ULP_PROTEASE domain-containing protein

Overview
NameULP_PROTEASE domain-containing protein
Smed IDSMED30033434
Length (bp)1085
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ULP_PROTEASE domain-containing protein (SMED30033434) t-SNE clustered cells

Violin plots show distribution of expression levels for ULP_PROTEASE domain-containing protein (SMED30033434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ULP_PROTEASE domain-containing protein (SMED30033434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ULP_PROTEASE domain-containing protein (SMED30033434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033434

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033434SMESG000058418.1 SmedASXL_014413SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033434SMESG000058418.1 SmedASXL_014413SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30033434SMESG000058418.1 dd_Smed_v4_12980_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 104.76 bits (260), Expect = 1.182e-25
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:   45 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFELP---IHLEKWFPRHVIKTKREDIRELILKL 228          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 105.531 bits (262), Expect = 3.792e-24
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  693 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 876          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 105.531 bits (262), Expect = 3.965e-24
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  824 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1007          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 105.531 bits (262), Expect = 4.047e-24
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  857 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1040          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Match: SENP7 (SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:HGNC:30402])

HSP 1 Score: 105.531 bits (262), Expect = 4.340e-24
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  791 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 974          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Match: CG12717 (gene:FBgn0030420 transcript:FBtr0073704)

HSP 1 Score: 103.219 bits (256), Expect = 1.030e-23
Identity = 59/185 (31.89%), Postives = 92/185 (49.73%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSE 622
             +  HW L I+C+P +   +  N   N    T +  IP                         +  P IL+FDSL++  R   + I+RDYL  E  AK   +    +F+K  + G+  ++PQQ+N TDCG+YLL Y+E FF KPI  +T+   +  L++WF    + KKR  I  +I+K++ +S 
Sbjct:  474 NEQSHWILAIICYPNLRSPVVNN---NNVQTTLSDDIP-------------------------IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAH-VFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKE--LSNWFDLLTVTKKREDIANLIKKLMNESN 627          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Match: CG12717 (gene:FBgn0030420 transcript:FBtr0346120)

HSP 1 Score: 103.219 bits (256), Expect = 1.030e-23
Identity = 59/185 (31.89%), Postives = 92/185 (49.73%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSE 622
             +  HW L I+C+P +   +  N   N    T +  IP                         +  P IL+FDSL++  R   + I+RDYL  E  AK   +    +F+K  + G+  ++PQQ+N TDCG+YLL Y+E FF KPI  +T+   +  L++WF    + KKR  I  +I+K++ +S 
Sbjct:  474 NEQSHWILAIICYPNLRSPVVNN---NNVQTTLSDDIP-------------------------IKQPLILIFDSLAVTSRHRAIAILRDYLTCEHKAKYPNALAH-VFNKDNMPGHSVEVPQQQNLTDCGLYLLQYVEQFFTKPINDYTLPIKE--LSNWFDLLTVTKKREDIANLIKKLMNESN 627          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076952)

HSP 1 Score: 98.9821 bits (245), Expect = 4.004e-22
Identity = 49/126 (38.89%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  233 LKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIV 610
            + ++D   V  P IL+FDSL+   R+  V  +RDYL  E+  K+  +    +F+K  + G+  K+PQQ NFTDCG+YLL Y+E FF +PI+ + +   Q  L +WF    + KKR  I  +IQ+++
Sbjct: 1552 IASDDVPAVKQPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQAH-VFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQQLM 1674          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076950)

HSP 1 Score: 98.9821 bits (245), Expect = 4.004e-22
Identity = 49/126 (38.89%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  233 LKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIV 610
            + ++D   V  P IL+FDSL+   R+  V  +RDYL  E+  K+  +    +F+K  + G+  K+PQQ NFTDCG+YLL Y+E FF +PI+ + +   Q  L +WF    + KKR  I  +IQ+++
Sbjct: 1552 IASDDVPAVKQPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQAH-VFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQQLM 1674          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Match: velo (gene:FBgn0035713 transcript:FBtr0076951)

HSP 1 Score: 98.2117 bits (243), Expect = 5.327e-22
Identity = 49/126 (38.89%), Postives = 76/126 (60.32%), Query Frame = 2
Query:  233 LKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIV 610
            + ++D   V  P IL+FDSL+   R+  V  +RDYL  E+  K+  +    +F+K  + G+  K+PQQ NFTDCG+YLL Y+E FF +PI+ + +   Q  L +WF    + KKR  I  +IQ+++
Sbjct:  430 IASDDVPAVKQPLILIFDSLAGASRSRVVATLRDYLTCEYRVKKPDAQAH-VFNKDNMPGHCVKVPQQNNFTDCGLYLLQYVEQFFGEPIRDYRLPIKQ--LTNWFDFLTVTKKREDIANLIQQLM 552          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Match: senp6a (SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-080204-25])

HSP 1 Score: 97.4413 bits (241), Expect = 3.169e-22
Identity = 62/241 (25.73%), Postives = 109/241 (45.23%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWM-AGLIDYNQLMN-----------------KSGVTQASSIPE----NKTEFATKLR-----------HEKLAALKAED-----------------------PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSE 622
             ++ HW+L ++CFP + +  ++ N L                   +  ++Q ++ P     N+ +F   LR           H+       +D                       P +   PCIL+ DSL    R+  V  +R+YL+ EW+ K+ +   K  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  P+ +F +    ++L +WF +  +  KR  I  +I K+  + +
Sbjct:  123 NESAHWYLAVICFPGLESAQVEPNPLYQPQTAVSSSPPTDGASEQRDQLSQNTAGPHRADANQVQFTDGLRRIIEYSTEDDSHQSDDQSSCQDECSEDGALADDSGSFDRAEWTSKPTICKQPCILIMDSLRGPTRSTVVKTLREYLEVEWEVKKGS---KRSFGKELMKGSSPRVPQQDNFSDCGVYVLQYVESFFESPLPSFHL---PMNLLEWFPQQRMKTKREEIKDLILKLQTQQQ 357          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 90.1225 bits (222), Expect = 2.761e-19
Identity = 61/215 (28.37%), Postives = 99/215 (46.05%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWM----AGL-IDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAAL-----------------KAEDPQMV--------------PMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            Q  HW+L ++CFP      +GL +  N+  +      A S P   + F +    ++L+                   +AED   V                PCIL+ DSL+   R+ +V I++ YL+ EW  K  +      F+K  + G+ P +P+Q N+TDCG+YLL Y+E+F   P + F      + L  WF +  + +KR+ I  +I K+
Sbjct:  473 QMSHWYLAVICFPGQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILKL 679          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 89.7373 bits (221), Expect = 3.152e-19
Identity = 61/216 (28.24%), Postives = 99/216 (45.83%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWM----AGL-IDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAAL-----------------KAEDPQMVPM--------------PCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
             Q  HW+L ++CFP      +GL +  N+  +      A S P   + F +    ++L+                   +AED   V                PCIL+ DSL+   R+ +V I++ YL+ EW  K  +      F+K  + G+ P +P+Q N+TDCG+YLL Y+E+F   P + F      + L  WF +  + +KR+ I  +I K+
Sbjct:  354 NQMSHWYLAVICFPGQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILKL 561          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Match: senp6b (SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GENE-030131-6330])

HSP 1 Score: 89.7373 bits (221), Expect = 3.264e-19
Identity = 61/216 (28.24%), Postives = 99/216 (45.83%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWM----AGL-IDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAAL-----------------KAEDPQMVPM--------------PCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
             Q  HW+L ++CFP      +GL +  N+  +      A S P   + F +    ++L+                   +AED   V                PCIL+ DSL+   R+ +V I++ YL+ EW  K  +      F+K  + G+ P +P+Q N+TDCG+YLL Y+E+F   P + F      + L  WF +  + +KR+ I  +I K+
Sbjct:  338 NQMSHWYLAVICFPGQISQTSGLDLSLNERRHSRQYLCAPSPPNPMSLFYSPESSKQLSRWSQSIDDLDQSFEILSDDEAEDDLQVVTNRSVLNRGSDVSKKPCILIMDSLTSSGRSSEVQILQQYLQEEWRVKMGSQQS---FEK--MHGWSPIVPKQDNYTDCGIYLLQYVESFLKDPPQAF---HHNMDLKGWFSQRTVKRKRLQIKELILKL 545          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Match: senp7b (SUMO specific peptidase 7b [Source:ZFIN;Acc:ZDB-GENE-060531-45])

HSP 1 Score: 89.7373 bits (221), Expect = 4.562e-19
Identity = 52/188 (27.66%), Postives = 89/188 (47.34%), Query Frame = 2
Query:   80 HWFLVIVCFPWM--AGLIDYNQLMNKSGVTQ-----------------ASSIPENKTEFATKLRHEKLAALKAED---PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKR 577
            HW+LV++CFP +    ++++ Q   KS V+Q                 +S  P+       + R   L            +   PCIL+ DSL L        ++R+YL+ EW+ ++ +      F   ++ G L ++P Q N +DCG+YLL Y+E+F   P+  F +    + L  WF ++++ KKR
Sbjct:  681 HWYLVLICFPALERPQIVEWRQ---KSSVSQDESQTTKERPSGESQRESSQQPKGNPSKINESRSHNLPDCTVHSCTKETICKRPCILIMDSLKLSYHQRTYTLLREYLQVEWEVRKGSCRS---FSNESITGSLCRVPLQDNSSDCGLYLLQYVESFLQNPVVDFALP---LRLDQWFPRSQVRKKR 859          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Match: tspan9 (tetraspanin 9 [Source:Xenbase;Acc:XB-GENE-956624])

HSP 1 Score: 100.908 bits (250), Expect = 1.285e-22
Identity = 64/209 (30.62%), Postives = 95/209 (45.45%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGL------IDYNQLMNK----SGVTQASSIPEN---KTEFATKLRHEKLAALKAEDPQ-----------------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            +N HW+L ++CFPW+          D   L  K    +  T  S I  N   + E  T +            P                  ++  PC+L+FDSL        V ++R+YLK EW+ KR T      F +S +R + PK+P+Q N TDCG++LL Y+E+F  +PI+ F      + L DWF    +  KR  I  +I K+
Sbjct:  649 ENSHWYLAVICFPWLESAEFEERNFDSTNLCGKPPKEASNTTCSVIVFNDHLEKEEETIVDDSSSDDSTRPSPHSGSNKKKSRVKVLTCDFVLSRPCLLIFDSLKSGSVQTTVQVLREYLKVEWEVKRKTMRE---FSRSNMRDFYPKVPKQNNSTDCGLFLLQYVESFVQQPIENFDSP---IHLEDWFPLTVVKSKREEIRDLILKL 851          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Match: septin2 (septin 2 [Source:Xenbase;Acc:XB-GENE-480201])

HSP 1 Score: 97.8265 bits (242), Expect = 1.511e-21
Identity = 45/112 (40.18%), Postives = 70/112 (62.50%), Query Frame = 2
Query:  263 MPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
             PCIL+ DSL    R+  V  +R+YL+ EW+ ++ +   K  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  PI++F +    ++L DWF +  +  KR  I  +I
Sbjct:  970 QPCILLMDSLKGPSRSTVVKTLREYLEVEWEVRKGS---KRSFSKDFMKGSSPRVPQQNNFSDCGVYILQYVESFFENPIQSFDL---PMNLMDWFPQQRMKTKREEIRNLI 1075          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Match: septin2 (septin 2 [Source:Xenbase;Acc:XB-GENE-480201])

HSP 1 Score: 97.8265 bits (242), Expect = 1.629e-21
Identity = 45/112 (40.18%), Postives = 70/112 (62.50%), Query Frame = 2
Query:  263 MPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
             PCIL+ DSL    R+  V  +R+YL+ EW+ ++ +   K  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  PI++F +    ++L DWF +  +  KR  I  +I
Sbjct:  976 QPCILLMDSLKGPSRSTVVKTLREYLEVEWEVRKGS---KRSFSKDFMKGSSPRVPQQNNFSDCGVYILQYVESFFENPIQSFDL---PMNLMDWFPQQRMKTKREEIRNLI 1081          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Match: septin2 (septin 2 [Source:Xenbase;Acc:XB-GENE-480201])

HSP 1 Score: 97.8265 bits (242), Expect = 1.668e-21
Identity = 45/111 (40.54%), Postives = 70/111 (63.06%), Query Frame = 2
Query:  266 PCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
            PCIL+ DSL    R+  V  +R+YL+ EW+ ++ +   K  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  PI++F +    ++L DWF +  +  KR  I  +I
Sbjct:  961 PCILLMDSLKGPSRSTVVKTLREYLEVEWEVRKGS---KRSFSKDFMKGSSPRVPQQNNFSDCGVYILQYVESFFENPIQSFDL---PMNLMDWFPQQRMKTKREEIRNLI 1065          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 101.293 bits (251), Expect = 6.837e-23
Identity = 49/120 (40.83%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V I+R+YL+ EW+ K+ +   K  F K  ++G  PK+PQQ NF+DCGVY+L Y+E+FF  P+  F +    ++L +WF    +  KR  I  II K+
Sbjct:  991 PTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGS---KRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFEL---PMNLMNWFPPPRMKTKREEIRNIILKL 1104          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 101.293 bits (251), Expect = 7.350e-23
Identity = 49/120 (40.83%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V I+R+YL+ EW+ K+ +   K  F K  ++G  PK+PQQ NF+DCGVY+L Y+E+FF  P+  F +    ++L +WF    +  KR  I  II K+
Sbjct:  984 PTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGS---KRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFEL---PMNLMNWFPPPRMKTKREEIRNIILKL 1097          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Match: Senp6 (SUMO/sentrin specific peptidase 6 [Source:MGI Symbol;Acc:MGI:1922075])

HSP 1 Score: 101.293 bits (251), Expect = 8.541e-23
Identity = 49/120 (40.83%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V I+R+YL+ EW+ K+ +   K  F K  ++G  PK+PQQ NF+DCGVY+L Y+E+FF  P+  F +    ++L +WF    +  KR  I  II K+
Sbjct:  818 PTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGS---KRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFEL---PMNLMNWFPPPRMKTKREEIRNIILKL 931          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Match: Senp7 (SUMO1/sentrin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:1913565])

HSP 1 Score: 99.7525 bits (247), Expect = 2.173e-22
Identity = 60/190 (31.58%), Postives = 93/190 (48.95%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQ--------ASSIPENKTEFATKLRHEKLAALKAEDPQ-MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D  Q +++    Q          + P   +  +T     +   +    P+ M   PCIL+ DSL        V  +R+YL+ EW+ KR T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  844 ESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1027          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Match: Senp7 (SUMO1/sentrin specific peptidase 7 [Source:MGI Symbol;Acc:MGI:1913565])

HSP 1 Score: 99.7525 bits (247), Expect = 2.214e-22
Identity = 60/190 (31.58%), Postives = 93/190 (48.95%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQ--------ASSIPENKTEFATKLRHEKLAALKAEDPQ-MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D  Q +++    Q          + P   +  +T     +   +    P+ M   PCIL+ DSL        V  +R+YL+ EW+ KR T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  817 ESSHWYLAVICFPWLEEAVYEDCPQTVSQQFQGQQSQHDHKMTDNDPHTTSTVSTSAEDSQSTEVNMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1000          
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BQF6|SENP7_HUMAN (Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7 PE=1 SV=4)

HSP 1 Score: 105.531 bits (262), Expect = 1.944e-23
Identity = 66/192 (34.38%), Postives = 94/192 (48.96%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +         S  +NKT     LR     +L AED Q           M   PCIL+ DSL        V  +R+YL+ EW+ K  T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  857 ESSHWYLAVICFPWLEEAVYEDFPQTV-SQQSQAQQSQNDNKT-IDNDLRTTSTLSLSAEDSQSTESNMSVPKKMCKRPCILILDSLKAASVQNTVQNLREYLEVEWEVKLKTHRQ---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1040          
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Match: sp|A7MBJ2|SENP7_BOVIN (Sentrin-specific protease 7 OS=Bos taurus OX=9913 GN=SENP7 PE=2 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.829e-23
Identity = 62/192 (32.29%), Postives = 93/192 (48.44%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ-----------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+  ++  D+ Q + +   +QA     +       L      +   ED Q           M   PCIL+ DSL        V  +R+YL+ EW+ KR T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  854 ESSHWYLAVICFPWLEEVVYEDFPQTIPQ--YSQAEESHHDSRTIDNDLHTSSALSSGTEDSQSPEMNVTVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKTHRE---FSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFKDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1037          
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9GZR1|SENP6_HUMAN (Sentrin-specific protease 6 OS=Homo sapiens OX=9606 GN=SENP6 PE=1 SV=2)

HSP 1 Score: 104.375 bits (259), Expect = 5.307e-23
Identity = 51/120 (42.50%), Postives = 74/120 (61.67%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V I+R+YL+ EW+ K+ +   K  F K  ++G  PK+PQQ NF+DCGVY+L Y+E+FF  PI +F +    ++LA+WF    +  KR  I  II K+
Sbjct:  965 PTICKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGS---KRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPILSFEL---PMNLANWFPPPRMRTKREEIRNIILKL 1078          
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Match: sp|D3ZF42|SENP7_RAT (Sentrin-specific protease 7 OS=Rattus norvegicus OX=10116 GN=Senp7 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 1.482e-22
Identity = 61/190 (32.11%), Postives = 93/190 (48.95%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLI--DYNQLMNKSGVTQAS--------SIPENKTEFATKLRHEKLAALKAEDPQ-MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            ++ HW+L ++CFPW+   +  D+ Q +++    Q S        + P   +   T     +        P+ M   PCIL+ DSL        V  +R+YL+ EW+ KR T      F K+ +    PK+P+Q N +DCGVYLL Y+E+FF  PI  F +    + L  WF +  I  KR  I  +I K+
Sbjct:  844 ESSHWYLAVICFPWLEEAVYEDFPQTVSQEFQDQQSQHDNKTIDNDPHTTSTVFTSAEESQSTETSMSVPKKMCKRPCILILDSLKAASIQNTVQNLREYLEVEWEVKRKT---HREFSKTNMVDLCPKVPKQDNSSDCGVYLLQYVESFFQDPIVNFEL---PIHLEKWFPRHVIKTKREDIRELILKL 1027          
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P7W0|SENP6_MOUSE (Sentrin-specific protease 6 OS=Mus musculus OX=10090 GN=Senp6 PE=1 SV=3)

HSP 1 Score: 101.293 bits (251), Expect = 5.141e-22
Identity = 49/120 (40.83%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V I+R+YL+ EW+ K+ +   K  F K  ++G  PK+PQQ NF+DCGVY+L Y+E+FF  P+  F +    ++L +WF    +  KR  I  II K+
Sbjct:  984 PTVCKQPCILLMDSLRGPSRSNVVKILREYLEVEWEVKKGS---KRSFSKDVMKGSNPKVPQQNNFSDCGVYVLQYVESFFENPVLNFEL---PMNLMNWFPPPRMKTKREEIRNIILKL 1097          
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Match: A0A087VXC7 (Sentrin specific protease 7 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000060300 PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.778e-44
Identity = 79/210 (37.62%), Postives = 122/210 (58.10%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVP--------------------------MPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKS 619
             +N HWFL +VC+PWM G++ Y +L       Q   IP+    FA     E    +  E+ + +P                          MPCIL+FDS+S Q+R   +HIIR+YL++EWD +R   DG ++F+K TVRG+ P++P Q N  DCG++LLHY+E FF +P+K++T +FFQ  ++ WF+   + KKR +I+ +I++I  +S
Sbjct:  478 NENLHWFLGLVCYPWMVGMVSYTKLYADYSFDQCRLIPD----FADTNNVETFGDVGIEEVKNLPTDERGDAFDRWRRRRLAWLRGRGINAMPCILLFDSISAQQRIGNLHIIRNYLQAEWDVRRRERDGAMLFNKDTVRGFSPRVPGQSNLVDCGIFLLHYVEMFFKRPLKSYTREFFQNEMSRWFESEMLGKKRSVISKLIEQISRRS 683          
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Match: A0A4E0RHH0 (Sentrin-specific protease 7 OS=Fasciola hepatica OX=6192 GN=D915_008307 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 3.608e-44
Identity = 78/213 (36.62%), Postives = 122/213 (57.28%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQL------------------------MNKSGVTQASS----IPENKTEFA-TKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKS 619
             +  HWFL +VC+PWMAG++ Y  L                        +N    T  ++    +P +    A  + R ++L  L++    +  MPCIL+FDSL  Q R   +H+IRDYL++EWD +R+  DG L F+K T+RG+ P++P Q N  DCG+YLLHY+E FF +P+K++T  +FQ  +A WF +A + +KR+ I  +I ++  +S
Sbjct:  325 NEASHWFLGLVCYPWMAGMVSYTALYQAEAFDMCQLTERFANVDSLIGQLNVDDQTMCNAPLERLPSDMVGSAFDRWRRQRLVWLRSRG--INAMPCILLFDSLPCQTRVSNLHVIRDYLQAEWDTRRAEQDGPLSFNKDTIRGFSPRVPSQSNLVDCGIYLLHYVEMFFKQPVKSYTKGYFQHEMASWFSEATVGEKRMEIYNVIMRLHERS 535          
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Match: A0A0R3TM84 (ULP_PROTEASE domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8407 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.172e-44
Identity = 75/206 (36.41%), Postives = 121/206 (58.74%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVP--------------------------MPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
             +N HWFL +VC+PWM G++ YN+L ++    Q   +P+    FA       L  +  E+ +++P                          MPCIL+FDSL+ Q R   +H IR YL++EWD +RS  DG+++F+K T+RG+ P++P Q N  DCG++LLHY+E FF +P+K++T ++FQ  ++ WF+   + KKR +I  +I ++
Sbjct:  424 NENLHWFLGLVCYPWMVGMVSYNKLYSEYNYDQCQLVPD----FADTTFDPNLGDIGNEEIRVLPTDAQAEAFNRWRRRRLAWLRKRGINAMPCILLFDSLASQHRVGNLHKIRSYLQAEWDVRRSERDGEMVFNKDTIRGFSPRVPGQGNLVDCGIFLLHYVEMFFKRPVKSYTREYFQNEMSRWFESDMLGKKRSVINKLIDQL 625          
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Match: A0A0R3WL90 (ULP_PROTEASE domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1515 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.299e-43
Identity = 78/203 (38.42%), Postives = 124/203 (61.08%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPE----NKTEFA-TKLRHEKLAALKAED------------------PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
             +N HWFL +VC+PWM G++ Y +L       Q   IP+    N  E + + +  E++ AL  ++                    +  MPCIL+FDS+S Q+R   +HIIR+YL++EWD +R   DG ++F+K TVRG+ P++P Q N  DCG++LLHY+E FF +P+K++T +FFQ  ++ WF+   + KKR +I+ +I++I
Sbjct:  578 NENLHWFLGLVCYPWMVGMVSYTKLYADYSFDQCRLIPDFADTNNVEASFSDIGIEEVKALPTDERGEAFDRWRRRRLAWLRGRGINAMPCILLFDSISAQQRIGNLHIIRNYLQAEWDVRRKERDGDMLFNKDTVRGFSPRVPGQSNLVDCGIFLLHYVEMFFKRPLKSYTREFFQNEMSRWFESEMLGKKRSVISKLIEQI 780          
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Match: A0A068WWJ0 (Sentrin specific protease 7 OS=Echinococcus granulosus OX=6210 GN=EgrG_000060300 PE=4 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 3.294e-43
Identity = 78/207 (37.68%), Postives = 124/207 (59.90%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPE----NKTEFA-TKLRHEKLAALKAED------------------PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKS 619
             +N HWFL +VC+PWM G++ Y +L       Q   IP+    N  E +   +  E++  L  ++                    +  MPCIL+FDS+S Q+R   +HIIR+YL++EWD +R   DG ++F+K TVRG+ P++P Q N  DCG++LLHY+E FF +P+K++T +FFQ  ++ WF+   + KKR +I+ +I++I  +S
Sbjct:  478 NENLHWFLGLVCYPWMVGMVSYTKLYADYSFDQCRLIPDFADTNNVEASFGDVGIEEVKNLPTDERGDAFDRWRRRRLAWLRGRGINAMPCILLFDSISAQQRIGNLHIIRNYLQAEWDVRRRERDGDMLFNKDTVRGFSPRVPGQSNLVDCGIFLLHYVEMFFKRPLKSYTREFFQNEMSRWFESEMLGKKRSVISKLIEQISRRS 684          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Match: senp6a (SUMO specific peptidase 6 [Source:NCBI gene;Acc:103024689])

HSP 1 Score: 98.9821 bits (245), Expect = 3.443e-22
Identity = 47/120 (39.17%), Postives = 72/120 (60.00%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V  +R+YL+ EW+ K+ +   +  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  P+ +F      ++L DWF +  +  KR  I  +I KI
Sbjct:  970 PTICRQPCILIMDSLRGPARSTVVKTLREYLEVEWEVKKGS---RRSFGKEVMKGSSPRVPQQDNFSDCGVYVLQYVESFFENPLPSF---HLPMNLLDWFPQQRMKTKRDEIKDLILKI 1083          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Match: senp6a (SUMO specific peptidase 6 [Source:NCBI gene;Acc:103024689])

HSP 1 Score: 98.2117 bits (243), Expect = 5.988e-22
Identity = 47/120 (39.17%), Postives = 73/120 (60.83%), Query Frame = 2
Query:  248 PQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            P +   PCIL+ DSL    R+  V  +R+YL+ EW+ K+ +   +  F K  ++G  P++PQQ NF+DCGVY+L Y+E+FF  P+ +F +    ++L DWF +  +  KR  I  +I KI
Sbjct:  963 PTICRQPCILIMDSLRGPARSTVVKTLREYLEVEWEVKKGS---RRSFGKEVMKGSSPRVPQQDNFSDCGVYVLQYVESFFENPLPSFHL---PMNLLDWFPQQRMKTKRDEIKDLILKI 1076          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Match: senp7b (sentrin-specific protease 7-like [Source:NCBI gene;Acc:103027137])

HSP 1 Score: 91.2781 bits (225), Expect = 1.305e-19
Identity = 58/196 (29.59%), Postives = 93/196 (47.45%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWM--AGLIDYNQLMNK--SGVT-----QASSIPENKTEFATKLRHEKLAALKAEDPQ------------------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKR 577
            Q  HW+LV++CFP +  A  + +  L +   SG T     Q SS P ++      L  E+      E P+                  +   PCIL+ DSL L        ++R+YL+ EW+ +R T      F+ ++++G   K+P Q N +DCG+YLL Y+E+F   P+  F +      L  WF + ++ +KR
Sbjct:  668 QEAHWYLVVICFPGLLQAESVPWKNLASSEASGTTNKPQLQDSSKPGSQ---GPTLSTEQRQTGSTEGPKCNSPDLPDCTVLSCQRQNVTRRPCILIMDSLKLSYHLRIYTLLREYLQVEWEVRRGT---PRTFNDNSIKGSHCKVPLQDNSSDCGLYLLQYVESFLQNPVVHFDLPL---RLERWFPRQQVRRKR 854          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-100n23.3 (SUMO specific peptidase 7 [Source:NCBI gene;Acc:103030654])

HSP 1 Score: 91.2781 bits (225), Expect = 1.407e-19
Identity = 55/206 (26.70%), Postives = 89/206 (43.20%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQ---------------------------MVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
            Q  HW+LV+VCFP M    D  Q + + G   A    EN ++       ++ +   +E  +                           +   PCIL+ DSL L        ++R+YL+ EW+ KR    G   F    + G   ++P Q N +DCG+YLL Y E+F   P+  F +      L  WF + ++ +KR  I  ++ ++
Sbjct:  830 QEAHWYLVVVCFPGM----DEPQWVKREGQDSAEDTTENSSDSTAGTETQEGSKNNSEGEKSSDENSSKPVSISGPPNCTERTCTRKTVCKRPCILIMDSLKLSVHERIFKLLREYLQVEWETKRG---GHRDFSAEKMVGSHCRVPLQDNSSDCGLYLLQYAESFLQDPVVNFELPL---RLECWFPRQQVREKREEIRDLVLRL 1025          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Match: senp6b (sentrin-specific protease 6-like [Source:NCBI gene;Acc:103045568])

HSP 1 Score: 88.1965 bits (217), Expect = 1.164e-18
Identity = 61/215 (28.37%), Postives = 94/215 (43.72%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSG------VTQASSIPENKTEFATKLRHEKLAALKAEDPQM-----------------------------VPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKI 607
             Q  HW+L ++CFP  A        M+ SG       T + S P   + F  +   E L+       +M                                PCIL+ DSLS + +   V I+++YL+ EW  K+ T   +  F   ++ G+  ++PQQ N TDCGVYLL Y E+  + P +   I    V L++WF +  + KKR  I  +I ++
Sbjct:  443 NQLSHWYLAVICFPGQASPC---STMDSSGNEESMEYTPSPSHPNPMSLFYRQPASEHLSRQSVSIGEMDEGFCFVSDHDSDDDIQYNGTSRNVFNIASKQPCILIMDSLSCRSKPTVVKILQEYLEMEWLVKKGT---RRSFANGSMNGWSLQVPQQDNHTDCGVYLLQYAESLIMNPPQ---ILHPGVDLSEWFPQTLVKKKREKIKRLINRL 648          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Yeast
Match: ULP2 (Peptidase that deconjugates Smt3/SUMO-1 peptides from proteins; plays a role in chromosome cohesion at centromeric regions and recovery from checkpoint arrest induced by DNA damage or DNA replication defects; potential Cdc28p substrate; human homolog PML implicated in promyelocytic leukemia can partially complement yeast null mutant [Source:SGD;Acc:S000001293])

HSP 1 Score: 48.521 bits (114), Expect = 1.018e-6
Identity = 36/146 (24.66%), Postives = 65/146 (44.52%), Query Frame = 2
Query:   80 HWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTI 517
            HWF  I+    +  ++D++Q  +K+    +  I  N                        P+  IL FDSL  Q  + ++  I+++L S    K S     +  DK+ ++     +PQQ N +DCGV+++  +  FF  P++T  +
Sbjct:  531 HWFSCIIT--NLDAILDFHQNKDKNDAINSDEISINN-----------------------PLVNILTFDSLR-QTHSREIDPIKEFLISYALDKYS-----IQLDKTQIKMKTCPVPQQPNMSDCGVHVILNIRKFFENPVETIDV 645          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Match: senp7b (sentrin-specific protease 7 [Source:NCBI gene;Acc:101175292])

HSP 1 Score: 100.138 bits (248), Expect = 1.454e-22
Identity = 56/177 (31.64%), Postives = 89/177 (50.28%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
             Q+ HWFLV++CFP   GL +  Q   +S   Q  S+P  +    T     +   +K         PCILV DSL          ++RDYL+ EW+ +R T     +F   +++G+  ++PQQ N +DCGV+LL +  +F   P+  F +      L +WF + ++ +KR  I  +I
Sbjct:  615 NQDSHWFLVVICFP---GLEEPRQEQLES-AGQVVSLPSAQPPECTLRGCSRRTVMK--------RPCILVMDSLKTSSHDGVCRLLRDYLQVEWEVRRRT---PRLFSADSMKGFSCRVPQQDNSSDCGVFLLQFAHSFLQNPVVNFELP---PRLENWFPRQQVRRKREEIRNLI 773          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Match: senp6a (SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GENE-080204-25])

HSP 1 Score: 92.0485 bits (227), Expect = 2.116e-20
Identity = 45/120 (37.50%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  239 AEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
            A  P ++  PCIL+ DSL    R+  V  +R+YL+ EW+ ++ T   +  F K  ++G  P +PQQ NF+DCGVY+L Y+E+FF  P   F +    ++L++WF +  +  KR  I  +I
Sbjct:  231 ASKPTILKQPCILIMDSLRGPTRSTVVKTLREYLEVEWEVRKGT---QRSFSKEVMKGSSPCVPQQDNFSDCGVYVLQYVESFFENPPPRFHL---PMNLSEWFPQQRMKTKREEIKELI 344          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Match: si:dkey-100n23.3 (uncharacterized LOC101170552 [Source:NCBI gene;Acc:101170552])

HSP 1 Score: 87.8113 bits (216), Expect = 1.944e-18
Identity = 58/198 (29.29%), Postives = 93/198 (46.97%), Query Frame = 2
Query:   71 QNQHWFLVIVCFP---------WMAGL----------IDYNQLMNKSGVTQASSIPEN--KTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLI-FDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
            Q  HW+LVI+CFP         W AG            D   + + S   +A ++P++  K    + +   +    +     +   PCIL+ DSL +      V ++RDYL+SEW+ +R    G L  F    ++    K+P Q N +DCG+YLL Y+E F   P+  F +    + L  WF + ++ +KR  I  +I
Sbjct:  812 QEAHWYLVIICFPGLDEPKVESWTAGSPSEETVGRSEADAEMICSNSVEAEAENVPKDPSKDSPTSPVSCTEQTCCRQ---TVQRRPCILLMDSLKISLHERVVKLLRDYLQSEWEVRR----GSLRDFGPDQMKSSNCKVPLQDNSSDCGLYLLQYVECFLKDPVVHFDL---PLQLQQWFPRQQVRRKRDEIRDLI 999          
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Match: si:dkey-100n23.3 (uncharacterized LOC101170552 [Source:NCBI gene;Acc:101170552])

HSP 1 Score: 87.8113 bits (216), Expect = 1.944e-18
Identity = 58/198 (29.29%), Postives = 93/198 (46.97%), Query Frame = 2
Query:   71 QNQHWFLVIVCFP---------WMAGL----------IDYNQLMNKSGVTQASSIPEN--KTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLI-FDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
            Q  HW+LVI+CFP         W AG            D   + + S   +A ++P++  K    + +   +    +     +   PCIL+ DSL +      V ++RDYL+SEW+ +R    G L  F    ++    K+P Q N +DCG+YLL Y+E F   P+  F +    + L  WF + ++ +KR  I  +I
Sbjct:  812 QEAHWYLVIICFPGLDEPKVESWTAGSPSEETVGRSEADAEMICSNSVEAEAENVPKDPSKDSPTSPVSCTEQTCCRQ---TVQRRPCILLMDSLKISLHERVVKLLRDYLQSEWEVRR----GSLRDFGPDQMKSSNCKVPLQDNSSDCGLYLLQYVECFLKDPVVHFDL---PLQLQQWFPRQQVRRKRDEIRDLI 999          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000058418.1 (SMESG000058418.1)

HSP 1 Score: 396.741 bits (1018), Expect = 3.622e-135
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = 2
Query:   71 QNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSEPEVAK 637
            +NQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSEPEVAK
Sbjct:  356 ENQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSEPEVAK 544          

HSP 2 Score: 51.9878 bits (123), Expect = 4.570e-7
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:    3 LTNSCNLDTPSVRHERVSKWTKN 71
            LTNSCNLDTPSVRHERVSKWTKN
Sbjct:  319 LTNSCNLDTPSVRHERVSKWTKN 341          
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Match: SMESG000052086.1 (SMESG000052086.1)

HSP 1 Score: 198.749 bits (504), Expect = 1.556e-56
Identity = 87/177 (49.15%), Postives = 121/177 (68.36%), Query Frame = 2
Query:   68 KQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATKLRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDAKRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKTFTIDFFQVSLADWFKKAEIDKKRVIITGII 598
             +N HWFL I+CFPWMAG+I Y+QL       Q S IPEN++ F+ K R E+L +L+ +   + P PCIL+FDSL    R   V +IR+YLK+EWD KR+  DG L+FDK+T+RG+ P++PQQ N  DCG+Y+LHY+E FF  P+  +T ++FQ SL +WF K  ++ KR  I  +I
Sbjct:  739 NENNHWFLAIICFPWMAGMISYDQLFGMPNC-QISEIPENQSVFSQKTRVERLRSLRTQK-NIEPKPCILLFDSLQHVTRAPNVKLIREYLKTEWDVKRAAKDGPLVFDKNTIRGFNPQVPQQTNTIDCGIYVLHYVEMFFEHPLSVYTKEYFQTSLTEWFDKKTVETKREFIQKLI 913          
The following BLAST results are available for this feature:
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SENP71.182e-2534.38SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP73.792e-2434.38SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP73.965e-2434.38SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP74.047e-2434.38SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
SENP74.340e-2434.38SUMO specific peptidase 7 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG127171.030e-2331.89gene:FBgn0030420 transcript:FBtr0073704[more]
CG127171.030e-2331.89gene:FBgn0030420 transcript:FBtr0346120[more]
velo4.004e-2238.89gene:FBgn0035713 transcript:FBtr0076952[more]
velo4.004e-2238.89gene:FBgn0035713 transcript:FBtr0076950[more]
velo5.327e-2238.89gene:FBgn0035713 transcript:FBtr0076951[more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
senp6a3.169e-2225.73SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b2.761e-1928.37SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b3.152e-1928.24SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
senp6b3.264e-1928.24SUMO specific peptidase 6b [Source:ZFIN;Acc:ZDB-GE... [more]
senp7b4.562e-1927.66SUMO specific peptidase 7b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tspan91.285e-2230.62tetraspanin 9 [Source:Xenbase;Acc:XB-GENE-956624][more]
septin21.511e-2140.18septin 2 [Source:Xenbase;Acc:XB-GENE-480201][more]
septin21.629e-2140.18septin 2 [Source:Xenbase;Acc:XB-GENE-480201][more]
septin21.668e-2140.54septin 2 [Source:Xenbase;Acc:XB-GENE-480201][more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Senp66.837e-2340.83SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
Senp67.350e-2340.83SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
Senp68.541e-2340.83SUMO/sentrin specific peptidase 6 [Source:MGI Symb... [more]
Senp72.173e-2231.58SUMO1/sentrin specific peptidase 7 [Source:MGI Sym... [more]
Senp72.214e-2231.58SUMO1/sentrin specific peptidase 7 [Source:MGI Sym... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BQF6|SENP7_HUMAN1.944e-2334.38Sentrin-specific protease 7 OS=Homo sapiens OX=960... [more]
sp|A7MBJ2|SENP7_BOVIN3.829e-2332.29Sentrin-specific protease 7 OS=Bos taurus OX=9913 ... [more]
sp|Q9GZR1|SENP6_HUMAN5.307e-2342.50Sentrin-specific protease 6 OS=Homo sapiens OX=960... [more]
sp|D3ZF42|SENP7_RAT1.482e-2232.11Sentrin-specific protease 7 OS=Rattus norvegicus O... [more]
sp|Q6P7W0|SENP6_MOUSE5.141e-2240.83Sentrin-specific protease 6 OS=Mus musculus OX=100... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VXC71.778e-4437.62Sentrin specific protease 7 OS=Echinococcus multil... [more]
A0A4E0RHH03.608e-4436.62Sentrin-specific protease 7 OS=Fasciola hepatica O... [more]
A0A0R3TM845.172e-4436.41ULP_PROTEASE domain-containing protein OS=Rodentol... [more]
A0A0R3WL901.299e-4338.42ULP_PROTEASE domain-containing protein OS=Hydatige... [more]
A0A068WWJ03.294e-4337.68Sentrin specific protease 7 OS=Echinococcus granul... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
senp6a3.443e-2239.17SUMO specific peptidase 6 [Source:NCBI gene;Acc:10... [more]
senp6a5.988e-2239.17SUMO specific peptidase 6 [Source:NCBI gene;Acc:10... [more]
senp7b1.305e-1929.59sentrin-specific protease 7-like [Source:NCBI gene... [more]
si:dkey-100n23.31.407e-1926.70SUMO specific peptidase 7 [Source:NCBI gene;Acc:10... [more]
senp6b1.164e-1828.37sentrin-specific protease 6-like [Source:NCBI gene... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ULP21.018e-624.66Peptidase that deconjugates Smt3/SUMO-1 peptides f... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
senp7b1.454e-2231.64sentrin-specific protease 7 [Source:NCBI gene;Acc:... [more]
senp6a2.116e-2037.50SUMO specific peptidase 6a [Source:ZFIN;Acc:ZDB-GE... [more]
si:dkey-100n23.31.944e-1829.29uncharacterized LOC101170552 [Source:NCBI gene;Acc... [more]
si:dkey-100n23.31.944e-1829.29uncharacterized LOC101170552 [Source:NCBI gene;Acc... [more]
back to top
BLAST of ULP_PROTEASE domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000058418.13.622e-13599.47SMESG000058418.1[more]
SMESG000052086.11.556e-5649.15SMESG000052086.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033434 ID=SMED30033434|Name=ULP_PROTEASE domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1085bp
GACTCACAAATAGTTGCAATCTAGACACTCCATCAGTTCGGCATGAACGC
GTTTCTAAATGGACAAAAAACAAAATCAGCATTGGTTTCTTGTGATAGTC
TGTTTCCCGTGGATGGCGGGTTTGATCGATTACAACCAATTAATGAATAA
ATCCGGAGTGACTCAGGCATCTTCAATTCCGGAAAATAAAACCGAATTCG
CCACAAAACTCCGCCACGAGAAATTGGCCGCATTGAAAGCAGAAGATCCT
CAAATGGTTCCAATGCCGTGTATTCTTGTGTTTGATTCGCTGTCGTTGCA
GCGGCGGACTGAGAAAGTCCACATAATTCGAGATTATCTCAAGTCTGAAT
GGGACGCGAAACGATCAACATCCGATGGAAAGTTGATATTCGACAAGTCC
ACCGTTCGAGGATATCTGCCCAAAATTCCCCAGCAAAAGAATTTCACAGA
CTGCGGAGTTTATTTACTTCATTATTTGGAAACGTTTTTTTTGAAACCTA
TCAAGACTTTTACTATCGATTTTTTCCAAGTCAGTCTGGCGGATTGGTTT
AAAAAAGCAGAAATCGATAAAAAGCGTGTTATAATCACAGGTATCATACA
AAAAATCGTTGTGAAGTCAGAACCGGAAGTAGCCAAATGATGGAATTGAG
TAGATTGTAATGCAAACATTTTTCTGTAAATAATAATGATTATTTGAATT
TCTTTTTAATTTCTCAATGTGACAATATTTAGGTGACTGAATCGATTTTG
CTTTTTTGACAAAATAGGTTATTACACATTTATAGATTTCAGTGTCGATT
TGTGTTGTAATATTTATTTGATTGTACGGATTGGTTTTTACACGAATTTC
AAGTACATGCAGCTATAATTGTTGTCATGACTTTATTTAAATTTGATTGG
TTGATTTCAACTAACGAATGAGAATTATAAATTGCGCCATTCTAATCAAT
TGGGAATATAGTTGCCGTTTCATTCTGACAAAGGGTATCCATGTTTTCAA
GGATATTTATTGGTCTCTCTTGTAAATGATTATTATGATTAAGGATAACT
AATCAGCAGAATTCTATCTCTAGTTTTAATTCCAG
back to top

protein sequence of SMED30033434-orf-1

>SMED30033434-orf-1 ID=SMED30033434-orf-1|Name=SMED30033434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MDKKQNQHWFLVIVCFPWMAGLIDYNQLMNKSGVTQASSIPENKTEFATK
LRHEKLAALKAEDPQMVPMPCILVFDSLSLQRRTEKVHIIRDYLKSEWDA
KRSTSDGKLIFDKSTVRGYLPKIPQQKNFTDCGVYLLHYLETFFLKPIKT
FTIDFFQVSLADWFKKAEIDKKRVIITGIIQKIVVKSEPEVAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038765Papain-like_cys_pep_sf
IPR003653Peptidase_C48_C
Vocabulary: molecular function
TermDefinition
GO:0008234cysteine-type peptidase activity
GO:0008233peptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003653Ulp1 protease family, C-terminal catalytic domainPFAMPF02902Peptidase_C48coord: 6..154
e-value: 3.1E-16
score: 59.9
IPR003653Ulp1 protease family, C-terminal catalytic domainPROSITEPS50600ULP_PROTEASEcoord: 1..143
score: 12.903
NoneNo IPR availableGENE3DG3DSA:1.10.418.20coord: 80..191
e-value: 7.1E-20
score: 72.9
NoneNo IPR availablePANTHERPTHR46896FAMILY NOT NAMEDcoord: 42..183
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 6..181