTTGTTAGAATTAAAACAAAAATTAGCAAATATTCCAA
TCGCATCATCTTTGTTTATATTTTCACAAAGCAATAAATTTCGAATATTT
TGCCATAGAGTTATCAATCATTCATTAACTAAAAAAATTCTCCTTGTAAT
TATTGTTTCCAGTTGTATTATGATTGCGTTTTTCAATCCACTCCAACCGA
ATACCACGCAGGCCTTTATTCTGAATATTTTTGATTACATTTTCACAGTC
TTTTTCACACTTGAATTGATTATTAATATGATTTCGTATGGCGTAATTTT
TCATAAAGGTTCTTATTTAAGAAATGCGTTCAACTGGATCGATTTTATAG
TGGTGTTTATTGGAATTCTGGATGTGATTTTAGTTGATGTTGAAATGTCA
GCTCTAAAAACTCTCCGTGTTTTAAGAGTTATTAAAACTTTAAGAACCAT
TAACAAAGCAAAGGAACTCAAACATTTGATAAATTCCGTCGCCATAACTA
TGGGCAATATTTGGAAGATTATACTCATCAAGTTATTGTTTGGTTTCATT
TTTTCAGTTATAGGGGTCATTCAGTTCAAGGGCTCATTTTATGCATGTTC
TGATATCAGTCAAAGAACTGAAGACAACTGCAAAGGGACATATATATATT
ATGCTTATGATGGTTCCTATCAAGCTAAAGTTATGAATCGAACTTGGAGT
AACAATCAGTTTAATTACGATAATGTTTTAAATGGGATGATGACGTTATT
TGTAGTCTCAACGTTTCAAGGCTATGGCGACATATTATTCACTAATATCG
ATGCCGTTAGGGAATATGAAGGACCGTATTTCAATAATAATAGATATATA
TTTTTCTTTTATTTGATATATTTGATCATTGACAAATTCTTCTTGATAAA
TATATTCATTGGATTTGTCGTCATTTCGTATCAACAAGCACGCGAGTCGG
AATACAAAAGTGAGGAATTGGATAAAAATCAAAAAAAATGTATTGCGTTA
ATACTGAAGTCGAAACCGATTTTCAGGTATGTCCCAATGGACCGTTACCG
GTTTCGGATTTGGCAATTGGTGACCTCGGAAAAGTTTAACAACTTTATTT
TCCTAATAATTATTCTTAATACAATAACAATGTCACTTGGGTTTGACAAA
AATCCCCAATTAATCAATGATATCAGTGATATTTTCAATTATATTTTCAT
TTGTCTTTTCACAATAGAAGTCATTTTGAAAATTATTGCTTTCAATTTTA
GAAATTATTTTGATGACAAAATGAATATATTCGATTTTATTGTTGTTTTG
GGAAGTTTTGTCGATGTCATTTTTATGAATCAAGAACCGGCAGTAGATGG
TGCTCTTCGTATTAATATATTTCGTTTATTTCGATCTTTGAGATTAGTGA
AATTATTGATGAAAAACAAATCCATTCGAGGAATTCTCTGGACTTTTATT
AATGCTTTTAATACCTTACCCTGGGTGATATTGTTGGTTTTAATGATTTT
ATATATTTATGCAATAATTGGAATGCAATTTTTCGGAAAAATCGCTTTAA
ACAATACCGGCAGTGAAATCACGACAAACAATAACTTTCAAACTTTGTTT
AATTCGTTTATTGTTCTTTTGAGATGTATAACTGGTGAAAAATGGCATAA
AATTATGATCAGCTGTGTAGATGATAATAAATCTAGGTGTCAACTTTCTT
CTGGCACCTGTGGAACACCATTTGCATATTTCTATTTCATTTCTTTTATC
ATTTTATCCAATTATTTGATTATGAACCTATTTTTAGCAGTTATCATCGA
AAAATTTGATTATCTTACTAAAGATAGCTCAAATTTAGGTCCACATCATC
TGGAAACCTTTATTGAGCAGTGGTCCTATTATGATATCGGTGCTAGAGGG
AGAATTACTCCTTTAGATGTTGTAGACTTGTTAACAAAGATCAATCCACC
CTTAGGTTTTGGAAAAATGTGTCCCCAAGATAAATGTCTCAGGAAATTAA
TGCACATGAATATGCCGTTGGAGAAAGATGGTACAATTTGCTTTCGCGCC
ACTTTATTCGCGCTCGTTAGAAGAAATCTGAGAATTAAACTTCCTTTGAA
TTCCAAAGACCTCAAATCAATTGAGGAATACAATGAAGAATTGCGATTAA
TTATCAAACGGTTGTGGCGTAAAACTAGTGATGCTGTGCTGGAGGAAATT
ATTCCTTCGAATGTTATGAATACTGTGACTGTCGGAAAATTCTATGCCAC
TTTTTTAATTCAAGACTTCTTTAGAAAATACAAACTTCTTAAAAAAGAAA
AAGAAGAAAAGATAAAGATTGAGTCTTTGATTACGCAAGAGGATGATGAA
GTTATCAATATATCTTCCATGGTTTTTCACAAAAATGACGGCATAGATGG
CATACAAGCAAAAGGAGAAGAAGCTATTGCTGCAGTTAAAAACACTTATA
ACGGATTGATTGACACAATTTGGCAAAATTTGAAGAGCATTTTTATAATG
CCCGATGAGGAATTTTTTGAAAAATAATTTAAGTTTATATTCTGAACGTG
ATTTTAAAACCATAAATTTCTTTGTACTATATAATTTGTTTAGGTCACCT
ATAAATACTCGACTATTCCCATAGTCGCGATTTCATGGAGTTCACTGATC
AGTTTGTGGGAAACTCATATTTTATTTTTTTATAAAAACATTTAAGGTAC
AAATATTCGCTGCTTTTCAGTCGACATCTTCTTGGGCTATGAACAAGTGG
TGCAAATGACAAATCTCGTTCTATTTCGGTTGAAGTTGGCCTAATAGTTA
ATATGTGCTAGAAGAAGTGGACAATAGTTTTCTCGATCATTTCTATGTCA
GACCGAGTACTTAATGAACCACGTATTTTGAAAAGACTCAGATAAATTTC
CATTCAAAATTCATGTAACATAAGAATGTATTATTCTGTGTAACCGCAAA
ATTAAGAGCTCCCACATTAAAATTGCGTACAGAAACTTGTCGTTTACATT
TACAGTATATACAAAATACACACAGACGCGTAAGAAAATATAAGAAATTC
AAGATTCAACAATCATTATAACTTTAACAATTCTATTAAAAAGCAACATA
AGTGCAAAACATTTATTCCATGACAAATATTCAACACGCTCTTTTATATC
TCTTCGTTGCGTAATGTGTACAAGAGGATTTATTGTTTTTCTAATTATTG
ATACAAAGAAACCAACATCCAAACACAAACGTCATAACTAACCTCTGATC
TTCAAACTAAAATTTGGACATTATTACTCAATAAGTAAATTAGATTAATT
ATAAAATGTTCTTTAATTATCCTTCCTTATAAATACAATGTGACAAAAAT
AGCGTATTTGTGGTTGGTTCGTTACGTTCTCGGTCTGACGG
back to top

protein sequence of SMED30033439-orf-1

>SMED30033439-orf-1 ID=SMED30033439-orf-1|Name=SMED30033439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1644bp
MSSNQKYYINTFLNYDINDKFSSKKRNMFPCLKPDRSCFYFKKTNRLRIF
IGKIVNTKAFEAFIMICIFFSCLGLSLTKMYPNNDSNDLNDKLENTELPL
ILIFAIESIMKIILYGFVLHAKSYLRNFWNVLDFIIVVLGIVTYILSVTD
QGKVDIKALRAFRVLRPLRLISKMPSLQIVLNSIIIAIKPLANILLLVLF
LIIIFSIVGISLFSGIFHFTCYNNVTKQRMSNPKPCNPRANSLGYLCDNL
PNLPVGQVWSCLDMYNNSLNVLRFPGPNIGITSFDNMGFAMLTVFQIITK
EGWTDIMYMVDDVYGNSWPWVFFIPLVILGSYFLLNLIIGILCGQFTKEK
LKVERQNEFIKEKQNLKDTDDYLFYKDWIEQGDKIINELLDESSVKTTFE
IQDNLIVDDEQNNKIYENVFDRILGKLKSTSKKMEPYKLKAQNYLLNIIK
TRYYFIVILVLVFINSLIMATEYIGQPYVLSQFQDYSNMFFLILFTIELL
LKLFSLGFKNYFIKPFNIYDFIIITVSVIEMSLVITNVMNQIGFSILRSV
RLLRVFKLTKHWDNLKKMVNNMVRSIKSILSLLLLIVLFMIIASLLGMQL
FGGKFISEDGSLYRTNFDDMLIAIITVFQLMTIEGWNREMYKGIQFLGGA
YSLGSLVSIYYIVVIVVGNYLLLNVFFAIVLEILNSKNDEEPKKIKDTDS
DFDDDQDSELEVPVTKELVMINDLPIMPPNVPNDIESLNPVLKKNRGNVN
FEQRVRITFKEAEVTSKTPEPLYHKVAYKEIYAEEEEDAIIFNIDEKLKI
TPEINKLLELKQKLANIPIASSLFIFSQSNKFRIFCHRVINHSLTKKILL
VIIVSSCIMIAFFNPLQPNTTQAFILNIFDYIFTVFFTLELIINMISYGV
IFHKGSYLRNAFNWIDFIVVFIGILDVILVDVEMSALKTLRVLRVIKTLR
TINKAKELKHLINSVAITMGNIWKIILIKLLFGFIFSVIGVIQFKGSFYA
CSDISQRTEDNCKGTYIYYAYDGSYQAKVMNRTWSNNQFNYDNVLNGMMT
LFVVSTFQGYGDILFTNIDAVREYEGPYFNNNRYIFFFYLIYLIIDKFFL
INIFIGFVVISYQQARESEYKSEELDKNQKKCIALILKSKPIFRYVPMDR
YRFRIWQLVTSEKFNNFIFLIIILNTITMSLGFDKNPQLINDISDIFNYI
FICLFTIEVILKIIAFNFRNYFDDKMNIFDFIVVLGSFVDVIFMNQEPAV
DGALRINIFRLFRSLRLVKLLMKNKSIRGILWTFINAFNTLPWVILLVLM
ILYIYAIIGMQFFGKIALNNTGSEITTNNNFQTLFNSFIVLLRCITGEKW
HKIMISCVDDNKSRCQLSSGTCGTPFAYFYFISFIILSNYLIMNLFLAVI
IEKFDYLTKDSSNLGPHHLETFIEQWSYYDIGARGRITPLDVVDLLTKIN
PPLGFGKMCPQDKCLRKLMHMNMPLEKDGTICFRATLFALVRRNLRIKLP
LNSKDLKSIEEYNEELRLIIKRLWRKTSDAVLEEIIPSNVMNTVTVGKFY
ATFLIQDFFRKYKLLKKEKEEKIKIESLITQEDDEVINISSMVFHKNDGI
DGIQAKGEEAIAAVKNTYNGLIDTIWQNLKSIFIMPDEEFFEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR002077VDCCAlpha1
IPR014873VDCC_a1su_IQ
IPR027359Volt_channel_dom_sf
IPR031649GPHH_dom
IPR005821Ion_trans_dom
Vocabulary: molecular function
TermDefinition
GO:0005245voltage-gated calcium channel activity
GO:0005216ion channel activity
GO:0005244voltage-gated ion channel activity
GO:0005262calcium channel activity
Vocabulary: biological process
TermDefinition
GO:0070588calcium ion transmembrane transport
GO:0055085transmembrane transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0034765regulation of ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0005891voltage-gated calcium channel complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002077Voltage-dependent calcium channel, alpha-1 subunitPRINTSPR00167CACHANNELcoord: 615..641
score: 50.29
coord: 178..193
score: 57.62
coord: 1110..1130
score: 43.3
coord: 304..321
score: 46.96
coord: 343..367
score: 29.62
coord: 1280..1294
score: 57.5
coord: 1329..1341
score: 45.31
IPR014873Voltage-dependent calcium channel, alpha-1 subunit, IQ domainSMARTSM01062Ca_chan_IQ_2coord: 1541..1574
e-value: 4.9E-8
score: 42.7
IPR014873Voltage-dependent calcium channel, alpha-1 subunit, IQ domainPFAMPF08763Ca_chan_IQcoord: 1485..1563
e-value: 7.7E-22
score: 77.3
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1015..1111
e-value: 1.2E-7
score: 33.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 1276..1404
e-value: 1.0E-22
score: 82.1
coord: 565..689
e-value: 2.2E-28
score: 100.4
coord: 263..352
e-value: 4.9E-19
score: 70.2
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1405..1526
e-value: 1.6E-21
score: 78.4
NoneNo IPR availablePANTHERPTHR45628FAMILY NOT NAMEDcoord: 22..1576
NoneNo IPR availablePANTHERPTHR45628:SF1VOLTAGE-DEPENDENT CALCIUM CHANNEL TYPE D SUBUNIT ALPHA-1coord: 22..1576
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 452..685
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 845..1116
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 1163..1404
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 58..348
NoneNo IPR availableTMHMMTMhelixcoord: 910..932
NoneNo IPR availableTMHMMTMhelixcoord: 1043..1065
NoneNo IPR availableTMHMMTMhelixcoord: 98..120
NoneNo IPR availableTMHMMTMhelixcoord: 848..866
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 453..475
NoneNo IPR availableTMHMMTMhelixcoord: 1164..1181
NoneNo IPR availableTMHMMTMhelixcoord: 659..681
NoneNo IPR availableTMHMMTMhelixcoord: 579..601
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
NoneNo IPR availableTMHMMTMhelixcoord: 881..903
NoneNo IPR availableTMHMMTMhelixcoord: 970..992
NoneNo IPR availableTMHMMTMhelixcoord: 1196..1218
NoneNo IPR availableTMHMMTMhelixcoord: 59..78
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 1085..1107
NoneNo IPR availableTMHMMTMhelixcoord: 490..512
NoneNo IPR availableTMHMMTMhelixcoord: 1379..1401
NoneNo IPR availableTMHMMTMhelixcoord: 1291..1313
NoneNo IPR availableTMHMMTMhelixcoord: 276..298
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 1151..1275
e-value: 3.8E-29
score: 103.1
coord: 443..564
e-value: 3.0E-22
score: 80.8
coord: 48..175
e-value: 5.2E-26
score: 93.0
IPR027359Voltage-dependent channel domain superfamilyGENE3DG3DSA:1.20.120.350coord: 833..953
e-value: 1.3E-21
score: 78.9
IPR031649Voltage-dependent L-type calcium channel, IQ-associated domainPFAMPF16905GPHHcoord: 1422..1474
e-value: 2.9E-16
score: 59.0
IPR005821Ion transport domainPFAMPF00520Ion_transcoord: 847..1118
e-value: 1.9E-46
score: 158.3
coord: 1164..1411
e-value: 1.0E-52
score: 178.8
coord: 58..350
e-value: 2.0E-56
score: 191.0
coord: 452..689
e-value: 1.6E-45
score: 155.3