Protocadherin-11 X-linked

Overview
NameProtocadherin-11 X-linked
Smed IDSMED30033431
Length (bp)3720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-11 X-linked (SMED30033431) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30033431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-11 X-linked (SMED30033431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-11 X-linked (SMED30033431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033431

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
anterior region of the whole animalSMED30033431SMESG000072628.1 dd_Smed_v4_17019_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30033431SMESG000072628.1 dd_Smed_v4_17019_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30033431SMESG000072628.1 SmedASXL_012697SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30033431SMESG000072628.1 dd_Smed_v4_17019_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033431SMESG000072628.1 dd_Smed_v6_17019_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30033431SMESG000072628.1 dd_Smed_v4_17019_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 266.159 bits (679), Expect = 6.053e-73
Identity = 230/779 (29.53%), Postives = 370/779 (47.50%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQ--MTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV-SDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ----AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSP 2820
            + EE P  +L+  +A+          +K +V          + Y   + ++ +I  T   +DRE L         C  + P  D CIL+F+  +T    N +  +++  IE++D+NDN+P+F +   T+ + EN  +G +    + SD D+      S E+      +E F  ++ +DQ     +L ++ +LDRE  D++ L I   DGGS P   + ++ + + D NDN PK+   ++   + E+ PI H +I++ A D D G N ++ Y F    ++    +R    L+  +G I VQ  +D E L +  +R  V+AKD G     + + VV +TV D+NDN P I+     +   +D +  I E+V     VA + V+D D G+   V C +  +  FQL       +   K Y L T   +D E +  Y I I   D G P L+ST  L + V D NDN P+F  ++ +   PENN  G+ I  + A+D D   N  ++YSL     A+ + +I   TG +      DRE  + Y   V+A D G   L  ++ V + +LD ND+ PKF L  Y FS+ E+      VG V  ID D GENA++   ++     F I   +G  IL S + DRE+ S Y  ++ A DGG P       V IN+ D NDN P    PS+ ++++     ++    ++Q+ A D D     +  + Y      S+   +P         LF I SH G + L  +     +    ++ ++  D G P
Sbjct:   64 VPEEQPPNTLIGSLAADYGFPDVGHLYKLEV---------GAPYLRVDGKTGDIFTTETSIDREGL-------RECQNQLPG-DPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF----HQAPEVVRRLLRLDRNTGLITVQGPVDREDLST--LRFSVLAKDRGTNPKSARAQVV-VTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTG-TILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFD--SGVNAELIY------SIAGGNP-------YGLFQIGSHSGAITLEKEIERRHHGLH-RLVVKVSDRGKP 800          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 266.159 bits (679), Expect = 2.351e-72
Identity = 203/655 (30.99%), Postives = 320/655 (48.85%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQ--MTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV-SDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ----AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            + EE P  +L+  +A+          +K +V          + Y   + ++ +I  T   +DRE L         C  + P  D CIL+F+  +T    N +  +++  IE++D+NDN+P+F +   T+ + EN  +G +    + SD D+      S E+      +E F  ++ +DQ     +L ++ +LDRE  D++ L I   DGGS P   + ++ + + D NDN PK+   ++   + E+ PI H +I++ A D D G N ++ Y F    ++    +R    L+  +G I VQ  +D E L +  +R  V+AKD G     + + VV +TV D+NDN P I+     +   +D +  I E+V     VA + V+D D G+   V C +     FQL       +   K Y L T   +D E +  Y I I   D G P L+ST  L + V D NDN P+F  ++ +   PENN  G+ I  + A+D D   N  ++YSL     A+ + +I   TG +      DRE  + Y   V+A D G   L  ++ V + +LD ND+ PKF L  Y FS+ E+      VG V  ID D GENA++   ++     F I   +G  IL S + DRE+ S Y  ++ A DGG P
Sbjct:   64 VPEEQPPNTLIGSLAADYGFPDVGHLYKLEV---------GAPYLRVDGKTGDIFTTETSIDREGL-------RECQNQLPG-DPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF----HQAPEVVRRLLRLDRNTGLITVQGPVDREDLST--LRFSVLAKDRGTNPKSARAQVV-VTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTG-TILSSLSFDREQQSTYTFQLKAVDGGVP 693          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHB2 (protocadherin beta 2 [Source:HGNC Symbol;Acc:HGNC:8687])

HSP 1 Score: 259.225 bits (661), Expect = 4.826e-72
Identity = 205/616 (33.28%), Postives = 320/616 (51.95%), Query Frame = 1
Query:  682 NKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE---IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV------KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP--KFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHP 2448
            ++Q+ ++    KLDRE LC          P  P    C+L FQ+  +   N ++  Q  + + DVND+SP FL+ +  + + E++  G    I+R Q  D  +      +I  +       +F+  L QD +      +L L + LDRE     +L +TA+DGGS P +GT +V I + DINDN P++    + V I ED P+   +  + A D D+G NG++ Y F    ++    +R  F L++ SGE+ ++QKLD+E +Q+  + +   A D G     S + VVF+ V+D+NDNPP +   +L    + +I EN+Q+   +A  SV+DPD+G  G + C I  D   F   S++N     Y+L    ++DRET   Y I I   DFG P L +   + ++V D NDN P F  T Y   + ENN    +IG V+ATD+D   N  V YSL    +      ++VSI+++ G L A +  D E    + F V A D G   LSS +LV + +LD ND++P   + LQ   +     +P  + PG  V +V A+D D G+NA ++Y L        FG+   +G++  R+A + RE+  ++  L V+  D G P
Sbjct:   80 DRQTGDLLLNEKLDREELC---------GPTEP----CVLPFQVLLE---NPLQFFQAELRIRDVNDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNF------HFHLNL-QDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAF----SQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQ--ATDGGG---LSGTCVVFVQVMDLNDNPPELTMSTL----INQIPENLQDTL-IAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVEN----FYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALQSLDYEALQAFEFRVGAADRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEV--RTARLLRERDAAKQRLVVLVKDNGEP 652          

HSP 2 Score: 126.331 bits (316), Expect = 1.023e-28
Identity = 139/505 (27.52%), Postives = 230/505 (45.54%), Query Frame = 1
Query: 1396 SGEIRVQQKLDYEYLQSPE---IRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQL---LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI---VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAI-DLDIGENAKITYHLQARFSQFGIDPISG-KIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            +G++ + +KLD E L  P    +    +  +N  +   +      + + D+ND+ P    + L K+ L KI E++            D D G     N  I  N +F L    SLD  +     L  + ++DRE      + +   D G P  + T ++ I V D NDN P F   LY+ +IPE++ +G  +  V+A D DI  NG + Y+ S  +E I     + + +G L   ++ D E+   Y+  + A D G   LS + +V++ ++D+ND+ P+  +    + IPE  N   T+  V ++ D D G+N ++   +Q     F    +     ++ S  +DRE  S Y + +  +D G P  + E  + + + DVNDN P F   +  +  + V  N  P   I  + A D D    T+ ++TY LLP        PQ       +L  I++  G LF +      S  YE     +  + A D GSP LSS+  + V V+
Sbjct:   83 TGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQAE-----LRIRDVNDHSP----VFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILP--QLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAFSQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQATDGG--GLSGTCVVFVQVMDLNDNPPELTMSTLINQIPE--NLQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAF---TQTSYTLFVRENNSPALHIGSVSATDRD--SGTNAQVTYSLLP--------PQDPHLPLASLVSINADNGHLFALQ-----SLDYEALQAFEFRVGAADRGSPALSSEALVRVLVL 554          

HSP 3 Score: 52.7582 bits (125), Expect = 5.104e-6
Identity = 72/242 (29.75%), Postives = 108/242 (44.63%), Query Frame = 1
Query: 2167 LTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS-----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            L I DVNDH+P F + +    IPE   PG T     A DLD+G N+   Y +   F      Q  +D I    ++ +  +DRE+     L + A DGG P   G  +V I + D+NDN P F   +    EV +  +      +A + A D D+   T+  I+Y             Q+   I +  F + +  G+L L  K    S      V+I+A D G   LS    + V+V+ D++D
Sbjct:  123 LRIRDVNDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEF---AKLLYEVQIPEDSPVGSQVAIVSARDLDI--GTNGEISYAF----------SQASEDIRKT-FRLSAKSGELLLRQKLDFESIQ-TYTVNIQATDGGG--LSGTCVVFVQVM-DLND 344          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHGB5 (protocadherin gamma subfamily B, 5 [Source:HGNC Symbol;Acc:HGNC:8712])

HSP 1 Score: 255.373 bits (651), Expect = 1.391e-70
Identity = 215/663 (32.43%), Postives = 330/663 (49.77%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTK----SIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAI-----VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL--------QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQA-RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
             R  I EE+P GS+V  +A+ +  S   + T K +V       S +  YF  + +S E+    +LDRE +C           K P    C L+F+  A+   N +    V +E+ED+ND++P F  +   + + E+ + G     +V+ DAD  L S +    S+    S + KE  +   Y +   L L K LDRE     +LV+TA+DGG  P +GT  + I +TD NDN P +  + + VS++E+VP    ++++ A D+D G N ++ Y F         R    F LNS SGEI  Q+KLD+E  ++ E  + V  +D G  +       V I + D NDN P +   SL    L  I EN      +A I ++D D+G+ GEVNC++  +  F+++S        Y L T  ++DRE    Y + I   D G P L+S+  + + + D NDN P+FH   Y   +PENN  G  I  V A+D D+  NG V YS ++S+ E +     VS+ + +G + A + FD E    +  T+ ARD G   LS++  + + + D ND+ P+             F  +P  + PG  V +V A+D D G NA ++YH LQA     F +   +G++    A  DR+  +R  L V   DGG P
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRV-------SSEKPYFTVSAESGELLVSSRLDREEIC----------GKKPA---CALEFEAVAE---NPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPE---LALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSF--------YRTGQIFSLNSKSGEITTQKKLDFE--ETKEYSMVVEGRDGGGLVAQ---CTVEINIQDENDNSPEVTFHSL----LEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDA-ARQRLLVAVRDGGQP 648          

HSP 2 Score: 132.494 bits (332), Expect = 1.129e-30
Identity = 152/552 (27.54%), Postives = 241/552 (43.66%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYL--QSPEIRLHVIA-KDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN---------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL-----PFPSVNY--PHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATA 2958
            + +F +++ SGE+ V  +LD E +  + P   L   A  +N     H     V + + DIND+ P     S       +I E+ Q   +       D D G       ++  N +F L+  +      Y  L    ++DRE    + +++   D G P L+ T  L I V D NDN P+F+  +Y+  + EN   G  +  V+ATD+D   N  + YS     + I S++S +G +T  K+ D E + +YS  V  RD G   L +   V + I D ND++P+         I E++ PG  +  ++  D D GEN ++   LQ          +  KII  S N         +DRE+   Y + + A+D G P       V ++I DVNDN PVF      +  V+V  N  P   IAQ+ A+D DL    + +++Y ++     P    +Y     QS +   Q  FD +    QL           ++E+ +  R  D GSP LS+   L V V     D+  +   +  P      +A+  +V   A
Sbjct:   72 KPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYH-----VNVEIEDINDHTPKFTQNSFE----LQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQ-IFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGG--GLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGE--------VPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFH---QASYLVSVPENNPPGASIAQVCASDLDL--GLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYE----QL----------RTFELTLQAR--DQGSPALSANVSLRVLV----GDRNDNAPRVLYPALGPDGSALFDMVPRAA 578          

HSP 3 Score: 83.9593 bits (206), Expect = 1.353e-15
Identity = 118/463 (25.49%), Postives = 201/463 (43.41%), Query Frame = 1
Query:  526 LFRQTIKEELPSGSLVLQIASP-------VEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIE--LEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKD--KLF-KIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVED 1869
            ++R +++E +P G+ VLQ+++         EI+ SF +T                + F  N +S EI T  KLD E      E K               ++ M  +  +    + Q  +E  ++D NDNSP          + EN   G  I   ++ D DS      + ++ G    K   +++   +  KL     LDRE    + + ITA D G  P + ++ V ++I D+NDN P +   ++ VS+ E+ P    I ++ A D D+G NG+V Y      + E   L ++  +++ SG +  Q+  DYE L++ E+ L   A+D G   + S +  + + V D NDN P +   +L  D   LF  +    +    V  +   D D+G    ++  +       L SL   L  G   T     DR+      +++   D G P L++T  L+++  D
Sbjct:  246 VYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRT---------------GQIFSLNSKSGEITTQKKLDFE------ETK---------------EYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSI-MASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQ--ARDQGSPAL-SANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLG--LRTGEVRTARALGDRDA-ARQRLLVAVRDGGQPPLSATATLHLVFAD 662          

HSP 4 Score: 66.2402 bits (160), Expect = 3.895e-10
Identity = 79/257 (30.74%), Postives = 113/257 (43.97%), Query Frame = 1
Query: 1909 QFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRE------TSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENA--KITYHLQARFSQFGIDPISGKIILRSA---NIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITY 2640
            ++RIPE    G  +G++ ATD            L  ++E    ++ + +G L  S   DRE       +    F  +A +  P +      V + I D+NDHTPKF    F   I E + PG       A D DIG N+  K    L   FS    +   G      A    +DRE+ S + L + A DGGHP   G T + I + D NDNPPVF   +     V++  N  P   + Q+ A D D  +  ++ ITY
Sbjct:   34 RYRIPEEMPKGSVVGNL-ATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAEN--PLNFYH---VNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVF---NRDVYRVSLRENVPPGTTVLQVSATDQD--EGINSEITY 279          
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Match: PCDHGB5 (protocadherin gamma subfamily B, 5 [Source:HGNC Symbol;Acc:HGNC:8712])

HSP 1 Score: 256.144 bits (653), Expect = 3.065e-70
Identity = 215/663 (32.43%), Postives = 330/663 (49.77%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTK----SIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAI-----VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQA-RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
             R  I EE+P GS+V  +A+ +  S   + T K +V       S +  YF  + +S E+    +LDRE +C           K P    C L+F+  A+   N +    V +E+ED+ND++P F  +   + + E+ + G     +V+ DAD  L S +    S+    S + KE  +   Y +   L L K LDRE     +LV+TA+DGG  P +GT  + I +TD NDN P +  + + VS++E+VP    ++++ A D+D G N ++ Y F         R    F LNS SGEI  Q+KLD+E  ++ E  + V  +D G  +       V I + D NDN P +   SL    L  I EN      +A I ++D D+G+ GEVNC++  +  F+++S        Y L T  ++DRE    Y + I   D G P L+S+  + + + D NDN P+FH   Y   +PENN  G  I  V A+D D+  NG V YS ++S+ E +     VS+ + +G + A + FD E    +  T+ ARD G   LS++  + + + D ND+ P+             F  +P  + PG  V +V A+D D G NA ++YH LQA     F +   +G++    A  DR+  +R  L V   DGG P
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRV-------SSEKPYFTVSAESGELLVSSRLDREEIC----------GKKPA---CALEFEAVAE---NPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPE---LALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSF--------YRTGQIFSLNSKSGEITTQKKLDFE--ETKEYSMVVEGRDGGGLVAQ---CTVEINIQDENDNSPEVTFHSL----LEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDA-ARQRLLVAVRDGGQP 648          

HSP 2 Score: 132.109 bits (331), Expect = 1.899e-30
Identity = 153/552 (27.72%), Postives = 241/552 (43.66%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYL--QSPEIRLHVIA-KDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN---------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL-----PFPSVNY--PHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATA 2958
            + +F +++ SGE+ V  +LD E +  + P   L   A  +N     H     V + + DIND+ P     S       +I E+ Q   +       D D G       ++  N +F L+  +      Y  L    ++DRE    + +++   D G P L+ T  L I V D NDN P+F+  +Y+  + EN   G  +  V+ATD+D   N  + YS     + I S++S +G +T  K+ D E + +YS  V  RD G   L +   V + I D ND++P+         I E++ PG  +  ++  D D GEN ++   LQ          +  KII  S N         +DRE+   Y + + A+D G P       V ++I DVNDN PVF   S     V+V  N  P   IAQ+ A+D DL    + +++Y ++     P    +Y     QS +   Q  FD +    QL           ++E+ +  R  D GSP LS+   L V V     D+  +   +  P      +A+  +V   A
Sbjct:   72 KPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYH-----VNVEIEDINDHTPKFTQNSFE----LQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQ-IFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGG--GLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGE--------VPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYL---VSVPENNPPGASIAQVCASDLDL--GLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYE----QL----------RTFELTLQAR--DQGSPALSANVSLRVLV----GDRNDNAPRVLYPALGPDGSALFDMVPRAA 578          

HSP 3 Score: 84.7297 bits (208), Expect = 8.604e-16
Identity = 118/463 (25.49%), Postives = 201/463 (43.41%), Query Frame = 1
Query:  526 LFRQTIKEELPSGSLVLQIASP-------VEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIE--LEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKD--KLFK-IKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVED 1869
            ++R +++E +P G+ VLQ+++         EI+ SF +T                + F  N +S EI T  KLD E      E K               ++ M  +  +    + Q  +E  ++D NDNSP          + EN   G  I   ++ D DS      + ++ G    K   +++   +  KL     LDRE    + + ITA D G  P + ++ V ++I D+NDN P +   ++ VS+ E+ P    I ++ A D D+G NG+V Y      + E   L ++  +++ SG +  Q+  DYE L++ E+ L   A+D G   + S +  + + V D NDN P +   +L  D   LF  +    +    V  +   D D+G    ++  +       L SL   L  G   T     DR+      +++   D G P L++T  L+++  D
Sbjct:  246 VYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRT---------------GQIFSLNSKSGEITTQKKLDFE------ETK---------------EYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSI-MASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQ--ARDQGSPAL-SANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLG--LRTGEVRTARALGDRDA-ARQRLLVAVRDGGQPPLSATATLHLVFAD 662          

HSP 4 Score: 65.0846 bits (157), Expect = 7.582e-10
Identity = 79/257 (30.74%), Postives = 113/257 (43.97%), Query Frame = 1
Query: 1909 QFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRE------TSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENA--KITYHLQARFSQFGIDPISGKIILRSA---NIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITY 2640
            ++RIPE    G  +G++ ATD            L  ++E    ++ + +G L  S   DRE       +    F  +A +  P +      V + I D+NDHTPKF    F   I E + PG       A D DIG N+  K    L   FS    +   G      A    +DRE+ S + L + A DGGHP   G T + I + D NDNPPVF   +     V++  N  P   + Q+ A D D  +  ++ ITY
Sbjct:   34 RYRIPEEMPKGSVVGNL-ATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAEN--PLNFYH---VNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVF---NRDVYRVSLRENVPPGTTVLQVSATDQD--EGINSEITY 279          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 178.718 bits (452), Expect = 8.607e-45
Identity = 167/538 (31.04%), Postives = 267/538 (49.63%), Query Frame = 1
Query: 1225 ENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLF-KIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQ-LLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMP-NHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQ 2823
            E +   + ED PI  +I  + A      ++  +YY   ++   ++SR +N F L+++SGEIR+ + +D E L   +  L V A +  +  I S ST V + V+D+ DN P  +     KD  F +I+E+      V S+   D D+G+ GE+   +   N + LL+++    K   + T   +DRET+    + +  +D G P   ST ++ I V D NDN P+F S  Y   I EN  +   I  V ATD+D   NG V YS+ SS+    ++ID +TG +T  +  D + S   +  + A+D     LSS+  + + ++D+NDH P     Q   ++ E+   G+ VG+V AID D G N  I Y ++     F ID  SG +I  +  +DRE  +RY LKV A D G PS    T + + ++D+NDN P F     K   V +S  +MP    I  ++A D+D     D +ITY +           ++   ++ ++ DI   G  L +  +       ++++V I A D G  Q
Sbjct:  168 EKYVKELPEDTPIETIIASVKASH---ASSQPLYY---SMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLD--KHILKVTAYERVDPTI-SASTTVVVHVLDVQDNSPIFE-----KDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAIN---AKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNS-PITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGS-EDFIIDEDSG-LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFD---KKEYNVTIS-EEMPRGSQIITLKAVDND----EDQKITYRI----------EEADREVF-SILDIGDQGAILSVSGELK--RQDHKVRVEISATDQGGLQ 664          

HSP 2 Score: 161.384 bits (407), Expect = 1.536e-39
Identity = 213/776 (27.45%), Postives = 353/776 (45.49%), Query Frame = 1
Query:  586 SPVE--ISSFMKTHKS-KVVEFSLLDSMDSK---YFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVD-GSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE---AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ-FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            +P+E  I+S   +H S + + +S++   DS+    F  +  S EI+    +DRE L                 D  IL+     + D        V++ + DV DNSP F        ++E+  +G  +      D DS       IE   G   GK           ++      LDRE +   +L + A D G+     T +V I + D+NDN P + +++++V+I E++ I  +I  + A D+D G NGKV+Y   +      S       ++  +GE+ +++++D +   SP I   + AKD  +  + S +  + I VIDIND+ P +    ++  K+  ++ENV   ++V  +   D D+G  G +   ++     ++  D+ L K   L     +DRET   Y + +   D G PSL ++  + ++++D NDN P F    Y   I E    G  I  + A D D  E+  + Y +        +I+ I      L+ S E  R+   K    + A D G   L    +V + I DVN   P F    F   IPE S  G  V  ++A D D G+NA+I Y + +  SQ F IDP SG I + S+++DRE  + + + V ASD   P     T + + ++D+NDN P F   +S +    +S +        Q+ A D+D+             P   V+Y   +S  S    LF +D   G L + +K     ++  I + I A D G+P LS+ + + +  +SD++D
Sbjct:  178 TPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVL-----------------DKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSG--ENGEIEYSLGEGNGKNLLAINAKSGVIQT--AAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMAS------SSGIGGLTIDYSTGEVTLRERIDAK--NSP-ITAVIRAKDGAQPALSS-TVPLTINVIDINDHAPTL----IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGLIKTTKL-----LDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQG--GLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISV-SSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIG------------PNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAV-IVLPIFARDRGTPSLSAASEITL-TLSDVND 887          

HSP 3 Score: 121.324 bits (303), Expect = 2.775e-27
Identity = 156/618 (25.24%), Postives = 263/618 (42.56%), Query Frame = 1
Query:  631 VVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGS-----LTASKEFDRET-SDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
            ++++S+  S D   F  ++ S  IKT   LDRE+              +    L +    M   + N +  I  VL   +D+NDN+P+F   +  + + E +  G +I   +  D D     T  IE       +E F+     DQ  +  +    +      ++ I+A D G       + V I+  +     P +    FSV I E  PI + +I L AED D G+N ++ Y  ++           FF ++  SG+I V   LD E        + V A D+    +++ ST + + + DINDN P   + S +      I E++        +S  D D G  G V    N    + + QL  LD   T G +L   + +DRE     ++ I   D G PSL++   + + + D NDN P F    Y   I EN+ +G  +G + A D D  +N  + + +   A+A +  I+ +        +    EFD E  ++K+ F + A       LSS+  V + + DVND+ P   +     +  ++    + +G + A D D  +NA + Y L+        +  +GKI+++        +S    K   SDG +
Sbjct:  513 IIKYSMEGSED---FIIDEDSGLIKTTKLLDRET--------------TARYSLKVTARDMGTPSLNTSTTIAVVL---KDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE----EADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS---APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---------SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNT-STQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR--TSG-TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEEN-DLIEAEKYTGKILVKQEWKRNMDVS---FKTCVSDGAN 1075          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 153.68 bits (387), Expect = 3.958e-37
Identity = 148/500 (29.60%), Postives = 242/500 (48.40%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRL--RNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP-NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL----SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL 2319
            + + I + D+ND++P+ + +Q  I ++ENV +G E+ R    D DS         ++GS       +  + +D   +   K LDRE    + L +TA D G+     +  + + + DINDN P +  + ++V+I E++P    II L A D D   + K+ Y  E    E  S L   +   + S+SGE++ Q           ++R+ + A D G         VV + + D+N  P  N    S+      KI E+      V ++   D D G    +   ID+  F  +   +P +   S+++   +DRE   ++ +I+  +D   P L ++  + ++++D NDN P F S+ Y   I E+  +G     V+A D DI  NG V Y L    SS +  +  +D  +G+L  S + DRE        + ARD G   LS++S + LT+ DVND+ P FE L Y   I E+S  G TVG + A D D G+NA I++ +
Sbjct:  104 VPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSE------DFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDH---------KVRVEISATDQGG---LQGRCVVNVFIDDVNSAPYFNDHPFSV------KIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQFFRI---DPSSGDISVSS--DLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRI 572          

HSP 2 Score: 144.821 bits (364), Expect = 1.923e-34
Identity = 181/691 (26.19%), Postives = 312/691 (45.15%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKL-GEIQRFQVSDADSKLFST--KSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDN----FKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ-----FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVH--IRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            V I + DVNDN+P F +    + + EN+ +   I   + +D D   F T  K      S  G           +V L       RE +D        VI A DG     + T+ + IN+ DIND+ P  I     ++++E+V I   + ++ A D+D G NG + Y  E   +         F+++  SG I+  + LD E   +    L V A+D G   +++ ST + + + DINDN P        K+    I E +    Q+ ++   D D  +  ++   I+  + ++ S+ +   +G  L+    + R+     + I   +  G   L    V+N+ ++D N + P F+   +  +IPE++ +G  +  + A D D  +N  ++YS+ S+      ID ++G ++ S + DRE    +S  V A D+    L++S+ + + + D+ND++P+F    Y  +I ED   G +  QV AID DIG N  + Y L    S      F +D  SG + + S+ +DRE+ +   L + A D G PS    + + + + DVNDN P F+     + ++ ++ N      +  I A D+D     D  I++ +                    LFDI+    Q  ++       + YE K +     +   S QLSS   + + V SD++D K
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGTNGKVHYSMASSSGIGGLTIDYSTGEVTL-------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---------FIIDEDSGLIKTTKLLDRE--TTARYSLKVTARDMGTPSLNT-STTIAVVLKDINDNAPTFD----KKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS--QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRV-SSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFE---QLSYDLYIAENSPVGSTVGTIVARDADEGDNAD--ISFRIFGGADA-------------KLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQLSSTVPVRIHV-SDVNDNK 638          

HSP 3 Score: 120.553 bits (301), Expect = 5.324e-27
Identity = 155/618 (25.08%), Postives = 265/618 (42.88%), Query Frame = 1
Query:  631 VVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID----NKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGS-----LTASKEFDRET-SDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
            ++++S+  S D   F  ++ S  IKT   LDRE+              +    L +    M   + N +  I  VL   +D+NDN+P+F   +  + + E +  G +I   +  D D     T  IE       +E F+     DQ  +  +    +      ++ I+A D G       + V I+  +     P +    FSV I E  PI + +I L AED D G+N ++ Y  ++           FF ++  SG+I V   LD E        + V A D+    +++ ST + + + DINDN P   + S +      I E++        +S  D D G  G V+  ++    + + QL  LD   T G +L   + +DRE     ++ I   D G PSL++   + + + D NDN P F    Y   I EN+ +G  +G + A D D  +N  + + +   A+A +  I+ +        +    EFD E  ++K+ F + A       LSS+  V + + DVND+ P   +     +  ++    + +G + A D D  +NA + Y L+        +  +GKI+++        +S    K   SDG +
Sbjct:  154 IIKYSMEGSED---FIIDEDSGLIKTTKLLDRET--------------TARYSLKVTARDMGTPSLNTSTTIAVVL---KDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIE----EADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFIDDVNS---APYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS---------SQFFRIDPSSGDISVSSDLDRE--DRATFSVIVTASDHASPPLNT-STQIEVILDDINDNSPQFTSSSYAA----TISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDR--TSG-TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG---QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD--QNATLEYFLEEN-DLIEAEKYTGKILVKQEWKRNMDVS---FKTCVSDGAN 716          

HSP 4 Score: 116.701 bits (291), Expect = 7.396e-26
Identity = 134/464 (28.88%), Postives = 224/464 (48.28%), Query Frame = 1
Query: 1513 VVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS---LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQFGIDPIS--GKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            +V ITV+D+NDN P   + S +      I EN+     +A++   D D G  G+V+  + +      S    LT  YS   +T    ID +       +I+  D   P+L+ST  L I V D ND+ P   +      + EN  +G+ +G V A D+D   NG + YS+  + + I  ID ++G +  +K  DRET+ +YS  V ARD G   L++S+ + + + D+ND+ P F+  +Y  +I E+   G  +  ++A+D D  E+ KITY + +A    F I  I   G I+  S  + R+   +  +++ A+D G    QG  +VN+ I+DVN  P     P S    V +  +    + +  ++A D D  +  + RI Y      S++              F ID   G + +   +++    ++S    V + A DH SP L++ T + V ++ DI+D
Sbjct:    1 MVEITVVDVNDNAPVFASDSYN----VTILENITIPAVIATVKATDEDFGTNGKVHYSMASS-----SGIGGLTIDYSTGEVTLRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFI--IDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQD-HKVRVEISATDQG--GLQGRCVVNVFIDDVNSAPYFNDHPFS----VKIPEHSPIGYPVITLKAEDHD--RGDNARIVY------SID----------SSQFFRIDPSSGDISVSSDLDREDRATFS----VIVTASDHASPPLNTSTQIEV-ILDDIND 420          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 139.813 bits (351), Expect = 7.457e-33
Identity = 154/553 (27.85%), Postives = 246/553 (44.48%), Query Frame = 1
Query:  805 FQMTAKADNNNVEIIQVLI--ELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAK-DNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            +Q T  A N N E    LI   L+DVNDN P F  ++  + V+E  K  E +     SD DS  F   S      H+  E  +  +     +++  K L R     F LV++A DGG   +  +  ++I + D +   P++    + +   ED+     I         VG   KV Y   +   +        F ++  +G+I V + LD +   +  + L++ A   +GE    S  T V I + D NDNPP   + SL +     I+E+++  +    +  +D D  K GEV   I + +    + +D    +   L+T + +D E   +Y + +K  D G P  +S   L I V D NDN P F  + Y   + EN+     +G V A DKD  ENG ++Y +++ +E    ID   G++   +  DRE       +++A D G    SS++   +++LDVND+ P         +P  S     +G + A+D D G N  + Y  Q + S F +       + R  N   E+  R  L VI SD G P
Sbjct:  609 YQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSY-----HILSESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAI-------GSVGAMSKVKYSIYSGDQDHN------FSIDEDTGKIYVTRYLDADVHDT--VLLNIQATLPSGE----SNQTQVVIFIEDHNDNPPQFSS-SLVE---ISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQ---LSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYF-GIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSNGDVYLRRQLNASDERHQR--LSVIVSDQGVP 1124          

HSP 2 Score: 138.272 bits (347), Expect = 1.991e-32
Identity = 166/608 (27.30%), Postives = 257/608 (42.27%), Query Frame = 1
Query:  652 DSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEY-FNARLYQDQVKLYLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDP--DT-----GKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDG 2439
            D   SK+   +++S EI T+  LD E                        +F + A     + E I +L+E++D NDN+PSF +    + + E  +LG       V+D D   F      +   +V   +   +R   +Q++  L+    LDRE  D ++L+I A DGG     G L  +I I D NDN P +    ++ S+  ++ I   +I + A D D+G N ++ Y+ +       S   NF +  S SG I     L    L +    + V+A D+G   + S S VV ITV+    + P +  I L +     + EN      VA +S+     DT     G       + D  +  LL L   L +  +   H     E  G  II         P L       + + D NDN P +HS+  Q  I  N   G     + A D D+ +NG + YS+      +VSID  TG +      D     +  F V A D G   LS+   V   +LD     P+FE   +   IPED+  G  + +V A +   G + +I Y LQ +     +D +SG + ++    D EK   Y+  VIA++ 
Sbjct:   62 DEQTSKFLKVDERSGEISTIAHLDYEKRS---------------------KFDIVAVKVEESGETIDILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNS---NFAI--SQSGVITTTASL----LPASTHDVIVVASDHGSPSLSS-SAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIII-------EHPQL-------LTIGDINDNAPQWHSS--QIHISLNRTQGGS-RTLTAKDPDLGQNGWIRYSVLDT--ELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQK-TFDFEKQKSYQTTVIATNA 618          

HSP 3 Score: 94.3597 bits (233), Expect = 4.614e-19
Identity = 137/554 (24.73%), Postives = 217/554 (39.17%), Query Frame = 1
Query: 1375 FFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNI--QAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN----FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIY-----SLSSNAEAIVS---IDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGG-----HPSFQ--GETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIW---TPEKKSHWTAIISLVV 2949
            F  ++  SGEI     LDYE     +I + V  +++GE I       + + V D NDN P+   Q + L      +I E  Q     A  +V D D  K       I   N    F+L S          L  +  +DRE    Y ++I+  D G P+       +I + D NDN P+F  + Y   +  N  +G ++  V ATD DI EN  + Y     S  SN+   +S   + + T SL  +   D          V+A D+G   LSSS++V +T+L     +P  ++ +        + E+S  G  V +V         + K+     +       D     ++L    +DRE  S + LK +    G     HP     G+   N               P   ++++++S N+        + A D DL Q  +  I Y +L                   L  ID   G++F+ N    C+   EIK  +RA D GSP LS+   ++  ++   S        +W    PE     T ++ +V 
Sbjct:   68 FLKVDERSGEISTIAHLDYEKRSKFDI-VAVKVEESGETID------ILVEVDDENDNAPSFADQVVKL------EISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD--------VIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQ--YRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIGDINDNA--------------PQWHSSQIHISLNRTQGGS-RTLTAKDPDLGQ--NGWIRYSVLD----------------TELVSIDKETGRIFVPNTI-DCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVA 564          

HSP 4 Score: 89.7373 bits (221), Expect = 1.293e-17
Identity = 100/431 (23.20%), Postives = 192/431 (44.55%), Query Frame = 1
Query: 1222 TENFSVSIKEDVPINHLIIKLLAEDK----------DVGNNGKVYYEFENIRNEEESRLR---------NFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-FQLLSLDNPLTKGYSLTTHN--SIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVE--DENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARD-NGPSHLSSSSLVYLTIL--DVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIA 2430
            T+N   S    VP++ +I +    DK          +V  N K+  +  N+  EE                F ++   G + V   +D E   + E ++ +   DN       +     + V+D NDN P   +++        +K+++ + Q++  I  +D D+G+ G V+  I + N   +++L NP T    L   N   +D     ++ I+++  D G P+  +   + + ++    + + P F   +Y+  + E+  +G  +  + A+++    N  ++YSL  + +  + ID  TG LT     D E+    S  +   D NG      S++V L I+   V++  P F +  Y   IP  +  G++VGQ++AID D G +  + Y +  R S   I+  +G I L+   + R  ++  ++ V+A
Sbjct: 2103 TDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKF-GRLFVAGPIDREQRATHEFQVEI---DNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAY----YLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTL-NPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEH-QGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG-----RSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVA 2518          

HSP 5 Score: 86.6557 bits (213), Expect = 1.160e-16
Identity = 124/468 (26.50%), Postives = 209/468 (44.66%), Query Frame = 1
Query: 1090 LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAIS----LSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV----SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTIL--DVNDHTPKFELQYFFSI--PEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSF 2454
            LDRE      L+I   DGGS  ++ T+ V +   + N  Q    T +  + I E   +  ++ +  A D D+G NGK  + FE + +   S       L   +G++ +++      LQS +I+L V+         H +  +     ++I++  P  +A +    L +  L  I E +   Q +A +    P+    G     ++       S+D   ++G  + T+  +DRE +  Y   +K    G      TRV ++ V + NDN P F  +  + R+PEN  +G Y+  V A  KD++    + Y L S++        +ID  TG++  +   D E   +++ T+ A D      S  +   LTI   D+ND+ P F    + +   P   +PG+   ++EA DLD      +TY L Q   S F + P SG + ++      E   RY + V A+D G PSF
Sbjct: 1687 LDREASQEHLLIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPS-ELEIAESSRVGDVLHRFRASDMDIGQNGK--FSFELLEDSSGS-----LDLVPETGDLVLRR---LSSLQSWKIKLRVVD--------HGVPGLYVEKNLEISNRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQ---PEL--AGLTYSIVEGNIDSAFSVD---SEGV-IRTNLELDREILERY--SLKVIGTGSGQQIGTRV-DVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGA--KDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDG-----SFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGALFMKVLPPAGE---RYLVTVTATDNGVPSF 2110          

HSP 6 Score: 83.1889 bits (204), Expect = 1.122e-15
Identity = 135/556 (24.28%), Postives = 235/556 (42.27%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNP--NTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEI--RVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASIS----------VNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHN---SIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASK----EFDRETSDKYSFTVIARDNG-PSHLSSSSL-VYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDG 2439
            +V + + ++NDN PSF  S+    V EN+++G  +      D D+       +  D S     +FN   +   +  +L   LD E++    L I A DG  +   N    + +IN      ++P + T     +     P   +      E  D+   G + Y      +       + F +   SG +  +V       YL      + V A DNG   + S ST V ++VI I +  P  +      +  F++ EN +   Q+ ++S          + DP+  K   ++       F  L +  P+ +     TH     ID E + S  +  KC+              ++V DENDN P+F S  Y   + ++   GQ IG + A+D+D  ENG V Y  LS N   IV+++ +TGS+  ++    + D   +  +   V ARD+G P+  +   + V L +   +   P F L  Y   + ED++ G  + ++ A +     N  + Y L+    + GID  +G++ L++ ++D E      + +  SDG
Sbjct: 1912 RVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTI--HLTAPLDFEVLPEHTLTIKATDGSFDTFTNLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKI------EAHDLDARGALTYSLGQGSS-------SIFRVAPESGALFMKVLPPAGERYL------VTVTATDNG---VPSFSTSVPVSVI-IGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSID------KFGRLFVAGPIDR-EQRATHEFQVEIDNEMMTSQKVQCKCH--------------VIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKT-HLDWESEPIISMYLSVSDG 2419          

HSP 7 Score: 78.5666 bits (192), Expect = 3.386e-14
Identity = 163/689 (23.66%), Postives = 282/689 (40.93%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSF-LNSQDTIYVKENVKLGEI-QRFQVSDADS--------KLFSTKSIEVDGSHVGKEYFNARLYQDQ---VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPD----------TGKGGEVNCEIDNKNFQ-LLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRI-PENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVN-DHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSS 2832
            V + + D NDN P    ++   + + E+ ++G++  RF+ SD D         +L    S  +D      +    RL   Q   +KL ++ H    L     L I+      NP T                 +++ + +  +I E +P    I KL  E       G  Y   E         + + F ++S  G IR   +LD E L+     L VI   +G++I     T V + V ++NDN P     S    K  ++ EN++    VA++   D D          +   G+     +   F   + L  PL            D E +  + + IK  D  F + T+   L I V D NDN P F   LYQ  + P     GQ    + A   D++  G + YSL   + +I  +   +G+L    +      ++Y  TV A DNG    S+S  V + I +      P FE  ++ F + E+S  G  +G     +L   E+ +  Y +Q   +   F ID   G++ + +  IDRE+ + +E +V   +    S + +   ++ + D NDN PVF   +S    +++  +      I QI A+D D     + R++Y +L    +N       +++  +   I  +      +++FP  ++    ++ + A DHG P  ++
Sbjct: 1713 VRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGLYVEKNLEIS----NRNPQT-----------EAKAPLEFLKQTYLSTIDEGLPRGQFIAKLQPELA-----GLTYSIVEG-------NIDSAFSVDS-EGVIRTNLELDREILE--RYSLKVIGTGSGQQI----GTRVDVRVNNLNDNVP-----SFPMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPL------------DFEVLPEHTLTIKATDGSFDTFTN---LTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEA--HDLDARGALTYSLGQGSSSIFRVAPESGALFM--KVLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIG-----NLSGEESREFHYRIQDPEASKIFSIDKF-GRLFV-AGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVF---TSVAYYLSLKDSMAHGQKIGQIMASDQD--SGENGRVSYRILSGNDLNI------VTLNPDTGSIQLNEWNDAQLDEFPNATW----QILVEARDHGHPARAA 2321          

HSP 8 Score: 59.3066 bits (142), Expect = 2.025e-8
Identity = 80/339 (23.60%), Postives = 140/339 (41.30%), Query Frame = 1
Query: 1882 YPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYH----LQA------RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCN-QMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            +P F   L +F +PE+  +G  IG ++   ++     + +          + +D  +G ++     D E   K+    +  +     +     + + + D ND+ P F  Q     I E +  G +       D   G+  K   H    LQ       + +   ++      ++ +  +DRE   +YEL + A DGG P+  G+   +I I D NDN PVF   S      +VS N  + +HLI  ++A D+D+ +  ++RI+Y +             + S   N  F I   G      +  P  ++     V + A DHGSP LSS   + + V+
Sbjct:   19 FPTFCQCLTKFTVPESAQIGTRIGWISGKREESAAPKYFVVFPDEQTSKFLKVDERSGEISTIAHLDYEKRSKFDIVAVKVEESGETID----ILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTD---GDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLIT-VQATDADIGE--NSRISYDI------------KKTSAPSNSNFAISQSGVITTTASLLPASTHD----VIVVASDHGSPSLSSSAVVTITVL 328          

HSP 9 Score: 52.373 bits (124), Expect = 2.638e-6
Identity = 40/143 (27.97%), Postives = 69/143 (48.25%), Query Frame = 1
Query: 2035 SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQY--FFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSF 2454
            SI+S TGS++     DRE S ++   +I  D G  +   S  V +T+ D ND+ P+ +        I E S  G  + +  A D+DIG+N K ++  L+       + P +G ++LR  +     +  +++K+   D G P  
Sbjct: 1674 SINSTTGSISV-LPLDREASQEHLLIIILTDGGSRN--DSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVLRRLS----SLQSWKIKLRVVDHGVPGL 1809          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 130.954 bits (328), Expect = 4.001e-30
Identity = 105/375 (28.00%), Postives = 186/375 (49.60%), Query Frame = 1
Query: 1372 NFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNI--QAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPI------SGKIILRSANIDREKISRYELKVIASDGGHPSFQGET 2466
            N F++N  +G ++V++    +Y ++ ++  H +   +  E+   + TVV   + ++NDN P I  + + +S D+     E+ +  Q +  I   D D     E+   + +    L  +D+    G  +T    +D E +G + + +  +D  F    +  V  I   D+NDN P F  + Y  ++ E+  +G  + H  A+  D  +N  + Y L  S+  + V++++ TG LT +K  D ET      TV+A+D+G   L + + V ++++D ND+ PKFE + Y   + E+S  G+ V  V+A+D+D      ++Y L+         P+      S   +L S +ID EKI +Y LKVIA DGG P  + E 
Sbjct: 2952 NVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKELITVV---IENLNDNRPKIIEKLLKVSIDENLPTSEDAR--QYITRIVAEDADFD---EIKFRMVDDFGGLFQIDD--INGV-VTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVI---DQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD--QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEA 3310          

HSP 2 Score: 120.939 bits (302), Expect = 4.044e-27
Identity = 117/435 (26.90%), Postives = 204/435 (46.90%), Query Frame = 1
Query: 1231 FSVSIKEDVPI-----NHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQ-------------KLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNC---EIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCN--DFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE--AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN--IDREKISRYELKVIASDGGHP 2448
            FS       PI       +++K+ A D+D G NGK+ Y+F +    E         +N+ +GEI + +              +D     S    L+++   NG +I      ++      I ++      +  S  ++ ++ E+      VA +  ND DTG  G +     +I   + ++L++D    +    +  + + +E +    + +K +  D G P  +S + + + ++D N++ P F    Y  RI EN   G+ I  V A D D   NG + +SL +N E  +++SID+ TG +   K  DRE  D ++F +IA D G P  +S ++L  +++ DVND+ PK  +Q+  + IPED   G  V  + A D DIG+N+K+ + L +    F ID  SG I + +    +D  K   + L +  +D G P
Sbjct:  492 FSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLE---------INANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPII------IQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLT-ISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDP 910          

HSP 3 Score: 111.309 bits (277), Expect = 3.932e-24
Identity = 148/562 (26.33%), Postives = 257/562 (45.73%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLY----------LIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQ-KLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCE------IDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCND-----FGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPEN---NVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTAS--KEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQ 2457
            + ++DVN++SP F      + + EN K G+            +F   + + DG + GK  F+    Q++  +           L+K LDRE  D     I A D G         + I++ D+NDN PK + ++    I ED+P    +  + A D+D+G N K+ +    + N E+   R    ++  SG I +   +   +Y ++P   L +   D+G+ I+ S S  + + ++DI  N   I+   ++K+    + EN +   +V  I +   +TG   +V  E      I    +   S+D    KG   TTH  +DRET  +Y I ++  D     +  P       + I + D ND+ P+    +Y   + EN   NV+   +   +A D D +    +++ +   + ++   ID  +G +T S  +  DRE   ++   V   D G   L S+ +V + +LD ND++P F +  + +S+   S     + ++ A+D D GENA++TY++    ++F ID  +G II   A    E    Y L V A+D G P  Q
Sbjct:  708 LRIKDVNNHSPQFDEVSYYLRISENEKPGK-----------DIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF----LLNSEKVPFR----IDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPIL-STSCHLHVELVDIAHNHLAIEFDDVAKEA--SVYENSEIGTEV--IMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQ---KGTVRTTH-LLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV--RSKFAGKLCRIFAVDADEGENARLTYNITEGDARFSIDN-NGNIIASEAIHGDES---YALTVQATDHGTPGQQ 1235          

HSP 4 Score: 104.76 bits (260), Expect = 3.872e-22
Identity = 115/420 (27.38%), Postives = 195/420 (46.43%), Query Frame = 1
Query: 1237 VSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQ---QKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDN--KNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI-VSIDSNTGSL---TASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF---FSIPEDSNPGKTVGQVEAIDLDIGENAKI-TYHLQAR------FSQFGIDPISGKIILRSAN-IDREKISRYELKVIASD 2436
            V + ED PI  ++ KL A D+D G NG + Y   +I       L     ++  SGEI V     KL  E L+  +++L V A D G  +  S+ T+  + + D+N++ P    +S       +I EN +  + +  ++ ND D G  G++   + N  +   ++S+D    K   +    S+DRE    +   I  +D GFP   S   L I VED NDN P       + RIPE+   G ++  + A D+DI +N  + + L  N+E +   ID ++G +         D   +  ++ ++   D+G   LS+S  +++ ++D+  +    E        S+ E+S  G  V  +EA   + G+  K+   +L+ R      +  F ID    K  +R+ + +DRE  S Y + V A D
Sbjct:  615 VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVL----TVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMK-LRIKDVNNHSPQFDEVSY----YLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISID---AKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL--NSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEA--KETGDEQKVKAENLEYRIIGGDGWPHFSIDQ---KGTVRTTHLLDRETKSAYWITVEARD 1015          

HSP 5 Score: 102.449 bits (254), Expect = 1.797e-21
Identity = 121/458 (26.42%), Postives = 205/458 (44.76%), Query Frame = 1
Query:  799 LQFQMTAKADNNNV--EIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-----IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDK-LFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPL------TKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTG-SLTASKEFDRETSDKYSFTVIARD 2127
            L+F      DN+ V  E+I V+IE  ++NDN P  +     + + EN+   E     I R    DAD      + ++  G     +  N         + ++K LD E++  F L + A DG        L+  I+  D     P +    +S+ + E   I + +    A   D     + Y +         S + +F  LN+ +G + + + LD+E L +  ++L V+AKD+G   + + + V  I+V+D NDN P  +     K+K + K+KEN ++ ++V ++   D D+   G V+ E++       + D P+      + G  L +  SID E I  Y + +   D G P L S  +L I VEDEND+ P F        + E   +G  +   + +D D  +NG   +++    +   S   N    L  +K+ +    DKY  TVIA+D
Sbjct: 2979 LEFHRLTIQDNSEVCKELITVVIE--NLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDING-------VVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNA---PTFEKSTYSMKVMESESIGYELAHFRASGGDQNETIEYYLK--------PSDVTSFVNLNAQTGILTLAKPLDFETLSA--LKLTVVAKDSGVPPLETEAQVE-ISVMDENDNAPKFE-----KEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEI--VSETTTDTPVLPFAINSNGDVLISQ-SIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNG-APFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 6 Score: 98.5969 bits (244), Expect = 2.739e-20
Identity = 111/422 (26.30%), Postives = 189/422 (44.79%), Query Frame = 1
Query: 1396 SGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV--SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQY-FFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLP 2652
            +G I V + L+Y   +  +I L V+    G     +++    ++VIDIND PP       S      I E+ +    V  +S  D D     E +  +D    Q  S+ +P  +  ++T    ++ +   +  + IK  D   P   +T  + + +  E+   P F ++ Y F + E+  +G  IG V   + +I+E    I   S  +++ +  S++ +TG +      DRE  +++  T+ A   G  H  + + V + I DVND+ P F   Y  F+I ED+  G +V    A+D D   + +I + L      F ++  SG + + S  +DREKI  Y+L   A+D G   F  +    I + DVND+PP F+       E N+  +      I      D DLS    N ++   +P
Sbjct: 2456 TGRIHVSRVLNYHRDKRYQIPL-VVEDATGRRAFSTLT----LSVIDINDKPPFFVLPFYST----SISESAKEGDTVMMVSATDDDENDTIEYSL-LDGSESQFFSV-HP--RQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVH--AITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVAS-QLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFE-----KEEFNIDLHLPSTSPILHFSIKDDDLSP---NNVSQFFIP 2851          

HSP 7 Score: 72.0182 bits (175), Expect = 3.647e-12
Identity = 86/349 (24.64%), Postives = 149/349 (42.69%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDK-LFKIKEN--VQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN------PLTKGYS---LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF 2220
            P ++   +S SI E       ++ + A D D   N  + Y   ++ +  ES+   FF ++   G I V +KL  E+     + L + A D+     H+ +TV      ++N    +++    S    LF + E+  V NV             G+  ++  EID   F ++          P +   S   +   +S+DRE    + + I+ +  G     +T  ++I   D NDN P FH    +F I E+  +G  +   +A D+D   +G + +SL         ++ N+G LT + + DRE  D Y     A D G    ++     + + DVND  P+FE + F
Sbjct: 2503 PFFVLPFYSTSISESAKEGDTVMMVSATDDD--ENDTIEY---SLLDGSESQ---FFSVHPRQGTITVAKKL--EHKAGVTLSLTIKATDSANPPHHATTTV------EVNIASESVKVPRFSNSHYLFSVMEDADVGNV------------IGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVDI--GDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEE-NPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEG--GFNTDLPFTIVVSDVNDSPPQFEKEEF 2818          

HSP 8 Score: 70.8626 bits (172), Expect = 6.744e-12
Identity = 59/202 (29.21%), Postives = 96/202 (47.52%), Query Frame = 1
Query: 1873 NDNYPIFHSTLYQFRIPENNVLGQYIGH-------VNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG--PSHLSSSSLVYLTILDVNDHTPKF---ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDG 2439
            N + PIF   +Y+  I EN   G  +         V+A D+D   NG V Y  LS   E + S+D  +G++     FD E   +YSF V A D G  P      SL+ +T++D ND  P+F    L     +P  +  G +VG   A D+D      + Y ++ +   F +D  +G ++++ +N   +    ++L+V  +DG
Sbjct: 1664 NQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILP--TANGVSVGGQTAQDMD--SVGSLRYFIKDQSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTDG 1861          

HSP 9 Score: 64.6994 bits (156), Expect = 4.901e-10
Identity = 82/341 (24.05%), Postives = 151/341 (44.28%), Query Frame = 1
Query: 1393 LSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNP---PNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTH---NSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDE-NDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIG-----ENAKITYHL-QARFSQFGIDPISGKIIL 2373
            + G++ + +KL     +  E    +IAKDNG   +H +   V I V+D    P    N+    +SK+     K++   V+ +A  S+     G  G          +++L   +P +  + LT     N++      +Y   ++  +   P + +   + I+V+     + P+F    Y    PE+  +GQ +  + AT  D  EN  + YSLS + +  + I   TG +T + + D E + KY   ++A  +G   +SS +   + I DVND  P+F        I + +  G+ +  + A D+D       E+ K+ Y +     + F I P +G++ L
Sbjct: 2030 VGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGS--VHRVEEPVKIRVVD-KARPVFSQNVYTAVISKES---TKKSTVLVKVMAKSSLQSKSKGLIG----------YRILDKKSPFSVDF-LTGEVRLNNLKMLAETNYTFEVEAREVTRPKMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPESTSIGQRLLTIKATTSD--ENDTIEYSLSGSKD--IEIHPETGDVTITGQLDYEKTQKYDLKLVATSSG-KQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSL 2348          

HSP 10 Score: 62.3882 bits (150), Expect = 2.945e-9
Identity = 107/440 (24.32%), Postives = 185/440 (42.05%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIK-------LLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSI-STVVFITVIDINDNPPNIQAISLSKDKLFKIKENV-------QNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN----PLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVL--GQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASK-EFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPED-----SNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIIL--RSANIDREKISRYELKVIASDGG 2442
            P +  + +  +I+E++P    ++        + A D+D G+NG V Y   + ++E+       F ++  SG IR Q   D+E ++  E   +V A D G+    S+  +++ +TVID ND PP   + SL    +      V       Q++  V S+     D      V   +D+K   +L  D+     +TK + L    + D +   SY++ I                   +  EN  +  F    Y   + EN  L  G  I  V      ++      +S+ +  EA   I   TG +++S    DRE S      V A+ +  + + + +LV + I ++ND TP      F   P D     S+ G  V + + ID D G+   I+      +  F I  + GK++L  +  +I+ E +  +  K+IA D G
Sbjct: 1668 PIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQ------MFSVDQYSGAIRTQMSFDFEKMK--EYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQS----VPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVT-DGKQSASYVMKIST-----------------ISTENSKFK-FTRNEYHTSLIENTTLPPGSIILSVATIGDKLDH-----FSIVNPHEAFF-IHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETP-----IFMGTPYDITIGHSDIGTVVLEPKVIDNDEGDVVTISSENMPEY--FKI--VGGKVVLGKKLPSIEEEDL-EFNFKLIAKDNG 2060          

HSP 11 Score: 61.6178 bits (148), Expect = 4.523e-9
Identity = 66/249 (26.51%), Postives = 112/249 (44.98%), Query Frame = 1
Query: 1729 LTKGYSLTTH-NSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKF----------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDG 2439
            LT GY  T+    +DRE    + + +   D G P L S  ++ + V DENDN P F   ++ + +   +     +  + A D D  EN  + Y++ +  +A  SID+N G++ AS+    + S  Y+ TV A D+G P    +++ V LT         K           +  Y   I +    G TVG++EA D D G+    +       S F +   +G+++L +  ++  K     L +  +DG
Sbjct: 1101 LTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSV--RSKFAGKLCRIFAVDADEGENARLTYNI-TEGDARFSIDNN-GNIIASEAIHGDES--YALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDAD-GDELWWSISSGDPDSVFDVRQDTGQLLL-AKKVELLKRGELRLNISVTDG 1341          

HSP 12 Score: 57.7658 bits (138), Expect = 6.859e-8
Identity = 97/413 (23.49%), Postives = 167/413 (40.44%), Query Frame = 1
Query: 1225 ENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLD---YEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASI-----SVNDPDTGKGG-------EVNCEI----DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGF---PSLTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS------SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIP-EDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIIL 2373
            + +   I +D+     ++++ A D D+G N  +Y+   N  ++        F++  ++G +R  + +    Y      E R   +   +  E+  S +  V ITV +    P  I           KI  N+ N +Q+A+I     S ND   G  G       EV  E+      K  + +       K  S    N+    TIG   I  + + F     P + +   + I +E   ++   F  +     +  E   +G+ +  +N   ++ ++   + YSL        NA    +I S  G L  S + +R +   Y+F VIA  +G +   +   V + ILD NDH P F  ++    P     PG  + +V+A D D GEN KI Y   +      I+  +G+I L
Sbjct:  158 QGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSLVNRSHD--------FIVEPVTGWVRSLRHVKPGKYSLKVKSEDRASRLYYFDENEVQPSWTADVLITVRETKPKPRRILV------DQRKINPNILNNRQLAAIITLKDSPNDAIVGLKGNEKEHWFEVEPEVVGNDGTKELRWMLY----AKNGSQVPKNTNVTLTIGEDYI--RRSGFSISKKPVIPTNETVTIQIERLAEHLIRFLDNEKLTLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINR-SERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELP-LEINANTGEITL 548          

HSP 13 Score: 56.6102 bits (135), Expect = 1.451e-7
Identity = 52/201 (25.87%), Postives = 87/201 (43.28%), Query Frame = 1
Query: 1891 FHSTLYQFRIPENNVLGQYIGHVNAT-------DKDIEENGHVIYSLSSNAEAIVSIDSNTGSLT-------ASKEFDRETSDKYSFTV--IARDNGPSHLSSSSLVYLTILDVNDHTPKF---ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
            F + LY   + EN++  +Y    N+T       +KD      V   +   +    +     G               +RE  D Y   V  + +    S+L +++ ++L ++D ND +P F   E  Y   I +D  P  TV +VEA D DIG N+ I + L  R   F ++P++G +     ++   K  +Y LKV + D
Sbjct:   33 FTAPLYNLSVEENSIGSKYARSENSTKIGVPLPEKDANCKFRVAEIVGEKSSLFKAHSRQVGDFVFLRIRYKGDNPLNRELKDFYDILVKAMCKRRDLSNLETTARIHLRVIDRNDASPVFLVGEQGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSLVNRSHDFIVEPVTGWV----RSLRHVKPGKYSLKVKSED 229          

HSP 14 Score: 55.4546 bits (132), Expect = 3.755e-7
Identity = 51/185 (27.57%), Postives = 88/185 (47.57%), Query Frame = 1
Query: 1831 LTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVI-ARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDS-NPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIIL 2373
            + S    ++ + DENDN P F   T + F + E++ +   +  V A DKD  ENG V YS+ S N E++  ID+ +G +  +K  D E     S   I A D+  + L     +++   +    T KF+ + + +   DS  PG  V  + A+      +  ++Y L+   + F +  +SG + L
Sbjct: 1447 MKSFATFSVNINDENDNSPYFVGHTAFAF-VDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPELQHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNAL-----HHGTVSYKLEPNCTFFEVHTLSGAVHL 1625          

HSP 15 Score: 54.6842 bits (130), Expect = 6.381e-7
Identity = 76/278 (27.34%), Postives = 128/278 (46.04%), Query Frame = 1
Query: 1849 LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG--PSHLSSSSLVY--------------LTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ----ARFSQFGIDPISGKIILRS--ANIDREKIS--RYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            ++I + D ND+ P+F +   +         G  +  V+ATD+D  ENG ++Y  +S  E  + I++NTG +T  +   +  S  +  TV A D G   S +S+ +L++              +     N H+P F        + ED+  G  V +++A D D G N  I Y +     +      +D  SG+I + S  + + +EK+     +LKV A D G P       + + I+DVN++ P F   S     + +S N+ P   I ++ AND D
Sbjct:  478 VSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTS--ELPLEINANTGEITLVEVPKKGNS--WPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYY---LRISENEKPGKDIFKVTANDFD 748          
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 115.931 bits (289), Expect = 1.428e-25
Identity = 166/634 (26.18%), Postives = 271/634 (42.74%), Query Frame = 1
Query:  661 DSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK-------ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVS-IKEDVPINHLIIKLLAEDKDVG-NNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQS-PEIRLHVIA-KDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK-IKENVQNVQQ-------VASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS----------LTTHNSIDRETIGS--YIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVI-YSLSSNAEAI-VSID-----SNTGSLTASKEFDRE-TSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR-FSQFGIDPISGKIILRSAN-IDREKISRYELKVIASD 2436
            ++K+F  ++ + EI    K DRE +                 D+ IL  + + +       A+  N + ++V I + DVNDN+PSF   +    VKE+   G ++   +  D D    S     + G+  G+  F  R   D   +++ + LD E  D + LV+ A DG  N  T   I   ++ D     P++  + ++ + I+EDV I  ++  + A D D    + ++ Y  E    +E       F +   SG I + + LD +     P     V A  D+G  ++      V + V DINDN P      +  ++LF  I+EN + +         V +   +DP T          +N N +   + N L  G S          +    S+DRE      +II ++ ND G PS      + I V D NDN P F  T Y+  + E   +G  +   +A D D E   +V  Y LS  ++   V+ D     S+ G L   +  D E  + +  F +  R +   H  + + V++ ++D NDH P         + ED   G ++G+  A D D G+ A+   + Q+    QF ID       LR A+ +DRE I+ Y L + A D
Sbjct: 1267 ETKHFRIDELTGEIFPNEKFDREKI-----------------DMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKH--SNLRYHLIGAGGGRIPFGVRT--DSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNA---PQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADE------VFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYAD--VQVNVRDINDNSP------IFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTT----------ENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH-DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDG---TLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 2 Score: 113.235 bits (282), Expect = 8.785e-25
Identity = 146/517 (28.24%), Postives = 222/517 (42.94%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEI--RLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK-IKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN------FQLLSLD--NPLTK-GYSLTTHNSIDRETIGSYIIIIK----CNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQY------IGHVNATDKDIEENGHVIYSL---SSNAEAIVSIDSNTGSLTASKE--FDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK-----------IILRSANIDR-----EKISRYELKVIASDGGHP-SFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATD 2625
            P +    ++  ++ED+P+N  I+K+ A DKD G+N ++ Y  +N          + F +NS +GEI  + +LD + L       R +V A+D+GE +  S S ++ I   + ND      A+ L   +    + E+ Q    V  I   D D     EV     +KN        L S+D    L K  + ++  +  + E   +  +I++    C  +   + TS   L I +ED N+N P F        I +  + G Y      I  V ATD D   NG ++YSL    S +     ID  TG LT S    FDRET  +   TV A D G   L       + ++D+ND++P+FE   Y  S+      G +V  V A D D   NA+ITY L+       ID  +G+           +  RS  I        K  ++   VIA D G P + Q    V +N+ D     P +Q        + V  N   N +I + RA  S  S+ +D
Sbjct:  640 PTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDN----------HNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE----SAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK-IMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLE-------IDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSD 1130          

HSP 3 Score: 106.301 bits (264), Expect = 1.304e-22
Identity = 205/832 (24.64%), Postives = 347/832 (41.71%), Query Frame = 1
Query:  544 KEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSK-----YFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKS-PTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNS--QDTIYVKENVKLGEIQRFQV-SDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV-----KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITE---NFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFE---NIRNEEESRLRNF--FLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKG-----------GEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLN-------IMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS--IPEDSNPGKTVGQVEAIDLDIGE-NAKITYHLQARFSQ--FGIDPISGKIILRSANIDRE---KISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNH----LIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPT-CSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            K E P  +    IA  +E     KT    +V+    D   S      Y     QS   K  V +DR++  + P      D ++ P  D+ +   + T + D   +   Q  +E+ D+NDNSP F     + ++   E V    I  F   +DA      T S+E+D +  G+E+ N   + + V     ++ LIK +  +       VI   +G       +  V +N+ D     PKW T       +++ E+V +N +I++  A       N  V Y+        N+ ES+ R F  F   +   E+ + + LDYE  Q     L + A D    +  + + VV   V D+ND  P   +   + + D+     E+++       ++V   DT              GE N E + K+F++  L         +  +   DRE I  YI+ ++ +D    +L      N       I++ D NDN P F    Y  R+ E+   G  +  + A D D   N       +        + +++G++   +  D E SD+Y   +IA D      ++++ VY+ I DVND+ P+FE Q + +  I ED +  K +  V A D D  E +++I Y L+ + +   F I   SG I L  A +DR+    +  +   V A D       G   V +N+ D+NDN P+  FP      +    N+ P H        ++A D D     +  I Y ++          +++L   +++F ID + G++F +       S   E  + +RA D G P       + +KV +D++D
Sbjct:  862 KPEFPDCAKYSDIAKIME--GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFV-IDRQTGVLTPSPHVVFDRETRPREDVTV---KATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEID-TTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYE--QVNNYTLTLTATDMTSRVASTKTFVV--EVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGE-ETKHFRIDELTG------EIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASD---GRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKA-LDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI--FPERLFGYIEE--NREPIHSDGVYFMDVQARDFDDPTTENANIEYGIV----------RNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKV-TDMND 1656          

HSP 4 Score: 78.5666 bits (192), Expect = 2.879e-14
Identity = 73/215 (33.95%), Postives = 106/215 (49.30%), Query Frame = 1
Query: 1849 LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDK----YSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKF--ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ---ARFSQ----FGIDPISGKIILR---SANIDREKISRYELKVIASDGG 2442
            L I ++D NDN P F   LY  ++ E+  L Q I  V A DKD  +N  + YS+ ++     SI+SN G ++A    D +  ++    Y F V ARD+G P  LSSS+++++   + ND +  F    QY   + ED+  G  V Q++A D D  E   +TY       R +Q    F ID  +G + LR   SA    E  +   L VI  D G
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN---FSINSN-GEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDE---VTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDG 835          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 223.402 bits (568), Expect = 1.972e-58
Identity = 187/604 (30.96%), Postives = 302/604 (50.00%), Query Frame = 1
Query:  679 CNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQR--FQVSDADSKLFSTKSIEVDGSHVGKEY-FNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDT-GKGGEVNCEID--NKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA---IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARF---SQFGIDPISGKIILRSANIDREKISRYELKVIASDGG 2442
             ++ + EI+T VKLDRE+                     ++   ++ +        I+VL+ ++D NDN+P+F  +   I   EN    E++R      D D + ++T+   +   +V   +  ++   +D V    L +   LDRE    + L+I A+DGG+ P  G + VNI I D+NDNQP +    +  ++ E+  +   ++++ A D D   NG V Y      N  +S     F ++  +G I + + LD+E  +  E  L V+AKD+GE+ + + +  V I V D+NDN P I  I LS D   KI E+ Q  + VA ISV+DPD+  +   VN  ++  + +F L + DN +   Y +  H  +DRE + +Y + +   D G P L +++ + + + D NDN P F   LY   + E    G  +  V A D+D   N  + YSL+   E       ID  TG +T     D ET      TV+ARD G   LSS++ V +TI DVND+ P F+  ++  S+ E+   G+ + +V A D D G NA + Y +   F   ++F +   SG+I + +  +D E+ S YE  V+A+D G
Sbjct:  125 IDRATGEIRTKVKLDRETRA----------------SYSLVAIPLSGRN-------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPR-EVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI----NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHE--LVVVAKDHGEQPLET-TAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICI-AGELDFERRSSYEFPVLATDRG 693          

HSP 2 Score: 175.637 bits (444), Expect = 9.475e-44
Identity = 208/721 (28.85%), Postives = 329/721 (45.63%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI------QRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSIST--VVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVASISVNDPDTGKGGE-----VNCEIDNKNFQLLSLDNPLTKGYSLTTHNS-------IDRETIGSYIIIIKCNDFGFPSL-TSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE--LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQ----FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRA--NDSDLSQAT------DNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV-ISDISDKKHHTNPIW 2901
            V + + D     P F  ++   YVKE++  G +          V+      +S  S + DG      YF+       +++   K LD E      L I A   G  P  G   VNI + D+NDN P++      +S+ E   +   +    A DKD G++G+V Y        +ES  +  F +++ SG + + Q LDYE  Q     L V A D G   + S+ST   + + V D+NDNPP  +     KD+    + E+     Q+  ++ +D DTG         V+  +DN    + S D  +++ + +  ++        +DRET   Y + +   D G P+    TRV+ + V D NDN P F  + Y+FRI EN   G  +G V A+D D+ EN  + YSL     +   +   TG ++  +  DRE  + Y   V ARD G    S+   V + + DVND+ P+     +   S+ E+  PG  V +V A+D D G+NA ITY + + R S     F IDP SG I  R   +D E+ S Y L V ASDGG+P  +   ++ + + D+NDN P F   +S +    V  +    H++  I      +D+ + +      D R+TY L P              + +  FDID H G L ++ +        E ++ IRA+D  +      + + VK+ ++D++D      P W
Sbjct:  813 VFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG------YFSIETNSGNIRI--AKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV-----KESG-KGLFAIDARSGHLILSQHLDYESSQ--RHTLIVTATDGG---VPSLSTNLTILVDVQDVNDNPPVFE-----KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSD--VSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV-LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTK----------DLIEAAFDIDRHSGNL-VVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA----PEW 1485          

HSP 3 Score: 167.548 bits (423), Expect = 3.387e-41
Identity = 216/782 (27.62%), Postives = 342/782 (43.73%), Query Frame = 1
Query:  520 KLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHV---GKEYF--NARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-----ENIRNE-EESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP-IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL----SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAID--LDIGENA--------KITYHLQARF-----SQFGIDPISGKIILRSANIDREKISRYELKVIASD---GGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLP-FPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL 2745
            K  +   +KE++P G++V  + +    +S    H+S V  +S+       YF     S  I+    LD E+                     +L  Q T   +       QV IE+EDVNDN+P F  S   I V E+ +LG  +      D DS      S +V  S V   GK  F  +AR       L L +HLD E      L++TA DGG    +  L + +++ D+NDN P +  + +SV++ E   IN  II++ A D D GNN ++ Y       +N+ N    S +   F +   SG I ++  LD E       +L V+A DNG    H+  T V + V+D NDN P  Q     K K  F+I+EN++    V  ++ +D D G+   +   +   N +FQ+    +P+T    ++T   +DRE    Y ++++  D G P  ++   + I V D NDN P I         + E    G  +  V A D+D  +N  + YS+     S+   + SID  +G +      D E    Y   V A D G     +  ++ + +LD+ND+ P F      F + ED+  G  VG +  I+   D+  N+        ++TY L         + F ID  SG +++ +  +DRE  S + L++ A D     +P     T+     +  ++ P   Q P     ++ VS       +I    A D+D    T+  + Y L+  FP +N    Q+      +LF +DS  G L L
Sbjct:  829 KARYNYYVKEDIPRGTVVGSVIA----ASGDVAHRSPV-RYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKS-----------------QVLLNIQATL-GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSG----SSGQVTYSLVKESGKGLFAIDAR----SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD--RYQLTVLATDNGTPAAHA-KTRVIVRVLDANDNDPKFQ-----KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV----HPVTG--EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV-ARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI----DLQVSEATPVGTIIHNFTATDAD--TGTNGDLQYRLIRYFPQLNESQEQA-----MSLFRMDSLTGALSL 1553          

HSP 4 Score: 160.229 bits (404), Expect = 4.609e-39
Identity = 192/687 (27.95%), Postives = 319/687 (46.43%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKS---IEVDGSHVGKEYFNARLYQDQVKLYLI---KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-ENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVAS-----ISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE-IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            + + + DVNDN P F        V E    G  + +    D D  L S  +    E   +H       A+ +Q   +  LI    H+D E     +L + A DGG  P + T  V + I D+NDN+P +    ++VS+ E+ P+   I+K+ A D D G N  V Y   E  ++  E      F + S SGEI +  +LD+E   S E    V+A D G     S + ++ + + D+NDN P    +   ++    ++E+ +   Q +S     +   DPD G  G+V+  I   N   +   +  T    +   + +   T   +++ I   D G     +  V+ + + D     PIF    Y + + E+   G  +G V A   D+     V YS+ S + +   SI++N+G++  +K  D E   +    + A    P  +   + V + + DVND+ P+FE      S+PE +  G  +    A D D G + ++TY L  ++    F ID  SG +IL S ++D E   R+ L V A+DGG PS      + ++++DVNDNPPVF+        VNVS ++  N  I Q+  N SDL    + RITY ++     N  +  S   + Q+ F I  + G ++L  + P    + +  ++ + A D+G+P   ++T +IV+V+
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH-------AQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYE--FPVLATDRGG---LSTTAMIKMQLTDVNDNRP----VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP-VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLIL-SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEYSVNVSESRSINAQIIQV--NASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH-FGIFPNSGWIYL--RAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL 1144          

HSP 5 Score: 155.992 bits (393), Expect = 1.089e-37
Identity = 218/894 (24.38%), Postives = 381/894 (42.62%), Query Frame = 1
Query:  517 LKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRE---SLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNN---VEIIQVLIELEDVNDNSPSFL-NSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLS--LDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPI--FHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASK----EFDR--------------------------------------ETSDKYSFT----------VIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFP-TCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCL 2994
            L+ ++R TI E +PSGS VLQ+      +  +   ++  + + +   + +  F  + Q   I T  + DRE   S  +   V++     + +      Q    +  D +N    ++  + I + DVNDNSP F   S   + V EN + G I     SD D    +     + G ++G ++    +     +L   + LDRE    + L I A D G      G   + I + D NDN P++    ++ S++ED P+   ++++ A D D+G N ++ Y   N     E++ +  F ++  SG I    KLD E   S      V+A D G   + S +  V I V+DINDN P  +        + ++   +Q  Q +  +   D D G   E+   ++ +N  + +    NP T   +L+   S+  E+     + +   D G P  +S  ++ +++ +     P+  F +  Y+  + EN+  G  +  V A   D           + N + I+S+DS +G +  +K    ++DR                                       TS  ++ T          ++AR      L+S + + + + D ND++PKF + Q+  ++ E +N G  V QV A D D G NA++ YH+      + F I+P    I+  +  +DRE    Y+LK+IA+D G P   G   + + I DVNDN P F      NN V VS       +I  I AND D   A    +TY L    +V+  +         ++F +D + G+L L  +        YE+ V      H      ++T L V+V     + ++   P++  ++   + AI+  +   +  +S  F +L +
Sbjct: 1720 LQAVYRATILENVPSGSFVLQVT-----AKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKF---SIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-----ETQWQ--FAIDGQSGLITTVGKLDRELQAS--YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG--ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIEN--------MSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH-----EARTVLTVRV-----NDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTV 2563          

HSP 6 Score: 152.14 bits (383), Expect = 1.444e-36
Identity = 148/576 (25.69%), Postives = 267/576 (46.35%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDT------IYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHL-----DRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-ENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHV-------------IAKDNGEEIIHSIS-------TVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRV-LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSL-VYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            + V + + D ND++P F++   +      +++ +  ++GE+    V+ D DS      + E+ G + G+  F  R+      + L+K L     D E    F L+I A D G   P   +L +++ +   ++N P+++   +  +I E+VP    ++++ A+      N  + YE    + N+        F ++   G I  + + D E   S  + ++V             + K    + I   S         ++ITV D+NDN P  +  S        + EN +    + ++  +D D G   ++   I   N     S+D+   +     +   +DRE    Y + I+ +D G P        + I VED+NDN P F  + Y   + E+  LG  +  ++A D D+  N  ++YSL++  +   +ID  +G +T   + DRE    Y+F V+A D G   + S+++ V + +LD+ND+ P FE   Y   +P    PG+T+ +V+A+D D+G NA+I Y L A  S    +F I+P +G +   S ++  E      L+V+A D G+P
Sbjct: 1586 VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRF--RINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND-------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEP-GVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSA-SQSLASESGKLLHLEVVARDKGNP 2142          

HSP 7 Score: 140.969 bits (354), Expect = 3.863e-33
Identity = 172/609 (28.24%), Postives = 272/609 (44.66%), Query Frame = 1
Query:  814 TAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLY------QDQV-----------KLYLIKHLDRELVDNFKLVITAIDGGSNPN---TGTLXXXXXXXXXXXXQPKWITEN------FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKL-----DYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPN-IQAISLSKDKLFKIKENVQN---VQQVASISVNDPDTGK-GGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLN-----------------------IMVEDENDNYPIFH-STLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS-QFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
            T  ++N     I V IE+ DVNDN+P +      + V E   +G I   F  +DAD+           G++   +Y   R +      Q+Q             L L   LD E V  + L++ A+D  SN       ++ V + I D ND+ P +++ N       S+ I +   I  ++  ++A D+D G+NG++ YE      E        F +NS +G I + + L     D E  +     L + AKD+G+      S  + + V   ++NPP  +QA+  +      I ENV +   V QV + S++  +      E+   + N  F +        +G  +TT    DRE+  SY++ +   D    S  S+  +                        I V D NDN P F   + Y   +PEN+  G  I  V A+D D   N  +IYS++  N     SIDS++G L+A +  DRE   +Y+  + A D G P        + + + D ND+ P+F+L +Y  S+ ED+  G +V Q+ A+D D+G NA++ Y L      QF ID  SG +I     +DRE  + Y   V+A+DGG 
Sbjct: 1458 TTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT-----------GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR------FRINSQTGIIELVKSLPPATEDVE--KGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT-----ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV-----DWQRGI-ITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGGR 2033          

HSP 8 Score: 139.043 bits (349), Expect = 1.574e-32
Identity = 151/525 (28.76%), Postives = 234/525 (44.57%), Query Frame = 1
Query: 1357 ESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPD-----TGKGGEVNCEIDNKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS---SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFF-----SIPEDSNPGKTVGQVEAIDLDI-GENAKITYHLQARFSQFGIDPISGKIILRSAN--IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            E+ +     ++  +GEIR + KLD E   S  +   V    +G  I       V +TV D NDN P     S+      +  EN     +   +   D D     T +   V+  + N  F+L S        Y  L     +DRET   Y ++I+  D G P L     +NI ++D NDN PIF+ + Y   +PEN  +G  +  V A+D D +ENG V Y+++   S+ E +  ID  TG++  +K  D ET + +   V+A+D+G   L +++ V + + DVND+ P   + +        I E + PG+ V ++   D D   E A +   L      F +      I L   +  +DRE +S Y L V+A+D G P       + + I DVNDNPP F+      N + V+    P   + Q+ A+D D  +  ++ +TY L   P     H Q         F ID   G L        C      ++ + A D G P LSS   ++V  I D++D +
Sbjct:  116 EAGVETDLAIDRATGEIRTKVKLDRETRASYSL---VAIPLSGRNI------RVLVTVKDENDNAPTFPQTSMH----IEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNV-NDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVAD---PGTSVLQVLAHDRD--EGLNSALTYSLAETPET---HAQ--------WFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLV-TIHDVNDNE 608          

HSP 9 Score: 133.265 bits (334), Expect = 8.244e-31
Identity = 160/579 (27.63%), Postives = 267/579 (46.11%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPK----WITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIR---VQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN---CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV--SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSI---PEDSNPGKT--VGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ 2517
            + V I ++DVNDN P F  S+    V EN  +G  + +   SD D+         ++     KE    R+      +Y+ K LD E  +  +LV+ A D G  P   T  V+I +TD+NDNQP     +++++ S  I E       + ++   D D         E+ N+ N   +     F L +    I    V   LD E + +    L V+A D G   +H+ S  +F+ + D+NDNPP  +   L    + ++ +   +V QV +   +D D G    +     E    + Q   +D P T    +TT + ID ET     + +   D G P L+ST  + + + D NDN PIF  + Y   + EN  +G+ I  V+A+D D   N  V Y++    + +    + S +G +  + E D E    Y F V+A D G   LS+++++ + + DVND+ P F   +Y  S+   P+ S+   +  +  V A D D G   +++Y + A      F ID  +G+I ++R   +       + L + A+DGG+     + +V ++I D    PP+F+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKT------EYANV-NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSN--YTLSVVATDKGTPPLHA-SKSIFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLA---HDRDEGLNSALTYSLAETPETHAQWFQID-PQTG--LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE 828          

HSP 10 Score: 114.005 bits (284), Expect = 7.511e-25
Identity = 179/713 (25.11%), Postives = 298/713 (41.80%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE---VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRL----RNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSI----------DRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFT-VIARDNGP-----SHLSSSSLVYLTILDVNDHTPKFE--LQYFFSIPEDSNPGKTVGQVEAIDLDI--GENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQ--------IRANDSDLSQATDNRITYILLPFPSVNYPHPQSRL----SIYQNLFDIDSHGGQLF----LINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIV 2850
            +++IELED NDNSP F   Q    V E    G     QV   DS   S   +    VDG+H    +     +   V+  ++  LDRE+ D +KL I A D G    TGT  + + I D+NDNQP +   N  V++ E   +  +I  + A D D        Y     R   ES +     + F L+  SG++ ++++LDYE  Q  E  L VIA D      H   TV+ + V D NDN P    ++      F I   +  + +  S+   D D       + + +  N +++ +  P  +G+S+   N +             + G Y + I   D G P+L S+ +L +   D       F    Y+ +I E   LG  +  +     D       +  ++ N E+   +   + ++   K  DRE +D Y    V++  +GP      + SS   V +TILD ND+ P F+   +Y   I E +    ++ Q++AID D     N+++ Y + +   +  F ID ++G ++  +  +D +  ++ YEL + A D  H                +  P   +     +NE      +   H +A+         RA+ SDL +    ++ Y + P PS        R+     +  + F  D    Q +    L +       S  ++V I + D  +PQ + +TY  V
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVA-QVHAFDSDAGSNARLRYHIVDGNH-DNAFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT-------YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ--EYELDVIASDAA----HEARTVLTVRVNDENDNAPVF--LAQQPPAYFAILPAISEISESLSV---DFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-----QSLAIIAGNEESAFEL-LQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTG-VLFVNNRLDYDSGAKSYELIIRACDSHH-----------QRPLCSLQPFRLELHDENDNEPKFPLTEY-VHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFV 2977          

HSP 11 Score: 100.908 bits (250), Expect = 6.889e-21
Identity = 105/372 (28.23%), Postives = 171/372 (45.97%), Query Frame = 1
Query: 1792 IIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR-------FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF--QFPSS------KNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            +++ +  D  F  L S   L I +EDENDN P F    +   + E N  G ++  V+A D D   N  + Y +   ++  A V   + +G +  +   DRE  D Y   +IA D G   ++ ++ + + I+DVND+ P F      ++ E +  G  +  + A D+D      +TY L A         S F +D  SGK++L+   +D E    YEL VIASD  H   +  T++ + + D NDN PVF  Q P +        +E++ S +   +  +  + A D+D S+  ++++ YI+ P       HP + + +  N+  +             P  S S +  V I A D G P L S T L V+ 
Sbjct: 2291 VLVARTADAPF--LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKR-RLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV--DFDLLTVNATDAD-SEGNNSKVIYIIEPAQEGFSVHPSNGV-VSVNMSRLQ------------PAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQA 2638          

HSP 12 Score: 97.8265 bits (242), Expect = 5.488e-20
Identity = 172/738 (23.31%), Postives = 288/738 (39.02%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQ---MTAKADNNNVEI----IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDAD--SKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNT--GTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQK--LDYEYLQSP------------------------------------------------EIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNV--------LGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ----YFFSIPEDSNPGKTVG------QVEAIDLDI-GENAKITYHLQARFSQFGIDPISGKIILRSANIDREKIS-----RYELKVIASDGGHPSFQGET 2466
            +  +++E+ P G+ V+QI++   + + +  +   V  +SL +    + F  + QS  I T+ KLDRE                       LQ     M    D    E+    + V I + D+NDN P F        V   ++ G+ + + Q  DAD  +      S+  + S V  ++   R+      L   + L  E      L + A D G+ P +  G + + I          ++  E + V +KE+ P    +++++A   D G   KV + F    NE+         L+SLSGEIRV +   LDY+   +P                                                EIR+ ++A+      + S + +V I + D NDN P        K  +  + E       VA +   D D G    +   I + N     +  P   G  + T+  +DRE    Y + I   D G P +T T  + + + D NDN P F         P NN+        LG  I  ++A D D      + Y L + +       +I ++D  +G L   +  D E   +Y   VIA D   +H  + +++ + + D ND+ P F  Q    YF  +P  S   +++        V A D D  G N+K+ Y ++     F + P +G +   S N+ R + +      Y +++IA D G P+ +  T
Sbjct: 1957 YTGSVQEDAPLGTSVVQISA---VDADLGVNARLV--YSLANETQWQ-FAIDGQSGLITTVGKLDRE-----------------------LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKF---RINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSF-GAGNED-----GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELV-IELEDENDNSPKFS----QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF---------PPNNLVTVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD--AAH-EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV---SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST 2632          

HSP 13 Score: 82.8037 bits (203), Expect = 2.415e-15
Identity = 169/680 (24.85%), Postives = 294/680 (43.24%), Query Frame = 1
Query:  724 RESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADS------KLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITEN----FSV-----SIKEDVPINHLIIKLLAEDKDV-GNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRV-QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSY-IIIIKCNDFGFPSLTSTRVLN-----IMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEE--NGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSH---LSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL------QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMP-NHLIAQIRANDSDLSQATDNRITYIL 2646
            R ++ +D E+++    K    D  + Q   TA           + +++ DVNDN P+F    + + V E  +LG  I     +D D+      +L +  +++++   +    F    Y    KL L + LD EL   ++L + A D      T   ++ + + D NDN P ++ +     F++      I E + ++  ++ + A D D  GNN KV Y  E  +          F ++  +G + V   +L      S +  + +IAKD G+  + S ST++ +     NDN    ++  L      +I E       V  +  +  D      +    +   F+LL       +  ++     +DRE    Y + ++  +  G P ++S    +     I + D NDN+PIF  S  Y+  I E   L   I  + A D D E   N  V+Y ++S N E + +ID  TG L  +   D ++  K S+ +I R     H   L S     L + D ND+ PKF L +Y   + E+   G +V +  A DLD G   ++ Y +      ++ +  F +D  SG ++  +   D E+  RY+++++ASD G    +    V + IE  ++  P  QF       V  +   +P  +++ Q+ A DSD     D R+ Y L
Sbjct: 2381 RTNIVLDREIRDIYKLKIIATDEGVPQMTGTAT----------IRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI----FALDRYSG--KLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--------FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKS-STLLRVQA---NDNGSG-RSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA--IIAGNEESAFELL-------QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG-LVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTP--QFTERTYRFVLPAAVALPQGYVVGQVTATDSD--SGPDGRVVYQL 3010          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 223.402 bits (568), Expect = 1.972e-58
Identity = 187/604 (30.96%), Postives = 302/604 (50.00%), Query Frame = 1
Query:  679 CNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQR--FQVSDADSKLFSTKSIEVDGSHVGKEY-FNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDT-GKGGEVNCEID--NKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA---IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARF---SQFGIDPISGKIILRSANIDREKISRYELKVIASDGG 2442
             ++ + EI+T VKLDRE+                     ++   ++ +        I+VL+ ++D NDN+P+F  +   I   EN    E++R      D D + ++T+   +   +V   +  ++   +D V    L +   LDRE    + L+I A+DGG+ P  G + VNI I D+NDNQP +    +  ++ E+  +   ++++ A D D   NG V Y      N  +S     F ++  +G I + + LD+E  +  E  L V+AKD+GE+ + + +  V I V D+NDN P I  I LS D   KI E+ Q  + VA ISV+DPD+  +   VN  ++  + +F L + DN +   Y +  H  +DRE + +Y + +   D G P L +++ + + + D NDN P F   LY   + E    G  +  V A D+D   N  + YSL+   E       ID  TG +T     D ET      TV+ARD G   LSS++ V +TI DVND+ P F+  ++  S+ E+   G+ + +V A D D G NA + Y +   F   ++F +   SG+I + +  +D E+ S YE  V+A+D G
Sbjct:  125 IDRATGEIRTKVKLDRETRA----------------SYSLVAIPLSGRN-------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPR-EVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI----NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHE--LVVVAKDHGEQPLET-TAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSI---YLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICI-AGELDFERRSSYEFPVLATDRG 693          

HSP 2 Score: 175.637 bits (444), Expect = 9.475e-44
Identity = 208/721 (28.85%), Postives = 329/721 (45.63%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI------QRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSIST--VVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVASISVNDPDTGKGGE-----VNCEIDNKNFQLLSLDNPLTKGYSLTTHNS-------IDRETIGSYIIIIKCNDFGFPSL-TSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE--LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQ----FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRA--NDSDLSQAT------DNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV-ISDISDKKHHTNPIW 2901
            V + + D     P F  ++   YVKE++  G +          V+      +S  S + DG      YF+       +++   K LD E      L I A   G  P  G   VNI + D+NDN P++      +S+ E   +   +    A DKD G++G+V Y        +ES  +  F +++ SG + + Q LDYE  Q     L V A D G   + S+ST   + + V D+NDNPP  +     KD+    + E+     Q+  ++ +D DTG         V+  +DN    + S D  +++ + +  ++        +DRET   Y + +   D G P+    TRV+ + V D NDN P F  + Y+FRI EN   G  +G V A+D D+ EN  + YSL     +   +   TG ++  +  DRE  + Y   V ARD G    S+   V + + DVND+ P+     +   S+ E+  PG  V +V A+D D G+NA ITY + + R S     F IDP SG I  R   +D E+ S Y L V ASDGG+P  +   ++ + + D+NDN P F   +S +    V  +    H++  I      +D+ + +      D R+TY L P              + +  FDID H G L ++ +        E ++ IRA+D  +      + + VK+ ++D++D      P W
Sbjct:  813 VFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG------YFSIETNSGNIRI--AKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV-----KESG-KGLFAIDARSGHLILSQHLDYESSQ--RHTLIVTATDGG---VPSLSTNLTILVDVQDVNDNPPVFE-----KDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSD--VSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVI-VRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVV-LDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTF---TSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTK----------DLIEAAFDIDRHSGNL-VVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNA----PEW 1485          

HSP 3 Score: 167.548 bits (423), Expect = 3.387e-41
Identity = 216/782 (27.62%), Postives = 342/782 (43.73%), Query Frame = 1
Query:  520 KLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHV---GKEYF--NARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-----ENIRNE-EESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP-IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL----SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAID--LDIGENA--------KITYHLQARF-----SQFGIDPISGKIILRSANIDREKISRYELKVIASD---GGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLP-FPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL 2745
            K  +   +KE++P G++V  + +    +S    H+S V  +S+       YF     S  I+    LD E+                     +L  Q T   +       QV IE+EDVNDN+P F  S   I V E+ +LG  +      D DS      S +V  S V   GK  F  +AR       L L +HLD E      L++TA DGG    +  L + +++ D+NDN P +  + +SV++ E   IN  II++ A D D GNN ++ Y       +N+ N    S +   F +   SG I ++  LD E       +L V+A DNG    H+  T V + V+D NDN P  Q     K K  F+I+EN++    V  ++ +D D G+   +   +   N +FQ+    +P+T    ++T   +DRE    Y ++++  D G P  ++   + I V D NDN P I         + E    G  +  V A D+D  +N  + YS+     S+   + SID  +G +      D E    Y   V A D G     +  ++ + +LD+ND+ P F      F + ED+  G  VG +  I+   D+  N+        ++TY L         + F ID  SG +++ +  +DRE  S + L++ A D     +P     T+     +  ++ P   Q P     ++ VS       +I    A D+D    T+  + Y L+  FP +N    Q+      +LF +DS  G L L
Sbjct:  829 KARYNYYVKEDIPRGTVVGSVIA----ASGDVAHRSPV-RYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKS-----------------QVLLNIQATL-GEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSG----SSGQVTYSLVKESGKGLFAIDAR----SGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRD--RYQLTVLATDNGTPAAHA-KTRVIVRVLDANDNDPKFQ-----KSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV----HPVTG--EISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVV-ARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPI----DLQVSEATPVGTIIHNFTATDAD--TGTNGDLQYRLIRYFPQLNESQEQA-----MSLFRMDSLTGALSL 1553          

HSP 4 Score: 160.229 bits (404), Expect = 4.609e-39
Identity = 192/687 (27.95%), Postives = 319/687 (46.43%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKS---IEVDGSHVGKEYFNARLYQDQVKLYLI---KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-ENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVAS-----ISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE-IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            + + + DVNDN P F        V E    G  + +    D D  L S  +    E   +H       A+ +Q   +  LI    H+D E     +L + A DGG  P + T  V + I D+NDN+P +    ++VS+ E+ P+   I+K+ A D D G N  V Y   E  ++  E      F + S SGEI +  +LD+E   S E    V+A D G     S + ++ + + D+NDN P    +   ++    ++E+ +   Q +S     +   DPD G  G+V+  I   N   +   +  T    +   + +   T   +++ I   D G     +  V+ + + D     PIF    Y + + E+   G  +G V A   D+     V YS+ S + +   SI++N+G++  +K  D E   +    + A    P  +   + V + + DVND+ P+FE      S+PE +  G  +    A D D G + ++TY L  ++    F ID  SG +IL S ++D E   R+ L V A+DGG PS      + ++++DVNDNPPVF+        VNVS ++  N  I Q+  N SDL    + RITY ++     N  +  S   + Q+ F I  + G ++L  + P    + +  ++ + A D+G+P   ++T +IV+V+
Sbjct:  490 IFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH-------AQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYE--FPVLATDRGG---LSTTAMIKMQLTDVNDNRP----VFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPP-VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLIL-SQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFE---KDEYSVNVSESRSINAQIIQV--NASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQH-FGIFPNSGWIYL--RAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVL 1144          

HSP 5 Score: 155.992 bits (393), Expect = 1.089e-37
Identity = 218/894 (24.38%), Postives = 381/894 (42.62%), Query Frame = 1
Query:  517 LKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRE---SLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNN---VEIIQVLIELEDVNDNSPSFL-NSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLS--LDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPI--FHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASK----EFDR--------------------------------------ETSDKYSFT----------VIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFP-TCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCL 2994
            L+ ++R TI E +PSGS VLQ+      +  +   ++  + + +   + +  F  + Q   I T  + DRE   S  +   V++     + +      Q    +  D +N    ++  + I + DVNDNSP F   S   + V EN + G I     SD D    +     + G ++G ++    +     +L   + LDRE    + L I A D G      G   + I + D NDN P++    ++ S++ED P+   ++++ A D D+G N ++ Y   N     E++ +  F ++  SG I    KLD E   S      V+A D G   + S +  V I V+DINDN P  +        + ++   +Q  Q +  +   D D G   E+   ++ +N  + +    NP T   +L+   S+  E+     + +   D G P  +S  ++ +++ +     P+  F +  Y+  + EN+  G  +  V A   D           + N + I+S+DS +G +  +K    ++DR                                       TS  ++ T          ++AR      L+S + + + + D ND++PKF + Q+  ++ E +N G  V QV A D D G NA++ YH+      + F I+P    I+  +  +DRE    Y+LK+IA+D G P   G   + + I DVNDN P F      NN V VS       +I  I AND D   A    +TY L    +V+  +         ++F +D + G+L L  +        YE+ V      H      ++T L V+V     + ++   P++  ++   + AI+  +   +  +S  F +L +
Sbjct: 1720 LQAVYRATILENVPSGSFVLQVT-----AKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKF---SIDSSSGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLAN-----ETQWQ--FAIDGQSGLITTVGKLDRELQAS--YNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPY----IGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTG--ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF----PPNNLVTVSEATELGAVITSISANDVDTYPA----LTYRLGAESTVDIEN--------MSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH-----EARTVLTVRV-----NDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTV 2563          

HSP 6 Score: 152.14 bits (383), Expect = 1.444e-36
Identity = 148/576 (25.69%), Postives = 267/576 (46.35%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDT------IYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHL-----DRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF-ENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHV-------------IAKDNGEEIIHSIS-------TVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRV-LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSL-VYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            + V + + D ND++P F++   +      +++ +  ++GE+    V+ D DS      + E+ G + G+  F  R+      + L+K L     D E    F L+I A D G   P   +L +++ +   ++N P+++   +  +I E+VP    ++++ A+      N  + YE    + N+        F ++   G I  + + D E   S  + ++V             + K    + I   S         ++ITV D+NDN P  +  S        + EN +    + ++  +D D G   ++   I   N     S+D+   +     +   +DRE    Y + I+ +D G P        + I VED+NDN P F  + Y   + E+  LG  +  ++A D D+  N  ++YSL++  +   +ID  +G +T   + DRE    Y+F V+A D G   + S+++ V + +LD+ND+ P FE   Y   +P    PG+T+ +V+A+D D+G NA+I Y L A  S    +F I+P +G +   S ++  E      L+V+A D G+P
Sbjct: 1586 VTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGN-GEGRF--RINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVAND-------LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYG---LSVPENSEP-GVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGE----LSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSA-SQSLASESGKLLHLEVVARDKGNP 2142          

HSP 7 Score: 140.969 bits (354), Expect = 3.863e-33
Identity = 172/609 (28.24%), Postives = 272/609 (44.66%), Query Frame = 1
Query:  814 TAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLY------QDQV-----------KLYLIKHLDRELVDNFKLVITAIDGGSNPN---TGTLXXXXXXXXXXXXQPKWITEN------FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKL-----DYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPN-IQAISLSKDKLFKIKENVQN---VQQVASISVNDPDTGK-GGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLN-----------------------IMVEDENDNYPIFH-STLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS-QFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
            T  ++N     I V IE+ DVNDN+P +      + V E   +G I   F  +DAD+           G++   +Y   R +      Q+Q             L L   LD E V  + L++ A+D  SN       ++ V + I D ND+ P +++ N       S+ I +   I  ++  ++A D+D G+NG++ YE      E        F +NS +G I + + L     D E  +     L + AKD+G+      S  + + V   ++NPP  +QA+  +      I ENV +   V QV + S++  +      E+   + N  F +        +G  +TT    DRE+  SY++ +   D    S  S+  +                        I V D NDN P F   + Y   +PEN+  G  I  V A+D D   N  +IYS++  N     SIDS++G L+A +  DRE   +Y+  + A D G P        + + + D ND+ P+F+L +Y  S+ ED+  G +V Q+ A+D D+G NA++ Y L      QF ID  SG +I     +DRE  + Y   V+A+DGG 
Sbjct: 1458 TTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT-----------GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR------FRINSQTGIIELVKSLPPATEDVE--KGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRAT-----ILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHV-----DWQRGI-ITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSA-RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGGR 2033          

HSP 8 Score: 139.043 bits (349), Expect = 1.574e-32
Identity = 151/525 (28.76%), Postives = 234/525 (44.57%), Query Frame = 1
Query: 1357 ESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPD-----TGKGGEVNCEIDNKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS---SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFF-----SIPEDSNPGKTVGQVEAIDLDI-GENAKITYHLQARFSQFGIDPISGKIILRSAN--IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            E+ +     ++  +GEIR + KLD E   S  +   V    +G  I       V +TV D NDN P     S+      +  EN     +   +   D D     T +   V+  + N  F+L S        Y  L     +DRET   Y ++I+  D G P L     +NI ++D NDN PIF+ + Y   +PEN  +G  +  V A+D D +ENG V Y+++   S+ E +  ID  TG++  +K  D ET + +   V+A+D+G   L +++ V + + DVND+ P   + +        I E + PG+ V ++   D D   E A +   L      F +      I L   +  +DRE +S Y L V+A+D G P       + + I DVNDNPP F+      N + V+    P   + Q+ A+D D  +  ++ +TY L   P     H Q         F ID   G L        C      ++ + A D G P LSS   ++V  I D++D +
Sbjct:  116 EAGVETDLAIDRATGEIRTKVKLDRETRASYSL---VAIPLSGRNI------RVLVTVKDENDNAPTFPQTSMH----IEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNV-NDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVAD---PGTSVLQVLAHDRD--EGLNSALTYSLAETPET---HAQ--------WFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLV-TIHDVNDNE 608          

HSP 9 Score: 133.265 bits (334), Expect = 8.244e-31
Identity = 160/579 (27.63%), Postives = 267/579 (46.11%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPK----WITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIR---VQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN---CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV--SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSI---PEDSNPGKT--VGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ 2517
            + V I ++DVNDN P F  S+    V EN  +G  + +   SD D+         ++     KE    R+      +Y+ K LD E  +  +LV+ A D G  P   T  V+I +TD+NDNQP     +++++ S  I E       + ++   D D         E+ N+ N   +     F L +    I    V   LD E + +    L V+A D G   +H+ S  +F+ + D+NDNPP  +   L    + ++ +   +V QV +   +D D G    +     E    + Q   +D P T    +TT + ID ET     + +   D G P L+ST  + + + D NDN PIF  + Y   + EN  +G+ I  V+A+D D   N  V Y++    + +    + S +G +  + E D E    Y F V+A D G   LS+++++ + + DVND+ P F   +Y  S+   P+ S+   +  +  V A D D G   +++Y + A      F ID  +G+I ++R   +       + L + A+DGG+     + +V ++I D    PP+F+
Sbjct:  270 MTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQM-FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKT------EYANV-NVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSN--YTLSVVATDKGTPPLHA-SKSIFLRITDVNDNPPEFEQ-DLYHANVMEVADPGTSVLQVLA---HDRDEGLNSALTYSLAETPETHAQWFQID-PQTG--LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFE 828          

HSP 10 Score: 114.005 bits (284), Expect = 7.511e-25
Identity = 179/713 (25.11%), Postives = 298/713 (41.80%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE---VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRL----RNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSI----------DRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFT-VIARDNGP-----SHLSSSSLVYLTILDVNDHTPKFE--LQYFFSIPEDSNPGKTVGQVEAIDLDI--GENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQ--------IRANDSDLSQATDNRITYILLPFPSVNYPHPQSRL----SIYQNLFDIDSHGGQLF----LINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIV 2850
            +++IELED NDNSP F   Q    V E    G     QV   DS   S   +    VDG+H    +     +   V+  ++  LDRE+ D +KL I A D G    TGT  + + I D+NDNQP +   N  V++ E   +  +I  + A D D        Y     R   ES +     + F L+  SG++ ++++LDYE  Q  E  L VIA D      H   TV+ + V D NDN P    ++      F I   +  + +  S+   D D       + + +  N +++ +  P  +G+S+   N +             + G Y + I   D G P+L S+ +L +   D       F    Y+ +I E   LG  +  +     D       +  ++ N E+   +   + ++   K  DRE +D Y    V++  +GP      + SS   V +TILD ND+ P F+   +Y   I E +    ++ Q++AID D     N+++ Y + +   +  F ID ++G ++  +  +D +  ++ YEL + A D  H                +  P   +     +NE      +   H +A+         RA+ SDL +    ++ Y + P PS        R+     +  + F  D    Q +    L +       S  ++V I + D  +PQ + +TY  V
Sbjct: 2307 ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVA-QVHAFDSDAGSNARLRYHIVDGNH-DNAFVIEPAFSGIVRTNIV--LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT-------YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQ--EYELDVIASDAA----HEARTVLTVRVNDENDNAPVF--LAQQPPAYFAILPAISEISESLSV---DFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALD-----QSLAIIAGNEESAFEL-LQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTG-VLFVNNRLDYDSGAKSYELIIRACDSHH-----------QRPLCSLQPFRLELHDENDNEPKFPLTEY-VHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFV 2977          

HSP 11 Score: 100.908 bits (250), Expect = 6.889e-21
Identity = 105/372 (28.23%), Postives = 171/372 (45.97%), Query Frame = 1
Query: 1792 IIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR-------FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF--QFPSS------KNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            +++ +  D  F  L S   L I +EDENDN P F    +   + E N  G ++  V+A D D   N  + Y +   ++  A V   + +G +  +   DRE  D Y   +IA D G   ++ ++ + + I+DVND+ P F      ++ E +  G  +  + A D+D      +TY L A         S F +D  SGK++L+   +D E    YEL VIASD  H   +  T++ + + D NDN PVF  Q P +        +E++ S +   +  +  + A D+D S+  ++++ YI+ P       HP + + +  N+  +             P  S S +  V I A D G P L S T L V+ 
Sbjct: 2291 VLVARTADAPF--LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVDT--YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKR-RLDYELQQEYELDVIASDAAH---EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV--DFDLLTVNATDAD-SEGNNSKVIYIIEPAQEGFSVHPSNGV-VSVNMSRLQ------------PAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQA 2638          

HSP 12 Score: 97.8265 bits (242), Expect = 5.488e-20
Identity = 172/738 (23.31%), Postives = 288/738 (39.02%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQ---MTAKADNNNVEI----IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDAD--SKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNT--GTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQK--LDYEYLQSP------------------------------------------------EIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNV--------LGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ----YFFSIPEDSNPGKTVG------QVEAIDLDI-GENAKITYHLQARFSQFGIDPISGKIILRSANIDREKIS-----RYELKVIASDGGHPSFQGET 2466
            +  +++E+ P G+ V+QI++   + + +  +   V  +SL +    + F  + QS  I T+ KLDRE                       LQ     M    D    E+    + V I + D+NDN P F        V   ++ G+ + + Q  DAD  +      S+  + S V  ++   R+      L   + L  E      L + A D G+ P +  G + + I          ++  E + V +KE+ P    +++++A   D G   KV + F    NE+         L+SLSGEIRV +   LDY+   +P                                                EIR+ ++A+      + S + +V I + D NDN P        K  +  + E       VA +   D D G    +   I + N     +  P   G  + T+  +DRE    Y + I   D G P +T T  + + + D NDN P F         P NN+        LG  I  ++A D D      + Y L + +       +I ++D  +G L   +  D E   +Y   VIA D   +H  + +++ + + D ND+ P F  Q    YF  +P  S   +++        V A D D  G N+K+ Y ++     F + P +G +   S N+ R + +      Y +++IA D G P+ +  T
Sbjct: 1957 YTGSVQEDAPLGTSVVQISA---VDADLGVNARLV--YSLANETQWQ-FAIDGQSGLITTVGKLDRE-----------------------LQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKF---RINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFSF-GAGNED-----GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELV-IELEDENDNSPKFS----QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTF---------PPNNLVTVSEATELGAVITSISANDVDTYP--ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASD--AAH-EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV---SVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSST 2632          

HSP 13 Score: 82.8037 bits (203), Expect = 2.415e-15
Identity = 169/680 (24.85%), Postives = 294/680 (43.24%), Query Frame = 1
Query:  724 RESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADS------KLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITEN----FSV-----SIKEDVPINHLIIKLLAEDKDV-GNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRV-QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSY-IIIIKCNDFGFPSLTSTRVLN-----IMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEE--NGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSH---LSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL------QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMP-NHLIAQIRANDSDLSQATDNRITYIL 2646
            R ++ +D E+++    K    D  + Q   TA           + +++ DVNDN P+F    + + V E  +LG  I     +D D+      +L +  +++++   +    F    Y    KL L + LD EL   ++L + A D      T   ++ + + D NDN P ++ +     F++      I E + ++  ++ + A D D  GNN KV Y  E  +          F ++  +G + V   +L      S +  + +IAKD G+  + S ST++ +     NDN    ++  L      +I E       V  +  +  D      +    +   F+LL       +  ++     +DRE    Y + ++  +  G P ++S    +     I + D NDN+PIF  S  Y+  I E   L   I  + A D D E   N  V+Y ++S N E + +ID  TG L  +   D ++  K S+ +I R     H   L S     L + D ND+ PKF L +Y   + E+   G +V +  A DLD G   ++ Y +      ++ +  F +D  SG ++  +   D E+  RY+++++ASD G    +    V + IE  ++  P  QF       V  +   +P  +++ Q+ A DSD     D R+ Y L
Sbjct: 2381 RTNIVLDREIRDIYKLKIIATDEGVPQMTGTAT----------IRVQIVDVNDNQPTF-PPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSI----FALDRYSG--KLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--------FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKS-STLLRVQA---NDNGSG-RSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLA--IIAGNEESAFELL-------QSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAK-SYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESG-LVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTP--QFTERTYRFVLPAAVALPQGYVVGQVTATDSD--SGPDGRVVYQL 3010          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 191.045 bits (484), Expect = 2.158e-48
Identity = 184/628 (29.30%), Postives = 291/628 (46.34%), Query Frame = 1
Query:  667 KYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDAD-SKLFSTKSIEVDGSHVGKEY---FNARLYQDQVKLYL--IKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIR---------LHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ-AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN----FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS-----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGET 2466
            + F  +  + E+KT V LDRE +                 DL +L  Q T          I+V I++ DVNDNSP F      I   E+   G  +     +DAD  +   T   E+   +V  ++     A    D   L+L    +LDRE   +++L I+A DGGS P  G L VN+ I D+NDN P +   +++VS+ E       ++ ++A D D+G+N K+ Y      ++        F +N  +G I   ++++    Q   ++           V A+D+G        T V + ++D ND+ P I         K+  + EN  N   VA+++V D D+G  G  +  I + N    F+L          + +  +  +DRE IG Y + +   D G P+ T+T  L I V D ND+ P+F  + Y   + E    G ++  + ATD+D   N  V Y  LS N     S+D  TG +  +   DRE  D    ++ ARD GP+   + + + + ILD ND  P+F + +   ++ ED+ P   V  + A D D G N  +T+ L          QF +D ++G++  R   +DREK+S+YE+ VIA D G P+ Q  T
Sbjct:  101 REFTLDPVTGEVKTNVVLDREGM-------------RDHYDLVVLSSQPTYP--------IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ--------FTVNPETGVISTTERVNCP--QQTNVKSSASQKSCVFTVFARDHGSPR-QDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRL----EEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRP-LDREKMSQYEISVIARDQGAPTPQSAT 691          

HSP 2 Score: 180.644 bits (457), Expect = 3.523e-45
Identity = 205/764 (26.83%), Postives = 341/764 (44.63%), Query Frame = 1
Query:  646 LLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGG-SNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVI--AKDNGEEIIHSISTVVFITVIDINDNPPNI-QAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ-FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ--FPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLIN--KFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNP 2895
             L   DS  F  N  S +I  L  LDRE            D  SP          +T            V +E++D+NDN P F        V+EN+  G  +   + +D D  L +     + G H+ + + ++    +  ++     LDRE    + L + A D   + P   ++ + I+++D+NDN PK+ +  ++V++ E +     +    A D D G N  V+Y           R +++F +N+ +G +  + +L  +     ++   ++  A D GE+   S+S+   +TVI     PP +    +   +  F + E+V+  + +  +S   P  G  G++   I        SL      G      + +D E    Y I I+  D   PSL S  ++ + V D NDN P+    +Y   + E     Q I  V A+D+D  +NG+VIY L ++ +    I + +G +      DRE    Y+F V A D G  H++ ++ V L +LD ND+ PKF   +  ++ E++  G  V +V + DLD+G NA  +Y       + F I+P SG I + + ++DRE+   Y LKV+ASDG   +++ ET + I I+D NDN P F+  F S    E+  S       L+ QI A D D  Q  ++ I+Y      S+  P P         +F ID   G++F     +F    Y         + + A D+G P L S+  + + ++        H NP
Sbjct: 2425 FLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPP---------LTGTG--------IVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDS----ETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISG-------RDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQ---SLSSKAELTVIL---RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG-GIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITV-AGHLDREQQDEYILKVVASDG---AWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSI-----ALVGQIIATDRD-KQGPNSVISY------SLQQPSP---------MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIV------DAHNNP 3121          

HSP 3 Score: 155.992 bits (393), Expect = 1.221e-37
Identity = 177/704 (25.14%), Postives = 314/704 (44.60%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVG------KEYFNARLYQDQV----------KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENV--QNVQQVASISVNDPDTGK-GGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSL-VYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQF-------GIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            ++V I ++DVND  P F+++ +T  + ENV +  +           + + K+++ D    G      KE  +  + Q             +L ++  LDREL  ++ L ITA D G  P +    + I I D NDN P +  + +S S+ E+  I  +++++ A D D G NG++ Y    +  ++     + F ++  +G +RV + L+YE L      L V A+D   E     +  + I ++DINDN P      L    L ++ EN    N   V +++  D DT     +V   +   +  L  ++        +     +DRE    Y + +   D G P LT T ++ + V+D NDN P+F    Y   + EN   G ++    ATDKD   N  + ++L         IDS TG ++ +   DRE +  Y  T++A+D+  +   +SS+ + +++ DVND+ PKF+   Y  ++PE  + G+ V    A+DLD GENA + Y +  R   +       G+  +S K+ L++     + ++ Y + + A D G  S   +  + + +      P    F    N+   +S +  P  +I ++ A      +    +I Y +                I  +   +D + G L +         ++  ++ I A D  +P L S T LI   ++D +D
Sbjct: 2151 VKVTILIKDVNDEVPVFISANETA-IMENVAINTV-----------VIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSI--VLGDQN----HDFSISEDTGVVRVAKNLNYERLS--RYSLTVRAEDCALENPAGDTAELTINILDINDNRPTF----LDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRIN---ASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGV--VSTKLELKTKTKSHDDLT-YTIVISAMDQGEQSLSSKAELTVILRPPELFP---TFAYMANSHFAMSEDVRPGKMITKVSATSP--KKGLVGKIRYAIAG-------------GIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVT-LITLNVTDAND 2805          

HSP 4 Score: 146.362 bits (368), Expect = 8.772e-35
Identity = 172/588 (29.25%), Postives = 259/588 (44.05%), Query Frame = 1
Query: 1048 RLYQDQVKLYLI---KHLDREL-VDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI----DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG------------------------------------PSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQFG--------IDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
            RL+    KL ++     LDRE   + +++ + AI  G  P T    V + + D ND+ P+++   F  ++ ED+ I H I  L A D D    G V +   +  + +       FLL   +G++ +   LD E     E+R+ V    +G +   + +T   I V D NDNPP  +    S    F I EN Q   QV  I   D D G+  +++  +     N  F L    NP T   +LT    +D E +  YI+I++  D G PSL++T  +   V D NDN PIF    Y   + EN  +   +  V+A D D   NG + YS+++ + ++   IDSN G++   +  DRE    Y+ TV ARD                                         LSS+  V + I DVND  P F      +I E+      V  V+A+D D G N  I Y + +AR    G        ++P  G++ +  A +DRE  S Y L + A D G P    E+ + I I D NDN PVF     K    +V+ N     ++ Q+ A D D  +  + RI Y ++
Sbjct: 1763 RLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGK-------FLLEPSTGKLILNDTLDRETKSKYELRIRV---SDGVQYTEAYAT---IQVSDTNDNPPLFEDTVYS----FDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSL----NPQTGMLTLTAR--LDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDA-LDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFD---PKQYSASVAENASIGAMVLQVSATDVD--EGANGRIRYSIV 2318          

HSP 5 Score: 144.05 bits (362), Expect = 5.011e-34
Identity = 192/712 (26.97%), Postives = 320/712 (44.94%), Query Frame = 1
Query:  634 VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLC-IDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQ----VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEV-DGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGG-SNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVF--ITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNS-------IDRETIGSYIIIIKCNDFGFPS---LTSTRVLNIMVEDENDNYPIFHSTLYQFRIPE---NNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTG--SLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTIL-----DVNDHTPKFELQYFF--SIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ------FGIDPISGKIILRSANIDREK-ISRYELKVIA-SDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
             E S   S  ++ F  + ++  IKTL   DRE+L  +    +   +  S    +      + A   +N +  +Q    V + + DVNDN+P FL +   + + E    G  I      DAD  L       +  G+  G+  FN  L     +L L + LDRE  +   L++ A D    +P +    + I + D NDN P++   +  VS+ E  P    +++  A D D G N +V +             R+ F ++S++G + + + LDYE + S    L++ A D G     S+ST V   + V+D NDNPP   + ++ +    +IKE +     + +++ +DPD+G  G+V+  I  +  QL     P  + + + T          IDRE+I ++ + +   D   PS   L++ +++ ++VED NDN P+F S       P+   +      +  V+A D D   NG V Y + S  + +  +  NTG  + T   +F +E   +Y  T+ + D        SS VY+TI+           P+FE +     S+ E+   G ++  V A  L   E      ++ A  S+      F ID   G I+  +A +DRE     YE++V A + GG P     T V + + D ND+PP F          NVS +    H I+ +RA+D D    T   +T++L+
Sbjct: 1186 AELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ--FN--LDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSIS------AGNRRDTFHIDSITGSLYLHKPLDYEDITS--YTLNITASDCGTP---SLSTTVLYNVLVVDDNDNPPIFPSTAIVR----QIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQL-----PQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEV--RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTA-HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLG-ILSTAAELDREAGPEEYEVEVYAIALGGQPR-TSRTKVRVTVLDKNDSPPQFL---DTPFVYNVSEDLQIGHTISTLRAHDPD----TLGSVTFLLM 1861          

HSP 6 Score: 143.28 bits (360), Expect = 8.611e-34
Identity = 156/588 (26.53%), Postives = 258/588 (43.88%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITEN-FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFG--FPS----------------------------------LTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV--------SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH--LQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGET 2466
            +V + + D ND+ P FL++     V E++++G  I   +  D D+ L S   + +DG H GK      L     KL L   LDRE    ++L I   DG       T           ++ P    +  +S  I E+    + + +++A D D+G N ++ Y   +          + F LN  +G + +  +LDYE +Q     L V A+DNG+  + S +  V+  V+D+NDN P    +S S +    + ENV    +V ++S  D D+G  G +   I   +   +  +  +    ++ T  ++DRE   +Y + +   D    F S                                  L+ST  + I+++D ND  P+F S   +  I EN  +   +  V A D D   NG++ Y +    +  +        S++   G L      DRE    Y   + ARD G    S+ S + + ILD ND++P F+  QY  S+ E+++ G  V QV A D+D G N +I Y   L  +   F I   +G ++  + N++ E++SRY L V A D    +  G+T
Sbjct: 1808 KVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDG-HDGKFL----LEPSTGKLILNDTLDRETKSKYELRIRVSDGVQY----TEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVS------DWANDVFSLNPQTGMLTLTARLDYEEVQ--HYILIVQAQDNGQPSL-STTITVYCNVLDLNDNAPIFDPMSYSSE----VFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD---VDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISA-NETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTG-VVRVAKNLNYERLSRYSLTVRAEDCALENPAGDT 2367          

HSP 7 Score: 141.739 bits (356), Expect = 2.336e-33
Identity = 169/621 (27.21%), Postives = 292/621 (47.02%), Query Frame = 1
Query:  802 QFQMTAKADNNNVE-----IIQVLIELEDVNDNSPSFLNSQDTIYVKENV---KLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIG----SYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKE-FDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARF-SQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLS 2613
            ++ +T +A++  +E       ++ I + D+NDN P+FL+S     V EN      G +      DAD+   +++ +         + F  R+      + L+K LDRE    + L + A+D GS P TGT IV + + DINDN P +  +++  +++E++P    ++   A DKD G N K+ +   N+  E   R    F ++S +GEI     LD E  ++    L ++A+D+      + S  + I+V D+NDN P   + + +      + E +   + V      D D G+   V+  I  ++     ++   TK   ++T   +  +T      +Y I+I   D G  SL+S   L +++    + +P F +     F + E+   G+ I  V+AT       G + Y+++       + +D N+G L+  ++  D E +  Y   + A D     L S +L+ L + D ND+ P  E L Y   + E+ +P + +  V+A D D G+N  + Y LQ  F   F I   SG+I  R   +DRE+I  Y   V A D G P   G   V +++ D NDNPP F    ++   +NV+ N      + ++ ++D DL 
Sbjct: 2348 RYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQ-VRYFLKEGDSDLF--RINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRF---NLLGEHMHR----FHIDSETGEISTATTLDRE--ETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYN----VAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDIN---TKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPP-ELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITE-SGEIYTR-MRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF----TRLFSLNVTENAEIGSFVIRVTSSDLDLG 2942          

HSP 8 Score: 140.198 bits (352), Expect = 6.665e-33
Identity = 163/622 (26.21%), Postives = 275/622 (44.21%), Query Frame = 1
Query:  664 SKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTI----YVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARL------------YQDQVKLYL-IKHLD------RELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITEN-FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENI-RNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL-QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRV-LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN-AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
             ++F  N ++  I TL ++DRES+          D   P+      + Q++ +      +++ V++E  D+NDN+P F++    I    +         + +    DADS      + E+      +E F  +             ++ +V+  L +K  D      R   + +  +IT   GGS  +                 P++   +  S S+ E+ PI   I+ + A       + ++ Y   N+       ++   F +++  G +    +LD E   +  E+ ++ IA   G+    +  T V +TV+D ND+PP      L    ++ + E++Q    ++++  +DPDT  G      +D  + + L    P T    L  ++++DRET   Y + I+ +D     +  T     I V D NDN P+F  T+Y F IPEN   G  +G + A D D+ +N  + Y + S+ A  + S++  TG LT +   D E    Y   V A+DNG   LS++  VY  +LD+ND+ P F+ + Y   + E+      V  V A D+D G N  I Y + A    S+FGID  S   I    N+DRE  S Y L V A D
Sbjct: 1538 GRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPS------ERQLSTE------KLVTVIVE--DINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGP--QELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSV----------------PQFEQRSKLSGSVYENEPIGTSILTVTAHLA----SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIAL-GGQP--RTSRTKVRVTVLDKNDSPPQF----LDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFLLMDGHDGKFLL--EPSTG--KLILNDTLDRETKSKYELRIRVSD----GVQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGID--SNGTIRTRRNLDREHRSTYTLTVTARD 2105          

HSP 9 Score: 139.043 bits (349), Expect = 1.689e-32
Identity = 215/795 (27.04%), Postives = 346/795 (43.52%), Query Frame = 1
Query:  634 VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV--KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVI--DINDNPPNIQAISLS--KDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN-----PLTKG--------YSLT---THNSIDRETIGS--YIIIIKCNDFG----FPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETS-DKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ-ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQN-LFDIDSHGGQLFLINKFPTCSYSYEIKVH----IRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTP 2907
            V +SL    ++  F  +  + ++    +LDRES  I   +    D          L+  +++ A         + I + D NDN+P F  S   + V E    G E+ RF+ SDAD  + S     +   +    +     + D +   LYL K LD E + ++ L ITA D G+   + T++ N+ + D NDN P + +      IKE +P+   I+ + A+D D G NGKV Y     + E +      F +N+ +G I   +++D E + +   RL V+A D  +     +ST   +TVI  DINDN P   +++ +    K    K +   V QV +    D D+   G V  EI +   +L  L         T G        Y LT   T  ++  E   S  YI II     G     P       L+  V +   N PI  S L       +  +  ++ +V AT       G V        + +  ID+  G L+ + E DRE   ++Y   V A   G    +S + V +T+LD ND  P+F +  + +++ ED   G T+  + A D D      +T+ L      +F ++P +GK+IL    +DRE  S+YEL++  SDG   +   E    I + D NDNPP+F+         ++  N    + + QI A D+DL Q  + +++Y +              +S + N +F ++   G L L     T    YE   H    ++A D+G P LS+   +   V+ D++D      PI+ P
Sbjct: 1313 VYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD--------AALKHPLSSNA--------SITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTF-----HIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAIS--KQEPQLPQGRHFGINTETGVIHTLREIDRESIDT--FRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHA---KDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYE---NEPIGTSILTVTAHLASAEIEYFVTNVTATGS----RGQV--------DRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLILNDT-LDRETKSKYELRIRVSDGVQYT---EAYATIQVSDTNDNPPLFE---DTVYSFDIPENAQRGYQVGQIVARDADLGQ--NAQLSYGV--------------VSDWANDVFSLNPQTGMLTL-----TARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVL-DLNDNA----PIFDP 2029          

HSP 10 Score: 132.109 bits (331), Expect = 2.432e-30
Identity = 146/576 (25.35%), Postives = 249/576 (43.23%), Query Frame = 1
Query: 1234 SVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHV--IAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYS----------------------FTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGG--HPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISD 2865
            ++S+ E+  +   I      D+D G N ++ Y   N  N++       F +  ++G + +Q+ +  E    P   +HV  +A D G   + S  ++  + + D+ND+ P     S        + E  +   +  +++  D D G  G ++ EI   N + +    P   GY L     +DRE    Y + + C D G PS +S   + I V DENDN P F ++ + F IPEN     ++G + A D+DI  N  + ++LSS  +   +ID+  G +   + FDRE   K S                            DNG   L     V + + DVND+ P+F    Y  +I E ++ G  +  V   D D G N  + Y L       QF +D  +G++ L    +DRE    + L V+A D    HP     +I  + +++ ++ P   Q     ++EV+V         + + RA+D+D  Q  ++++ + +                  ++ F IDS  G L+L   ++     SY+    ++I A D G+P LS+     V V+ D
Sbjct:  951 TISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-------FRIGPVTGVLYLQRPIRAE----PGSLIHVELMATDAGSPPLSSKLSLS-VLIADVNDHTPVFDHTSYET----SLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP--DGY-LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDF-TIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSL-GRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQ----SSSEVSVLETSPTGTELMRFRASDAD--QGVNSQVVFSI-------------SAGNRRDTFHIDSITGSLYLHKPLDYEDITSYT----LNITASDCGTPSLSTTVLYNVLVVDD 1482          

HSP 11 Score: 123.635 bits (309), Expect = 8.188e-28
Identity = 152/523 (29.06%), Postives = 240/523 (45.89%), Query Frame = 1
Query: 1090 LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV-VFITVIDINDNPPNIQAISLSKDKLFK--IKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVI-YSLSSNAEAIVSIDSNTGSLTASK-------EFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAID-LDIGEN----AKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            LD EL   +++ I A DG +       ++ +N+TD NDN P      ++  + E+     LI  + A D+D G+NG V Y  +N            F +   SGEI  + +LD E +   +    V A D G  + H   T  V + ++D NDNPP          +LF   + EN +    V  ++ +D D G     +        +   ++ P +   ++  H  +DRE    YI+ +  +D  + + T    + I ++D+NDN P F  + Y F  PE       +G + ATD+D +    VI YSL      + SID  TG + + K       ++ R   + Y+ TV+A DNG   L S  LV + I+D +++ PKFE  +Y   +P+D+  G+ + +V A D  D+G N    + +T++L + FS   +    G I L    I     +RYEL V A+D G P    ET V I +   N + P F   S  + +V V  N+     I  + A D D
Sbjct: 2768 LDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQN-------DFDGTFEITE-SGEIYTRMRLDREEIG--DYAFVVEAVDQG--VPHMTGTASVLLHLLDKNDNPPKFT-------RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIE-PQSGNITVAGH--LDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQ-QPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFS---VGRHDGWITLVKP-IQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRF---SVNSYQVIVPENEPVGSTILTVGATDDD 3257          

HSP 12 Score: 110.923 bits (276), Expect = 6.128e-24
Identity = 122/452 (26.99%), Postives = 205/452 (45.35%), Query Frame = 1
Query: 1114 FKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDK-DVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEII-HSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ--YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGG 2442
            + L + A D G  P     +VNINI D ++N PK+    +   + +D      I+++ A DK D+G N ++ Y            L + F +    G I + + +       P  R  ++ +     +   S  T V I V   N + P     S        + EN      + ++   D DTG  G +   I   N  Q  S+D    +   +     +D + I  Y + I   D G+  L+S  +L I++ D NDN P+F+   Y   IPEN  +G ++   +A DKD  +N  + Y+   S        ++ + G+++++  FD E    Y+  + A+ N  S + S + +Y+ +L VN+  P+F LQ  + F + E S  G  VG V+A D D GE+ ++ Y L    +   F ID  +G +I  + ++DRE  +R  L V+A + G
Sbjct: 3090 YALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFN------LSSIFSVGRHDGWITLVKPIQV----PPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQ----VIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDE---RTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK-NPDSSMESYANLYVHVLGVNEFYPQF-LQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTG-LIYVARHLDRETQNRVVLTVMAKNYG 3520          

HSP 13 Score: 103.605 bits (257), Expect = 9.107e-22
Identity = 138/571 (24.17%), Postives = 248/571 (43.43%), Query Frame = 1
Query:  802 QFQMTAKADNNNV----EIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHV--IAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSI-------DRETIGSYIIIIKCNDFGFPSLTSTRVLNIMV--EDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIE-ENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAK-ITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            ++++  +A +  V    +  +V+I +   N ++P F  +   + V EN  +G  I     +D D+         + G   G E  +  + +    + + + LD +L+  + L IT  D G +P +   ++ I +TD+NDN P +  + +   I E+ P+   + +  A DKD   N  ++Y F     +     R+FF++N  +G I      DYE     E R++   I   N +  + S + + ++ V+ +N+  P      L     F + E      +V ++   D D+G+ G V        + L+   N   KG+ + T+  +       DRET    ++ +   ++G      T    +++  +D ND  P F    Y   I E   +G  +  V A DKD+  +N    YS+ + N +    ID  TG ++ +   DRE +  Y+  + A D G    + S+ V++ + DVND+ P F  +     I E+   G ++  + A D D+  N    TY L      S   +D  SG ++  + + DRE     E  +   D G P
Sbjct: 3194 RYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISG---GNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD-----RHFFIMNQSNGTISSAVSFDYE-----ERRIYTLQIKAKNPDSSMESYANL-YVHVLGVNEFYPQF----LQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVY-------YLLVGSSN--DKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDP-PEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSG-VVRSTTSFDREMTPILEAIIEVEDSGKP 3735          

HSP 14 Score: 95.9005 bits (237), Expect = 2.278e-19
Identity = 120/475 (25.26%), Postives = 195/475 (41.05%), Query Frame = 1
Query:  844 IIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSK--------------------LFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV-VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDT-GKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGH-VIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDH 2193
            +  + I L DVNDN P F + +   Y+ EN  +G    FQ   AD                          +S     S V  +Y   R+Y  Q+K    K+ D  +     L +  +  G N                +  P+++   F   + E   +   +  + A DKD G +G+VYY      N++       F +++ +G I V + LD E      + L V+AK+ G    +      V I++ D ND P  I+    S      I E      +V ++   D D   +  + +  I N N  Q   +D    +   ++T + +DRE   +Y ++I   D G P  T +  ++I +ED NDN P F        I EN   G  I  + A+D D+  NG    Y L     ++ +S+D N+G + ++  FDRE +      +   D+G     S  L+ +T+LD ND+
Sbjct: 3317 VAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFV-FQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIK---AKNPDSSMESYANLYVHVL--GVN----------------EFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKG------FRIDTNTGLIYVARHLDRETQN--RVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYYTST-----ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKID---VQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDN 3753          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0303223)

HSP 1 Score: 184.496 bits (467), Expect = 2.038e-46
Identity = 231/822 (28.10%), Postives = 368/822 (44.77%), Query Frame = 1
Query:  520 KLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVV--EFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADN----NNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYF--NARLYQDQ-VKLYLI----------KHLDRELVDNFKLVITAID---GGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKED---VPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGS--LTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ-------ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            + L+  ++ EE P+G+ V  + +            S VV    SLLDS     F  + ++  + T   LDRE + +                     F++ A  D+    +    +QV   + D ND+SP+F   Q    ++E   +G  +   + +D D      K+ E++    G E     A L QDQ + ++ I            LDRE  D++ L++TA D     S   T T  V + + D NDN P++    ++V + ED      ++ +  + A D D GNN  + Y    I    +S+    F ++S+SG++ + + LDYE ++S   RL + A+D G     S +T + + VID NDN P        +  L    ENV     +  +   D D G   E+   I  ++       +P T G+ + T   +DRE  G +   +   D G P  +++  + I V+D NDN P F+   Y+  + E+   G  +  V ATD D  E+  + Y +++ N     +I S  G   +T ++  D +   ++  TV A D+G    S ++ V++ I D N+  P FE   Y  S+ ED+  G TV  V A D D+G NA+ITY L             F I+P +G I+  +A +DRE  S Y L V A DGG+PS    T V I + DVNDN P F+ P     + ++  + +    + Q+ A+D D+    + RI Y+L            S   I    F ID   G +   NK           +   AVD GSP LSS   + ++ + D++D
Sbjct:  361 QALYVASVLEEQPAGAAVTTVRA-------RDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVH-------------------YFRVVATDDSFPPRSGTTTLQV--NVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIG----KNAEIE---YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI--IGGNTQSQ----FSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQESVL----ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRT-GW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVT-NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY---QASILEDALVGTSVIQVAASDPDV--GLNGRIKYLL------------SDRDIEDGSFVIDPTSGTI-RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR-LEDVND 1108          

HSP 2 Score: 170.244 bits (430), Expect = 4.420e-42
Identity = 153/501 (30.54%), Postives = 235/501 (46.91%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYL--IKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE--IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL 2319
            Q+L+ + D NDN+P F  SQ    V ENV +G  I R Q  D+D       + E+  S + +   N  L  D    ++  IK LDRE    F   + A DGG  P + +  V I + D+NDN P +  + +  ++ ED P    +  + A D D   + +++YE            R  F + S +G   I + Q LDY+  Q     L V A D+G     S +  V I + D N+  P  +    S      + E+      V  +S  D D G   ++   ++ ++   L   +P +   +  ++ T+  +DRET   Y++ +   D G PSL+ T  + I V D NDN P F S LYQ  I E+ ++G  +  V A+D D+  NG + Y LS     +    ID  +G++  +K  DRE+   +  T IA D G   LSS+  V + + DVND  P F   +    +PE+S  G  VG++ A D D G NA + Y +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEG----ANAEITYS-ISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITT------GNTRGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSA----SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 3 Score: 115.161 bits (287), Expect = 3.287e-25
Identity = 111/350 (31.71%), Postives = 158/350 (45.14%), Query Frame = 1
Query: 1885 PIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS----LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA-----------RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFP--SSKNNEVNVSCNQM---PNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            P F   LY   + E    G  +  V A D    E+  V+YS    L S ++++  +DS TG +T S   DRE  D + F V+A D+     S ++ + + +LD NDH+P FE + F  SI E +  G TV  + A D DIG+NA+I Y ++A               F ID  SG I  RS+ +DRE    Y L V A+D    S Q E         V        +P  S +   V V  +Q     ++ +A IRA D+D  Q  +  I Y ++   +             Q+ F IDS  G + L+         YE     ++ IRA D GSP  S+ T L+V VI
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS-LDRETSDSYHLLVTAADLA--SAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNT-------------QSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVI 680          
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0088214)

HSP 1 Score: 184.496 bits (467), Expect = 2.038e-46
Identity = 231/822 (28.10%), Postives = 368/822 (44.77%), Query Frame = 1
Query:  520 KLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVV--EFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADN----NNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYF--NARLYQDQ-VKLYLI----------KHLDRELVDNFKLVITAID---GGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKED---VPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGS--LTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ-------ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            + L+  ++ EE P+G+ V  + +            S VV    SLLDS     F  + ++  + T   LDRE + +                     F++ A  D+    +    +QV   + D ND+SP+F   Q    ++E   +G  +   + +D D      K+ E++    G E     A L QDQ + ++ I            LDRE  D++ L++TA D     S   T T  V + + D NDN P++    ++V + ED      ++ +  + A D D GNN  + Y    I    +S+    F ++S+SG++ + + LDYE ++S   RL + A+D G     S +T + + VID NDN P        +  L    ENV     +  +   D D G   E+   I  ++       +P T G+ + T   +DRE  G +   +   D G P  +++  + I V+D NDN P F+   Y+  + E+   G  +  V ATD D  E+  + Y +++ N     +I S  G   +T ++  D +   ++  TV A D+G    S ++ V++ I D N+  P FE   Y  S+ ED+  G TV  V A D D+G NA+ITY L             F I+P +G I+  +A +DRE  S Y L V A DGG+PS    T V I + DVNDN P F+ P     + ++  + +    + Q+ A+D D+    + RI Y+L            S   I    F ID   G +   NK           +   AVD GSP LSS   + ++ + D++D
Sbjct:  361 QALYVASVLEEQPAGAAVTTVRA-------RDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVH-------------------YFRVVATDDSFPPRSGTTTLQV--NVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIG----KNAEIE---YGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAI--IGGNTQSQ----FSIDSMSGDVSLVKPLDYESVRS--YRLVIRAQDGGSP-SRSNTTQLLVNVIDANDNAPRFYTSQFQESVL----ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRT-GW-VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVT-NAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLY---QASILEDALVGTSVIQVAASDPDV--GLNGRIKYLL------------SDRDIEDGSFVIDPTSGTI-RTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIR-LEDVND 1108          

HSP 2 Score: 170.244 bits (430), Expect = 4.420e-42
Identity = 153/501 (30.54%), Postives = 235/501 (46.91%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYL--IKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE--IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL 2319
            Q+L+ + D NDN+P F  SQ    V ENV +G  I R Q  D+D       + E+  S + +   N  L  D    ++  IK LDRE    F   + A DGG  P + +  V I + D+NDN P +  + +  ++ ED P    +  + A D D   + +++YE            R  F + S +G   I + Q LDY+  Q     L V A D+G     S +  V I + D N+  P  +    S      + E+      V  +S  D D G   ++   ++ ++   L   +P +   +  ++ T+  +DRET   Y++ +   D G PSL+ T  + I V D NDN P F S LYQ  I E+ ++G  +  V A+D D+  NG + Y LS     +    ID  +G++  +K  DRE+   +  T IA D G   LSS+  V + + DVND  P F   +    +PE+S  G  VG++ A D D G NA + Y +
Sbjct:  674 QLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEG----ANAEITYS-ISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEITT------GNTRGRFAITSQNGRGLITIAQSLDYK--QEKRFLLTVAATDSGGR---SDTATVHINITDANNFAPIFENAPYSA----SVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSI 1152          

HSP 3 Score: 115.161 bits (287), Expect = 3.287e-25
Identity = 111/350 (31.71%), Postives = 158/350 (45.14%), Query Frame = 1
Query: 1885 PIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS----LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA-----------RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFP--SSKNNEVNVSCNQM---PNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            P F   LY   + E    G  +  V A D    E+  V+YS    L S ++++  +DS TG +T S   DRE  D + F V+A D+     S ++ + + +LD NDH+P FE + F  SI E +  G TV  + A D DIG+NA+I Y ++A               F ID  SG I  RS+ +DRE    Y L V A+D    S Q E         V        +P  S +   V V  +Q     ++ +A IRA D+D  Q  +  I Y ++   +             Q+ F IDS  G + L+         YE     ++ IRA D GSP  S+ T L+V VI
Sbjct:  357 PYFEQALYVASVLEEQPAGAAVTTVRARDP---EDSPVVYSMVSLLDSRSQSLFKVDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSS-LDRETSDSYHLLVTAADLA--SAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDAD--QGNNAAIRYAIIGGNT-------------QSQFSIDSMSGDVSLVKPL-----DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVI 680          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 266.929 bits (681), Expect = 1.325e-73
Identity = 242/809 (29.91%), Postives = 397/809 (49.07%), Query Frame = 1
Query:  523 LLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK--ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISL--SKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLL-----SLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKH 2883
            +L+R  + EE P  +L+  +A+   +      +K +V          + Y   + ++ +I  T + +DRE+L      K+C +   P    C L+F+++      N +  +I+  IE++D+NDN+P F +   T+ V EN  +G +    ++ D D++        +         F  ++ +D+     +L ++  LDREL D++ L I A+DGG+ P   + ++ + I D NDN PK+   ++   + E+ PI H ++++ A D D+G NG++ Y      +     LR    ++  SG I V+  LD E + +  ++ +V+A+D G     S  T V I V D NDN P   I+ I L    D +  I E++     VA + V+D D G+   V C +  +  FQL      S+DN   + Y L T   +D E +  Y + I   D G P+L+ST  L + V D NDN PIF  TL++    E N  G+ +  V A+D D   N  ++YS+   S+   +  ID N+G + A    DRE  D+Y F V A D G PSH  ++++V + +LD ND+ PKF L  Y FS+ E+  P   VG V   D+D GENA++   ++    +F I   +G  IL S + DREK S Y  ++ A DGG P       V IN+ D NDN PV   PS+ ++ + +S    P+ ++  + A D D    ++  + Y +    +   PH         +LF I    G++ L  +  T  +S   ++ I+  D G P   +   + + V   I++  H
Sbjct:   25 ILYR--VHEEQPPSTLIGSLAADQGLPDTGHLYKLEV---------GAPYLRVDGKTGDIFTTEIPIDRETL------KDCRNKGKP----CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLR----IDRSSGIIYVKGPLDREEINN--LKFYVVARDKGPSP-KSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDN--KRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVV-IKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTG-TILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSVVEVVEAEDID--SGSNAELVYSI----AGGNPH---------DLFYISPSNGEITLTKEL-TRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSH 784          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 267.7 bits (683), Expect = 3.820e-73
Identity = 242/809 (29.91%), Postives = 397/809 (49.07%), Query Frame = 1
Query:  523 LLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK--ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISL--SKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLL-----SLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKH 2883
            +L+R  + EE P  +L+  +A+   +      +K +V          + Y   + ++ +I  T + +DRE+L      K+C +   P    C L+F+++      N +  +I+  IE++D+NDN+P F +   T+ V EN  +G +    ++ D D++        +         F  ++ +D+     +L ++  LDREL D++ L I A+DGG+ P   + ++ + I D NDN PK+   ++   + E+ PI H ++++ A D D+G NG++ Y      +     LR    ++  SG I V+  LD E + +  ++ +V+A+D G     S  T V I V D NDN P   I+ I L    D +  I E++     VA + V+D D G+   V C +  +  FQL      S+DN   + Y L T   +D E +  Y + I   D G P+L+ST  L + V D NDN PIF  TL++    E N  G+ +  V A+D D   N  ++YS+   S+   +  ID N+G + A    DRE  D+Y F V A D G PSH  ++++V + +LD ND+ PKF L  Y FS+ E+  P   VG V   D+D GENA++   ++    +F I   +G  IL S + DREK S Y  ++ A DGG P       V IN+ D NDN PV   PS+ ++ + +S    P+ ++  + A D D    ++  + Y +    +   PH         +LF I    G++ L  +  T  +S   ++ I+  D G P   +   + + V   I++  H
Sbjct:   25 ILYR--VHEEQPPSTLIGSLAADQGLPDTGHLYKLEV---------GAPYLRVDGKTGDIFTTEIPIDRETL------KDCRNKGKP----CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLR----IDRSSGIIYVKGPLDREEINN--LKFYVVARDKGPSP-KSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDN--KRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVV-IKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDVGKFVIQNGTG-TILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKPSN-SSFIRLSPMAAPDSVVEVVEAEDID--SGSNAELVYSI----AGGNPH---------DLFYISPSNGEITLTKEL-TRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNETIANVSH 784          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 258.455 bits (659), Expect = 3.533e-71
Identity = 224/670 (33.43%), Postives = 340/670 (50.75%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS---DADSKLFSTKSIEVDGSHVGKEYFNARL---YQDQVKLYLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA------IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ--ARFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQG 2460
             R +I EE   G+ V  +A  + I    KT K +   F ++ +     F  N+    +    KLDRE         N C+  +P    C++  ++   A  N +EI  V +++ DVND++P F   +  + + E V  G   RFQ+    D DS   S ++ ++  SH   EYF   +   Y+D     LI  K LDRE+  + KL +TA+DGG  P +G + + I++ DINDN P +I E +SV++ E+ P+   I+++ A D D G NG V Y   +  N+   +LR  F +N ++GEI V   LD+E     EI +   A D G   + +  +V  I + D+NDN P I+  SLS      I E+ +    VA ISV+D D+G  G V C + +N  FQL+      T  YSL T +++DRETI  Y I ++  D G P L+S + + + + D NDN P F S+ Y F + ENN  G+ +  V+A+DKD   N  V Y +  +  A       ++I+S  G + A K FD ETS  + F ++A D+G   LSS+  V + ILD ND+ P            +    IP + N G  V +V A D DIG N  + + LQ  +  S F +D  +G+I  LRS     E  ++++L ++  D G+ S   
Sbjct:   33 IRYSISEEQKDGTAVGNVAKDLGIDP--KTLKER--GFRIVSTSGESMFSVNQNDGVLYVKGKLDRE---------NVCERSTP----CLINLKI---ALENPLEIHYVTVDVIDVNDHAPMFPEQEKRLEISETVLPG--ARFQLQAARDPDSGSNSVQTYKL--SHT--EYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVND---KLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQ--ASDKGIAPLTTDKSVT-IKIADVNDNEPQIEVTSLSS----TIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENT--YSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDE--AQHKLVILVKDNGNVSLSA 662          

HSP 2 Score: 149.058 bits (375), Expect = 6.428e-36
Identity = 177/617 (28.69%), Postives = 283/617 (45.87%), Query Frame = 1
Query: 1288 AEDKDVGNNGKVYYEF---ENIRNEEESRLRNFFLLNSLSGEIRV---QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA--EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL------QARFSQF-GIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVN----VSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGI--------LCLLKRKYS---LQESNY 3030
            A D D G+N    Y+    E  R E + R  +        G++ V   Q+ LD E  +S  I+L + A D G        T++ I V+DINDN P    + + +     + EN      +  ++  D D G+ G V      ++++K  +L ++ NP+T    +T    +D E    Y I I+ +D G   LT+ + + I + D NDN P    T     IPE++  G  +  ++ +D D   NG V  SLS N   + + S   NT SL  +   DRET   Y  T+ A+D G   LSS   V + I DVND++P+F    Y F + E++ PGK++  V A D D G N+ ++Y +      + +F+ F  I+  +G+I  L+S   D E    ++  ++A+D G PS      VN+ I D NDN PV  +P S N        +  N    HL+ ++RA D+D+         ++L     V+            +LF +D + GQ+  +  F T +   + K+ I   D+G+  LS+   +IVKV+     +    + +   EK      +   ++ T   +S LF I         C     YS   LQ++NY
Sbjct:  159 ARDPDSGSNSVQTYKLSHTEYFRIEIKDRYED--------GKVPVLILQKPLDREVTKS--IKLQLTALDGGRPPKSGKMTII-IDVLDINDNAP----VFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNV-NPVTGEIVVT--GLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKS--FDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYN-----GWLLFSLQEVS----------DHSLFALDRYTGQIRTLRSF-TETDEAQHKLVILVKDNGNVSLSATATVIVKVVE--PKEAFAASDVKNAEKDEEENNVTFYLIITLGSVSVLFVISIIVLIVMQCSKSTDYSSKYLQDTNY 737          

HSP 3 Score: 144.436 bits (363), Expect = 1.997e-34
Identity = 151/527 (28.65%), Postives = 237/527 (44.97%), Query Frame = 1
Query: 1297 KDVGNNGKVYYE--FENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL---QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS--LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA----EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK---IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSS 2832
            KD+G + K   E  F  +    ES     F +N   G + V+ KLD E +    +P +    IA +N  EI +     V + VID+ND+ P        ++K  +I E V    +    +  DPD+G       ++ +  +  + + +    G    L     +DRE   S  + +   D G P  +    + I V D NDN P+F   +Y   + EN  +G  I  VNATD D  +NG V+YSL  +       + +++  TG +  +   D E  D Y   + A D G + L++   V + I DVND+ P+ E+    S IPEDS PG TV  +   DLD G N ++T  L      F + P S +    ++ ++ +DRE I+ Y++ + A D G P       V + I DVNDN P F   SS      V  N  P   +  + A+D D     ++ ++Y +               + + +  +I+S  G+++ +  F     S   + HI A D GSP LSS
Sbjct:   52 KDLGIDPKTLKERGFRIVSTSGES----MFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALENPLEIHY-----VTVDVIDVNDHAPMFP----EQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIP-FQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEF---SSSPYAFYVMENNAPGKSLFSVSASDKD--TGANSAVSYQIW--------RDGGAENKFTSFININSENGEIYALKSF-DFETSKTFQFHILATDSGSPSLSS 550          

HSP 4 Score: 55.0694 bits (131), Expect = 6.265e-7
Identity = 95/346 (27.46%), Postives = 158/346 (45.66%), Query Frame = 1
Query: 1909 QFRIPENNVLGQYIGHVNATD-----KDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTV-----IARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPIS----GKI--ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEV-NVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIK----VHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            ++ I E    G  +G+V A D     K ++E G  I  +S++ E++ S++ N G L    + DRE   + S        IA +N P  +     V + ++DVNDH P F E +    I E   PG       A D D G N+  TY L +    F I+       GK+  ++    +DRE     +L++ A DGG P   G+  + I++ D+NDN PVF        EV +V+ N+        +R N +DL +  +  + Y L     VN           + LF+++   G++ +     T    +E+K    + I+A D G   L++   + +K I+D++D +
Sbjct:   34 RYSISEEQKDGTAVGNV-AKDLGIDPKTLKERGFRI--VSTSGESMFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALEN-PLEIH---YVTVDVIDVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKL-SHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFI------KEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSL--GHDVN--------DKLRKLFNVNPVTGEIVV-----TGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIK-IADVNDNE 349          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh2aa15 (protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GENE-041118-15])

HSP 1 Score: 258.455 bits (659), Expect = 4.101e-71
Identity = 226/672 (33.63%), Postives = 341/672 (50.74%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS---DADSKLFSTKSIEVDGSHVGKEYFNARL---YQDQVKLYLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSIST--VVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA------IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ--ARFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQG 2460
             R +I EE   G+ V  +A  + I    KT K +   F ++ +     F  N+    +    KLDRE         N C+  +P    C++  ++   A  N +EI  V +++ DVND++P F   +  + + E V  G   RFQ+    D DS   S ++ ++  SH   EYF   +   Y+D     LI  K LDRE+  + KL +TA+DGG  P +G + + I++ DINDN P +I E +SV++ E+ P+   I+++ A D D G NG V Y   +  N+   +LR  F +N ++GEI V   LD+E     EI +   A D G   I  ++T   V I + D+NDN P I+  SLS      I E+ +    VA ISV+D D+G  G V C + +N  FQL+      T  YSL T +++DRETI  Y I ++  D G P L+S + + + + D NDN P F S+ Y F + ENN  G+ +  V+A+DKD   N  V Y +  +  A       ++I+S  G + A K FD ETS  + F ++A D+G   LSS+  V + ILD ND+ P            +    IP + N G  V +V A D DIG N  + + LQ  +  S F +D  +G+I  LRS     E  ++++L ++  D G+ S   
Sbjct:   33 IRYSISEEQKDGTAVGNVAKDLGIDP--KTLKER--GFRIVSTSGESMFSVNQNDGVLYVKGKLDRE---------NVCERSTP----CLINLKI---ALENPLEIHYVTVDVIDVNDHAPMFPEQEKRLEISETVLPG--ARFQLQAARDPDSGSNSVQTYKL--SHT--EYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVND---KLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQ--ASDKG---IAPLTTDKSVTIKIADVNDNEPQIEVTSLSS----TIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENT--YSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKSFDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFALDRYTGQIRTLRSFTETDE--AQHKLVILVKDNGNVSLSA 662          

HSP 2 Score: 148.673 bits (374), Expect = 7.842e-36
Identity = 177/617 (28.69%), Postives = 283/617 (45.87%), Query Frame = 1
Query: 1288 AEDKDVGNNGKVYYEF---ENIRNEEESRLRNFFLLNSLSGEIRV---QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA--EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL------QARFSQF-GIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVN----VSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGI--------LCLLKRKYS---LQESNY 3030
            A D D G+N    Y+    E  R E + R  +        G++ V   Q+ LD E  +S  I+L + A D G        T++ I V+DINDN P    + + +     + EN      +  ++  D D G+ G V      ++++K  +L ++ NP+T    +T    +D E    Y I I+ +D G   LT+ + + I + D NDN P    T     IPE++  G  +  ++ +D D   NG V  SLS N   + + S   NT SL  +   DRET   Y  T+ A+D G   LSS   V + I DVND++P+F    Y F + E++ PGK++  V A D D G N+ ++Y +      + +F+ F  I+  +G+I  L+S   D E    ++  ++A+D G PS      VN+ I D NDN PV  +P S N        +  N    HL+ ++RA D+D+         ++L     V+            +LF +D + GQ+  +  F T +   + K+ I   D+G+  LS+   +IVKV+     +    + +   EK      +   ++ T   +S LF I         C     YS   LQ++NY
Sbjct:  159 ARDPDSGSNSVQTYKLSHTEYFRIEIKDRYED--------GKVPVLILQKPLDREVTKS--IKLQLTALDGGRPPKSGKMTII-IDVLDINDNAP----VFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNV-NPVTGEIVVT--GLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIPFQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEFSSSPYAFYVMENNAPGKSLFSVSASDKDTGANSAVSYQIWRDGGAENKFTSFININSENGEIYALKS--FDFETSKTFQFHILATDSGSPSLSSNVTVNVFILDQNDNVPVILYPVSANGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYN-----GWLLFSLQEVS----------DHSLFALDRYTGQIRTLRSF-TETDEAQHKLVILVKDNGNVSLSATATVIVKVVE--PKEAFAASDVKNAEKDEEENNVTFYLIITLGSVSVLFVISIIVLIVMQCSKSTDYSSKYLQDTNY 737          

HSP 3 Score: 144.05 bits (362), Expect = 2.372e-34
Identity = 151/527 (28.65%), Postives = 237/527 (44.97%), Query Frame = 1
Query: 1297 KDVGNNGKVYYE--FENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL---QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS--LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA----EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK---IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSS 2832
            KD+G + K   E  F  +    ES     F +N   G + V+ KLD E +    +P +    IA +N  EI +     V + VID+ND+ P        ++K  +I E V    +    +  DPD+G       ++ +  +  + + +    G    L     +DRE   S  + +   D G P  +    + I V D NDN P+F   +Y   + EN  +G  I  VNATD D  +NG V+YSL  +       + +++  TG +  +   D E  D Y   + A D G + L++   V + I DVND+ P+ E+    S IPEDS PG TV  +   DLD G N ++T  L      F + P S +    ++ ++ +DRE I+ Y++ + A D G P       V + I DVNDN P F   SS      V  N  P   +  + A+D D     ++ ++Y +               + + +  +I+S  G+++ +  F     S   + HI A D GSP LSS
Sbjct:   52 KDLGIDPKTLKERGFRIVSTSGES----MFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALENPLEIHY-----VTVDVIDVNDHAPMFP----EQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKLSHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFIKEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSLGHDVNDKLRKLFNVNPVTGEIVVTGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIKIADVNDNEPQIEVTSLSSTIPEDSKPGTTVALISVSDLDSGINGRVTCSLSENIP-FQLMPSSQENTYSLVTTSALDRETIAHYDITLEAKDAGQPPLSSVKSVTVQISDVNDNSPEF---SSSPYAFYVMENNAPGKSLFSVSASDKD--TGANSAVSYQIW--------RDGGAENKFTSFININSENGEIYALKSF-DFETSKTFQFHILATDSGSPSLSS 550          

HSP 4 Score: 55.0694 bits (131), Expect = 6.649e-7
Identity = 95/344 (27.62%), Postives = 157/344 (45.64%), Query Frame = 1
Query: 1909 QFRIPENNVLGQYIGHVNATD-----KDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTV-----IARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPIS----GKI--ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEV-NVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIK----VHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            ++ I E    G  +G+V A D     K ++E G  I  +S++ E++ S++ N G L    + DRE   + S        IA +N P  +     V + ++DVNDH P F E +    I E   PG       A D D G N+  TY L +    F I+       GK+  ++    +DRE     +L++ A DGG P   G+  + I++ D+NDN PVF        EV +V+ N+        +R N +DL +  +  + Y L     VN           + LF+++   G++ +     T    +E+K    + I+A D G   L++   + +K I+D++D
Sbjct:   34 RYSISEEQKDGTAVGNV-AKDLGIDPKTLKERGFRI--VSTSGESMFSVNQNDGVLYVKGKLDRENVCERSTPCLINLKIALEN-PLEIH---YVTVDVIDVNDHAPMFPEQEKRLEISETVLPGARFQLQAARDPDSGSNSVQTYKL-SHTEYFRIEIKDRYEDGKVPVLILQKPLDREVTKSIKLQLTALDGGRPPKSGKMTIIIDVLDINDNAPVFI------KEVYSVTLNENTPVGTTILRVNATDLDEGQNGVVVYSL--GHDVN--------DKLRKLFNVNPVTGEIVV-----TGLLDFEVKDIYEIDIQASDKGIAPLTTDKSVTIK-IADVND 347          
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Match: pcdh2ab9 (protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GENE-041118-8])

HSP 1 Score: 257.299 bits (656), Expect = 1.935e-70
Identity = 204/666 (30.63%), Postives = 330/666 (49.55%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE----VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAI-----VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF------FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ--ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGET 2466
             R +++EEL SG++V  +   +     ++  K       +      +YF  N ++ ++    ++DRE+LC   E    C           L   + +  + ++V++     E+ D NDNSP F   +  + + E  + G   RF +  A     ++ S+         H+  +         QV+L L K  DREL+ + + +ITA DGGS P +GT  +N+ + D NDN P + +  + V ++E+ P+  L+IKL A D+D G+NG+VYY F +   +   ++R  F +++ SGEIRV+  +DYE   S E  +++ A D G+  + ++   V + V+D+NDNPP I   SLS      ++E+ +    VA IS+ND D+G+  +V+ +I   +  F++ S  N     Y++ T   +DRETI SY + +   D G P L+S+  + + V D NDN P F  T Y   + ENN     +  + ATD D  EN  + Y+ L+ N   +     VS+   TG + A + FD E   ++ F V A+DNG   LS  + VY+ I+D NDH+PKF            +I   S  G  V +  A DLD GENA + Y+L        F I   +G+ I  +  +  +  + + L V   D G P+    T
Sbjct:   33 IRYSVQEELESGTVVGDLVRDLG----LELRKLSARRIRISSDTARRYFNINHKTGKLVISDRIDRETLC---EFSGTC--------TLSLDVVLESPFEQHSVDV-----EILDANDNSPLFPRDEYQLEISEGAQPG--ARFSIEGAQDSDDASNSVRHYRLTPNEHLALDSTKPPADGKQVELVLKKPFDRELLQSHQFLITATDGGSPPRSGTARINVRVLDTNDNVPVFDSSVYKVKLRENSPVGALVIKLNATDRDEGSNGEVYYSFSSYTPD---KVRQMFSVDADSGEIRVKSNVDYEETNSYE--MYIQAADRGQGAV-AVHCKVVVEVLDVNDNPPEIVLSSLSS----PVREDARADTVVALISINDKDSGQNKQVSLDIIPPDLPFKIKSFRN----HYTIVTSALLDRETISSYNVTVTATDGGTPPLSSSMTVRVEVADINDNPPRFKQTSYTVYVSENNAPSAPLCVIKATDPDAGENARITYTILTDNNHGVSVGSYVSVKPATGEVYALRSFDFEKLREFHFQVKAQDNGVPPLSRVATVYIYIMDSNDHSPKFARAVVNGSHSTETILRHSEAGVLVSRALAWDLDAGENAWLLYNLHHAPELDLFKIHEHTGE-IRTTRRVIEDNSTVFSLTVHVRDHGSPARSAST 661          

HSP 2 Score: 144.821 bits (364), Expect = 1.559e-34
Identity = 127/440 (28.86%), Postives = 208/440 (47.27%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYL----QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPL-TKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS----NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK-IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
            R +F +N  +G++ +  ++D E L     +  + L V+ +   E+  HS+     + ++D NDN P        +D+   +I E  Q   + +     D D       +  +  N++  L S   P   K   L      DRE + S+  +I   D G P  + T  +N+ V D NDN P+F S++Y+ ++ EN+ +G  +  +NATD+D   NG V YS SS        + S+D+++G +      D E ++ Y   + A D G   ++    V + +LDVND+ P+  L    S + ED+     V  +   D D G+N +++  +      F I        I+ SA +DRE IS Y + V A+DGG P       V + + D+NDNPP F+     +  V VS N  P+  +  I+A D D  +  + RITY +L
Sbjct:   74 RRYFNINHKTGKLVISDRIDRETLCEFSGTCTLSLDVVLESPFEQ--HSVD----VEILDANDNSP-----LFPRDEYQLEISEGAQPGARFSIEGAQDSDDASNSVRHYRLTPNEHLALDSTKPPADGKQVELVLKKPFDRELLQSHQFLITATDGGSPPRSGTARINVRVLDTNDNVPVFDSSVYKVKLRENSPVGALVIKLNATDRDEGSNGEVYYSFSSYTPDKVRQMFSVDADSGEIRVKSNVDYEETNSYEMYIQAADRGQGAVAVHCKVVVEVLDVNDNPPEIVLSSLSSPVREDARADTVVALISINDKDSGQNKQVSLDIIPPDLPFKIKSFRNHYTIVTSALLDRETISSYNVTVTATDGGTPPLSSSMTVRVEVADINDNPPRFK---QTSYTVYVSENNAPSAPLCVIKATDPDAGE--NARITYTIL 497          

HSP 3 Score: 91.2781 bits (225), Expect = 4.759e-18
Identity = 118/470 (25.11%), Postives = 205/470 (43.62%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLY------------QDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN-----PLT-KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF--------HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDV 2184
            + + D NDN P F +S   + ++EN  +G  + +   +D D           +GS+ G+ Y++   Y             D  ++ +  ++D E  +++++ I A D G         V + + D+NDN P+ +  + S  ++ED   + ++  +   DKD G N +V  +   I  +   ++++F   N  +  I     LD E + S    + V A D G   + S S  V + V DINDNPP  +  S +      + EN      +  I   DPD G+   +   I   N   +S+ +     P T + Y+L    S D E +  +   +K  D G P L+    + I + D ND+ P F        HST    R  E  VL   +    A D D  EN  ++Y+L    E  +  I  +TG +  ++    + S  +S TV  RD+G    S+S+ + + ++++
Sbjct:  232 VRVLDTNDNVPVFDSSVYKVKLRENSPVGALVIKLNATDRD-----------EGSN-GEVYYSFSSYTPDKVRQMFSVDADSGEIRVKSNVDYEETNSYEMYIQAADRGQGAVAVHCKVVVEVLDVNDNPPEIVLSSLSSPVREDARADTVVALISINDKDSGQNKQVSLDI--IPPDLPFKIKSF--RNHYT--IVTSALLDRETISS--YNVTVTATDGGTPPLSS-SMTVRVEVADINDNPPRFKQTSYT----VYVSENNAPSAPLCVIKATDPDAGENARITYTILTDNNHGVSVGSYVSVKPATGEVYAL---RSFDFEKLREFHFQVKAQDNGVPPLSRVATVYIYIMDSNDHSPKFARAVVNGSHSTETILRHSEAGVL---VSRALAWDLDAGENAWLLYNLHHAPELDLFKIHEHTGEIRTTRRVIEDNSTVFSLTVHVRDHGSPARSASTTINVAVMEL 670          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:Xenbase;Acc:XB-GENE-996716])

HSP 1 Score: 263.848 bits (673), Expect = 1.857e-73
Identity = 215/670 (32.09%), Postives = 339/670 (50.60%), Query Frame = 1
Query:  517 LKLLFRQTIKEELPSGSLVLQIAS--PVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQ-VSDADSKLFSTKSIEVDGSHVGKEYF--NARLYQDQVK---LYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL--------QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHP 2448
            + L    TI EEL   SL+  IA+   +++   M         F ++  +  KYF  N  +  +    ++DRE +C                 +CIL F    +   N + +  V IE++D+NDN P F +   T+ + E+   G     Q   D D  + + ++ ++  +     YF  N +   D  K   L LIK LDRE     +L++TA DGG+   TGT I+ + +TD+NDN P +  E + VSI E+ PIN  ++ + A D D G N ++ Y F   +  E S   + F +++++GEIR +  LD+E  ++ EI +   AKD G  + H     V I +ID NDN P I   SLS      I EN      +A + V+D D+G+ GEV+C+I  +  FQL+S     ++ Y + + + +DRE +  Y I I  ND G P + S +V+ + + D NDN P+F  + Y   +PENN+ G  I  + A+D D+ +N  VIYS+S SN E     +  SI+  TG L + + FD E    +   ++ARD G   LS+++ +++ I D ND+ PK             F ++P  S PG  + +V A+D D G N+ ++YH      Q  F I+  +G+I +LR+  I  + I R++  V+  D G P
Sbjct:   32 VSLQLHYTIVEELRKNSLIANIATDLGLDVKDLMPRR------FRIVSRVSEKYFSVNLVNGNVYVKERIDREKIC-------------KATAICILTFDAVVE---NPLNVFSVKIEIQDINDNPPMFFHDTITLEIIESTTPGTHLVLQNAEDPDIGINAVQTYKLSDNL----YFALNEKTSSDGSKIPELVLIKSLDRETQTIHELILTAFDGGNPVKTGTAIIRVIVTDVNDNMPVFTEELYKVSISENTPINSTVLAVNATDDDEGTNAQISYSFS--KTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQ--AKDGGGYVAH---CKVLIHIIDENDNAPEISITSLSS----PILENSTLGTVIALVEVHDQDSGENGEVDCQIMGSVPFQLVS---STSRYYRIISSSVLDREKVSWYNITILANDRGRPQMHSRKVIRLDISDVNDNPPLFLKSTYVAYLPENNIPGASIYKIQASDLDLGDNAKVIYSISNSNTEDFAVSSFFSINIETGVLYSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIYITDQNDNAPKILYPPSESSVSAVFETVPFASEPGLLITKVVAVDADSGHNSLLSYHFVQISEQFPFNINEHTGEIRVLRA--IQEKDILRHKAVVMVKDNGDP 659          

HSP 2 Score: 129.798 bits (325), Expect = 6.908e-30
Identity = 150/542 (27.68%), Postives = 247/542 (45.57%), Query Frame = 1
Query: 1375 FFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV--VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQL---LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVN-VSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLV 2946
            +F +N ++G + V++++D E +     +   I     + ++ +   V  V I + DINDNPP     +++ + +         V Q A     DPD G       ++ DN  F L    S D   +K   L    S+DRET   + +I+   D G P  T T ++ ++V D NDN P+F   LY+  I EN  +   +  VNATD D   N  + YS S  +E     ++ SI +  G +      D E S+ +  +V A+D G        L++  I+D ND+ P+  +    S I E+S  G  +  VE  D D GEN ++   +        +   S    I+ S+ +DREK+S Y + ++A+D G P      ++ ++I DVNDNPP+F     K+  V  +  N +P   I +I+A+D DL    + ++ Y        +  +  +      + F I+   G L     +   S+ YE     ++ I A D GSP LS+   L +     I+D+  +   I  P  +S  +A+   V
Sbjct:   79 YFSVNLVNGNVYVKERIDREKI----CKATAICILTFDAVVENPLNVFSVKIEIQDINDNPPMFFHDTITLEIIESTTPGTHLVLQNAE----DPDIGINAVQTYKLSDNLYFALNEKTSSDG--SKIPELVLIKSLDRETQTIHELILTAFDGGNPVKTGTAIIRVIVTDVNDNMPVFTEELYKVSISENTPINSTVLAVNATDDDEGTNAQISYSFSKTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQAKDGGGYVAHCKVLIH--IIDENDNAPEISITSLSSPILENSTLGTVIALVEVHDQDSGENGEVDCQIMGSVPFQLVSSTSRYYRIISSSVLDREKVSWYNITILANDRGRPQMHSRKVIRLDISDVNDNPPLFL----KSTYVAYLPENNIPGASIYKIQASDLDLGD--NAKVIY--------SISNSNTEDFAVSSFFSINIETGVL-----YSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIY----ITDQNDNAPKILYPPSESSVSAVFETV 585          

HSP 3 Score: 78.9518 bits (193), Expect = 4.480e-14
Identity = 145/582 (24.91%), Postives = 235/582 (40.38%), Query Frame = 1
Query:  523 LLFRQTIKEEL-----PSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSS-------EIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRV--QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN---FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDN-----YPIFHSTLYQF--RIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI-VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILD 2181
            + F  TI  E+     P   LVLQ A   +I  + ++T+K            D+ YF  N+++S       E+  +  LDRE+  I   +    D  +P                     II+V++   DVNDN P F      + + EN  +       V+  D    +   I    S   +   +  ++       ++    +LD E+ +NF++ + A DGG         V I+I D NDN P+    + S  I E+  +  +I  +   D+D G NG+V  +              F L++S S   R+     LD E +    I   ++A D G   +HS   V+ + + D+NDNPP    + L    +  + EN      +  I  +D D G   +V   I N N   F + S  +   +   L +  S D E    + + I   D G P L++   L I + D+NDN     YP   S++      +P  +  G  I  V A D D   N  + Y     +E    +I+ +TG +   +    +   ++   V+ +DNG  HLS +  V L I D
Sbjct:  137 MFFHDTITLEIIESTTPGTHLVLQNAEDPDIGINAVQTYKLS----------DNLYFALNEKTSSDGSKIPELVLIKSLDRETQTIHELILTAFDGGNPV---------------KTGTAIIRVIVT--DVNDNMPVFTEELYKVSISENTPINS-TVLAVNATDDDEGTNAQISYSFSKTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQAKDGGGY--VAHCKVLIHIIDENDNAPEISITSLSSPILENSTLGTVIALVEVHDQDSGENGEVDCQIMG--------SVPFQLVSSTSRYYRIISSSVLDREKVSWYNIT--ILANDRGRPQMHS-RKVIRLDISDVNDNPP----LFLKSTYVAYLPENNIPGASIYKIQASDLDLGDNAKVIYSISNSNTEDFAVSSFFSINIETGVLYSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIYITDQNDNAPKILYPPSESSVSAVFETVPFASEPGLLITKVVAVDADSGHNSLLSYHFVQISEQFPFNINEHTGEIRVLRAIQEKDILRHKAVVMVKDNGDPHLSVTVTVSLVIGD 673          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000039468.1 (protocadherin gamma-B5-like [Source:NCBI gene;Acc:108646230])

HSP 1 Score: 261.151 bits (666), Expect = 1.053e-72
Identity = 215/669 (32.14%), Postives = 341/669 (50.97%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLL--DS-MDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEY-FNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL--------QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHPSFQG 2460
             + +I EE+  GSL+  +A  + ++        K + F  L  DS +  KYF  N ++  +    ++DRE+LC+             T + C L F    +   N + +  V I+++D+NDN P+F +    + + E    G   RF +  A+       S+E       K +    R   D     +L L   LDRE     +LV+TA DGG+   TGT I+ I ++D NDN P +  E ++VS+ E++P+N  I+++ A DKD G+N ++ Y F         +  N F+++S+SGE++ ++ LD+E ++  EI +   AKD G  + H+    + I +ID NDN P I   S++      I E+      VA I  +D D+G+ GEV+CEI     F+LLS        Y + T NS+DRE    Y I I+  D G P LT+ +++ + V D NDN P+F    Y   +PENN  G  I  + A DKD EEN  + YS +SSN E     + +SI+  TG + A + FD E   ++   ++A+D+G   L+SS+ + + I+D ND+ P              +  +P  S  G  V +V A+D+D G NA ++YH    A  S F ID  +G+I  R++ + +E+ + R+++ VI  D G PS   
Sbjct:   42 LQYSISEEMQKGSLIGNLAKDLGLNI-------KEIAFRKLRIDSDISDKYFKVNLENGNLYVADRIDREALCV-------------TTEECFLTFDAVIE---NPLNVFHVKIDIKDINDNPPTFAHEIIELKMSEFTIPG--TRFALEKAEDLDVGKNSLESYKLSANKHFVLTERTSSDTSTIPELVLEAPLDRETESIHELVLTAFDGGNPVQTGTAIIKIIVSDFNDNAPIFTQEVYTVSLNENIPVNSTILRVSANDKDEGSNSQITYYFA----ASSKQAMNTFIIDSISGEVKTKENLDFEKIKHYEISVQ--AKDGGGLVSHA---KILIQIIDENDNAPGITITSINT----PISEDSAPGTVVALIKAHDLDSGENGEVDCEIMGTVPFKLLSSSGNF---YKIVTTNSLDREKSPYYNITIQAIDRGSPPLTAKKIIRLDVSDINDNSPLFEKLTYVAYVPENNHPGASIYSIQAIDKDTEENAKLTYSIISSNTEEPSSASYISINPVTGIIYAQRSFDYEQEREFQIQIMAKDHGSPSLNSSTNLRICIVDQNDNFPTILYPSGDVGGSAAYEMVPFSSEQGTLVTKVVAVDIDSGHNAWLSYHFLQDAETSHFIIDQYTGEI--RTSRVFQERDVLRHKVVVIVKDNGTPSLSA 667          

HSP 2 Score: 125.176 bits (313), Expect = 1.921e-28
Identity = 159/553 (28.75%), Postives = 253/553 (45.75%), Query Frame = 1
Query: 1240 SIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL--QSPEIRLHVIAK-DNGEEIIHSISTVVFITVIDINDNPPNI--QAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVS---IDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKI--ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            SI E++    LI  L    KD+G N K    F  +R + +   + +F +N  +G + V  ++D E L   + E  L   A  +N   + H     V I + DINDNPP    + I L      K+ E      + A     D D GK    + ++  NK+F L    +  T     L     +DRET   + +++   D G P  T T ++ I+V D NDN PIF   +Y   + EN  +   I  V+A DKD   N  + Y  +++++  ++   IDS +G +   +  D E    Y  +V A+D G   L S + + + I+D ND+ P   +    + I EDS PG  V  ++A DLD GEN ++   +      F +   SG    I+ + ++DREK   Y + + A D G P    + I+ +++ D+NDN P+F+          V  N  P   I  I+A D D  +  + ++TY ++   S N   P S      +   I+   G ++    F       E ++ I A DHGSP L+S T L + ++
Sbjct:   45 SISEEMQKGSLIGNLA---KDLGLNIK-EIAFRKLRIDSDISDK-YFKVNLENGNLYVADRIDREALCVTTEECFLTFDAVIENPLNVFH-----VKIDIKDINDNPPTFAHEIIEL------KMSEFTIPGTRFALEKAEDLDVGKNSLESYKLSANKHFVLTERTSSDTSTIPELVLEAPLDRETESIHELVLTAFDGGNPVQTGTAIIKIIVSDFNDNAPIFTQEVYTVSLNENIPVNSTILRVSANDKDEGSNSQITYYFAASSKQAMNTFIIDSISGEVKTKENLDFEKIKHYEISVQAKDGG--GLVSHAKILIQIIDENDNAPGITITSINTPISEDSAPGTVVALIKAHDLDSGENGEVDCEIMGTVP-FKLLSSSGNFYKIVTTNSLDREKSPYYNITIQAIDRGSPPLTAKKIIRLDVSDINDNSPLFE---KLTYVAYVPENNHPGASIYSIQAIDKDTEE--NAKLTYSII---SSNTEEPSS-----ASYISINPVTGIIYAQRSF-DYEQEREFQIQIMAKDHGSPSLNSSTNLRICIV 564          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: dnajb13 (DnaJ heat shock protein family (Hsp40) member B13 [Source:Xenbase;Acc:XB-GENE-996716])

HSP 1 Score: 260.766 bits (665), Expect = 1.413e-72
Identity = 211/661 (31.92%), Postives = 338/661 (51.13%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQ-VSDADSKLFSTKSIEVDGSHVGKEYF--NARLYQDQVK---LYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL--------QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHP 2448
            +I EEL   S++  IA  + ++        + ++F ++  +  KYF  N  +  +    ++DRE +C                 +CIL F    +   N + +  V IE++D+NDN P F +   T+ + E+   G     Q   D D  + + ++ ++  +     YF  N +   D  K   L LIK LDRE     +L++TA DGG+   TGT I+ + +TD+NDN P +  E + VSI E+ PIN  ++ + A D D G N ++ Y F   +  E S   + F +++++GEIR +  LD+E  ++ EI +   AKD G  + H     V I +ID NDN P I   SLS      I EN      +A + V+D D+G+ GEV+C+I  +  FQL+S     ++ Y + + + +DRE +  Y I I  ND G P + S +V+ + + D NDN P+F  + Y   +PENN+ G  I  + A+D D+ +N  VIYS+S SN E     +  SI+  TG L + + FD E    +   ++ARD G   LS+++ +++ I D ND+ PK             F ++P  S PG  + +V A+D D G N+ ++YH      Q  F I+  +G+I +LR+  I  + I R++  V+  D G P
Sbjct:   35 SIVEELRKDSVIANIAKDLGLNK-------QELKFRIVSRVSEKYFSVNLVNGNVYVKERIDREKIC-------------KATAICILTFDAVVE---NPLNVFSVKIEIQDINDNPPMFFHDTITLEIIESTTPGTHLVLQNAEDPDIGINAVQTYKLSDNL----YFALNEKTSSDGSKIPELVLIKSLDRETQTIHELILTAFDGGNPVKTGTAIIRVIVTDVNDNMPVFTEELYKVSISENTPINSTVLAVNATDDDEGTNAQISYSFS--KTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQ--AKDGGGYVAH---CKVLIHIIDENDNAPEISITSLSS----PILENSTLGTVIALVEVHDQDSGENGEVDCQIMGSVPFQLVS---STSRYYRIISSSVLDREKVSWYNITILANDRGRPQMHSRKVIRLDISDVNDNPPLFLKSTYVAYLPENNIPGASIYKIQASDLDLGDNAKVIYSISNSNTEDFAVSSFFSINIETGVLYSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIYITDQNDNAPKILYPPSESSVSAVFETVPFASEPGLLITKVVAVDADSGHNSLLSYHFVQISEQFPFNINEHTGEIRVLRA--IQEKDILRHKAVVMVKDNGDP 652          

HSP 2 Score: 130.568 bits (327), Expect = 3.511e-30
Identity = 153/558 (27.42%), Postives = 253/558 (45.34%), Query Frame = 1
Query: 1348 NEEESRLR-------NFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV--VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQL---LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVN-VSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLV 2946
            N++E + R        +F +N ++G + V++++D E +     +   I     + ++ +   V  V I + DINDNPP     +++ + +         V Q A     DPD G       ++ DN  F L    S D   +K   L    S+DRET   + +I+   D G P  T T ++ ++V D NDN P+F   LY+  I EN  +   +  VNATD D   N  + YS S  +E     ++ SI +  G +      D E S+ +  +V A+D G        L++  I+D ND+ P+  +    S I E+S  G  +  VE  D D GEN ++   +        +   S    I+ S+ +DREK+S Y + ++A+D G P      ++ ++I DVNDNPP+F     K+  V  +  N +P   I +I+A+D DL    + ++ Y        +  +  +      + F I+   G L     +   S+ YE     ++ I A D GSP LS+   L +     I+D+  +   I  P  +S  +A+   V
Sbjct:   56 NKQELKFRIVSRVSEKYFSVNLVNGNVYVKERIDREKI----CKATAICILTFDAVVENPLNVFSVKIEIQDINDNPPMFFHDTITLEIIESTTPGTHLVLQNAE----DPDIGINAVQTYKLSDNLYFALNEKTSSDG--SKIPELVLIKSLDRETQTIHELILTAFDGGNPVKTGTAIIRVIVTDVNDNMPVFTEELYKVSISENTPINSTVLAVNATDDDEGTNAQISYSFSKTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQAKDGGGYVAHCKVLIH--IIDENDNAPEISITSLSSPILENSTLGTVIALVEVHDQDSGENGEVDCQIMGSVPFQLVSSTSRYYRIISSSVLDREKVSWYNITILANDRGRPQMHSRKVIRLDISDVNDNPPLFL----KSTYVAYLPENNIPGASIYKIQASDLDLGD--NAKVIY--------SISNSNTEDFAVSSFFSINIETGVL-----YSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIY----ITDQNDNAPKILYPPSESSVSAVFETV 578          

HSP 3 Score: 78.9518 bits (193), Expect = 4.084e-14
Identity = 145/582 (24.91%), Postives = 235/582 (40.38%), Query Frame = 1
Query:  523 LLFRQTIKEEL-----PSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSS-------EIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRV--QQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN---FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDN-----YPIFHSTLYQF--RIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI-VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILD 2181
            + F  TI  E+     P   LVLQ A   +I  + ++T+K            D+ YF  N+++S       E+  +  LDRE+  I   +    D  +P                     II+V++   DVNDN P F      + + EN  +       V+  D    +   I    S   +   +  ++       ++    +LD E+ +NF++ + A DGG         V I+I D NDN P+    + S  I E+  +  +I  +   D+D G NG+V  +              F L++S S   R+     LD E +    I   ++A D G   +HS   V+ + + D+NDNPP    + L    +  + EN      +  I  +D D G   +V   I N N   F + S  +   +   L +  S D E    + + I   D G P L++   L I + D+NDN     YP   S++      +P  +  G  I  V A D D   N  + Y     +E    +I+ +TG +   +    +   ++   V+ +DNG  HLS +  V L I D
Sbjct:  130 MFFHDTITLEIIESTTPGTHLVLQNAEDPDIGINAVQTYKLS----------DNLYFALNEKTSSDGSKIPELVLIKSLDRETQTIHELILTAFDGGNPV---------------KTGTAIIRVIVT--DVNDNMPVFTEELYKVSISENTPINS-TVLAVNATDDDEGTNAQISYSFSKTSENSLHTSMFSIHTINGEIRTKSNLDFEISENFEISVQAKDGGGY--VAHCKVLIHIIDENDNAPEISITSLSSPILENSTLGTVIALVEVHDQDSGENGEVDCQIMG--------SVPFQLVSSTSRYYRIISSSVLDREKVSWYNIT--ILANDRGRPQMHS-RKVIRLDISDVNDNPP----LFLKSTYVAYLPENNIPGASIYKIQASDLDLGDNAKVIYSISNSNTEDFAVSSFFSINIETGVLYSQRSFDYEQHKVFQMEIMARDGGSPPLSNNATLFIYITDQNDNAPKILYPPSESSVSAVFETVPFASEPGLLITKVVAVDADSGHNSLLSYHFVQISEQFPFNINEHTGEIRVLRAIQEKDILRHKAVVMVKDNGDPHLSVTVTVSLVIGD 666          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: ENSXETT00000039464.1 (protocadherin gamma-B5-like [Source:NCBI gene;Acc:105946880])

HSP 1 Score: 253.062 bits (645), Expect = 5.965e-70
Identity = 207/674 (30.71%), Postives = 335/674 (49.70%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEV---------DGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS------NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPK-------------FELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHPSFQG 2460
            +I EE+P GS +  IA+ +     +   +  + +  ++  +  KYF  N  +  +    ++DRE+LC              T + C L F    +   N + I  V +E++D+NDN P F++    + + EN   G +I      D D  + S +S ++         + ++ G   F         +L L   LDRE  + +++V+TA DGG+   TGT ++ I +TD NDN P +  E + VSI E++P+N  ++ + A DKD G N ++ Y F +   +      N F +N  SGE+  +  LD+E +++ EI +   AKD G  I H+    V I ++D NDNPP +   S++      + E       VA I  +DPD G+  EV+C+I     F+LLS        Y + T  ++DRE    Y I I+  D G P L+ ++ +   V D NDN P+F    Y   + ENN  G  I  + ATDKD EEN  V YS++S      ++ + +SI+  TG + A + FD E   ++   ++A+DNG   L+SS+ V + ++D ND++P              +EL     +P  S  G  V +V A+D D G NA ++YH    +  S F ID  +G+I  R++ + +E+ + R+++ VI  D G PS   
Sbjct:   33 SIFEEMPKGSSIGNIANDLG----LNLEEISIRKLRIVSQISEKYFRVNLGNGHLNVADRIDREALC-------------GTTEECFLTFDAVIE---NPLNIFHVRVEIKDINDNPPRFIHETVELEISENTLPGTQIALENAEDIDIGVNSLQSYQLSTNKNFLLTEKTNTGSSIFP--------ELVLKTSLDRENENFYEIVLTAFDGGNPMQTGTALIRITVTDANDNFPMFSQEIYKVSINENMPLNSTVLYVSASDKDEGINSQLTYSFSSASKQA----TNAFAINPQSGEVITKDILDFEKMKNYEIAVQ--AKDGGGLISHA---KVLIQILDENDNPPEVSLTSITN----PVSEESAPGTVVALIRAHDPDYGENAEVDCQIIGTVPFKLLSSSGNF---YKIVTTGTLDREKSSHYYITIQATDKGSPPLSFSKTIRFNVSDTNDNPPVFEKRNYIAYVLENNQPGASIYKILATDKDSEENSKVTYSITSINTEELSSASYISINPVTGVIYAQRSFDYEQDREFQIQIMAKDNGSPSLNSSANVRICVIDQNDNSPTILYPQSDGGGSSVYEL-----VPFSSEQGTLVTKVVAVDADSGHNAWLSYHFLQDSETSHFIIDQYTGEI--RTSRVFQERDVLRHKVVVIVKDNGTPSLSA 655          
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 256.529 bits (654), Expect = 6.620e-70
Identity = 230/716 (32.12%), Postives = 362/716 (50.56%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSF-MKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS---DADSKLFSTKSIEV-DGSHV-GKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            TI+EELP    +  I   + IS     T  S  + + L+  + DS     +  + EI  T  ++DRE LC            +   + C  + ++     N+   +I++ I ++D NDN+P F ++   I + EN  +    RF +    D D+     +  E+ +G  V G +       +   +L + ++LDRE  D + + I   DGG+   + T I+ + ++D+NDN+P +      V I E+ PI   +++L A D D+G+N ++ Y F     +  S  +  F LN+ +G I VQ+ LD E  ++   +L V+A D       +    V I V D+NDNPPNI     IS     ++  +++  N + +A I+V+D DT    +V C I+ +  F L ++ DN     Y L T + +D E I  +   I   D G PSL  T ++ + +EDENDN PIF   + +  + ENN  G Y+  V+A+D+D  +N  ++Y L  NA +   +D  TG LTAS+ FDRE  +++ FTV ARDNG   L S + V +T+LD ND++PKF   +F F + E+     TVG + A D D GEN  +T  +      F +DP SG +I  + + DRE+ S Y   V A DGG P       V INI D NDN PV   P S  +   V  + +P  ++A++ A D+D     + + T +
Sbjct:   29 TIREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLC--------AGSSNSDENECFFELEVVILP-NDFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLIN--SRFPIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIF---GAQVTSATKRLFALNNTTGLITVQRPLDRE--ETAVHKLTVLATDGSSTPARA---TVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTK-IALITVSDKDTDVNSKVICFIEREVPFHLKAVYDN----QYLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNA-SFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSG-LIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIV 718          

HSP 2 Score: 69.707 bits (169), Expect = 2.783e-11
Identity = 99/355 (27.89%), Postives = 154/355 (43.38%), Query Frame = 1
Query:  814 TAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK-IKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDE 1872
            T K   N   +++V  ELED NDN P F      + V EN + G  +     SD DS   S    ++  +     +F+  L +    L   +  DRE  + F   +TA D G+ P      V + + D NDN PK+   +F   + E++P    +  + A D D G N  V     +I N+ E+     F+L+  SG I+     D E  Q       V A D G+    S + V  I ++D NDN P +  IS   +  FK +  +      VA +   D DTG   E+   I + N + L   +P+T   +L    S     +G + +++  +D G+P    T VL  +  +E
Sbjct:  444 TGKPSLNQTALVRV--ELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPN---ASFFD--LDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTL---SILNDNEN-----FVLDPYSGLIKSNVSFDRE--QQSSYTFDVKAVDGGQPPRSSTAKVT-INIMDANDNSPVV--ISPPSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPS--AADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNE 776          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdhgb5 (protocadherin gamma subfamily B, 5 [Source:MGI Symbol;Acc:MGI:1935196])

HSP 1 Score: 270.011 bits (689), Expect = 3.977e-75
Identity = 220/666 (33.03%), Postives = 338/666 (50.75%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSH----VGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAE-----AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQAR-FSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHPSF 2454
             R  I EE+P+GS+V  +A  +  S   + T K ++       S +  YF  + +S E+    +LDRE +C    V             C L+F+  A+   N +    V +ELED+ND++P+F ++   + + E+ + G     +V+ DAD  L S ++ ++  S     V KE  + R Y +   L L K LDRE  + ++LV+TA+DGG  P +GT  + I +TD NDN P +  E + V + E+VP    ++++ A DKD G N ++ Y F         R    F LNS SGEI  Q+ LD+E ++  E  + V A+D G  +       V I + D NDN P I   SL    L  I EN      +A I ++D D+G+ GEVNC +D++  F+++S        Y L T  ++DRE    Y + I   D G P L+S+  + + V D NDN P+FH   Y   I ENN  G  I  V+A+D D+  NGHV YS ++S+ E     + V++++ +G + A + FD E    +  T+ ARD+G   LS++  + + + D ND+ P+             F  +P  + PG  V +V A+D D G NA ++YH LQA     F +   +G++  R+A    EK  +R  L V   DGG P  
Sbjct:   33 IRYKIPEEMPTGSVVGNLAKDLGFSVQELPTRKLRI-------SSEKPYFSVSSESGELLVSSRLDREQICGKKLV-------------CALEFEAVAE---NPLNFYHVSVELEDINDHTPNFTHTFSELQISESAQPGTRFILEVAEDADIALNSLQNYKLSPSPGFSLVNKEKQDGRKYPE---LVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFH--------RAGQVFGLNSKSGEIITQKTLDFEEIK--EYSIVVEARDGGGLVAQ---CTVEINIQDENDNRPEITVRSL----LEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLDDEVPFKIISSSK---NSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFHQASYLVYIAENNPPGASIAQVSASDPDLGSNGHVSYSIIASDLEPKSLWSYVTVNAQSGVVFAQRAFDHEQLRSFQLTLQARDHGSPTLSANVSMRVLVGDRNDNAPRVLYPALEPDGSALFDMVPRAAQPGYLVTKVVAVDADSGHNAWLSYHVLQASDPGLFSLGLRTGEV--RTARALGEKDAARQRLLVGVRDGGQPPL 650          

HSP 2 Score: 140.969 bits (354), Expect = 2.302e-33
Identity = 158/597 (26.47%), Postives = 265/597 (44.39%), Query Frame = 1
Query: 1219 ITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENI--RNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHV---IAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN---------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATA 2958
            ++E     I E++P   ++  L    KD+G      +  + +  R    S  + +F ++S SGE+ V  +LD E +   ++   +      +N     H     V + + DIND+ PN    + S+    +I E+ Q   +       D D       N ++  +  F L++ +    + Y  L    ++DRE    Y +++   D G P L+ T  L I V D NDN P+F+  +Y+ R+PEN   G  +  V ATDKD   N  + YS    A  +  ++S +G +   K  D E   +YS  V ARD G   L +   V + I D ND+ P+  ++     IPE++ PG  +  ++  D D GEN ++   L         D +  KII  S N         +DRE    Y + + A+D G P     T V +++ DVNDN P+F      +  V ++ N  P   IAQ+ A+D DL   ++  ++Y ++     +   P+S  S       +++  G +F    F         ++ ++A DHGSP LS+   + V V     D+  +   +  P  +   +A+  +V   A
Sbjct:   29 LSEQIRYKIPEEMPTGSVVGNLA---KDLG------FSVQELPTRKLRISSEKPYFSVSSESGELLVSSRLDREQICGKKLVCALEFEAVAENPLNFYH-----VSVELEDINDHTPNFTH-TFSE---LQISESAQPGTRFILEVAEDADIALNSLQNYKLSPSPGFSLVNKEKQDGRKYPELVLEKTLDREQQNYYRLVLTALDGGDPPLSGTTELRIQVTDANDNPPVFNQEVYKVRLPENVPPGTTVLRVTATDKDEGVNSEISYSFH-RAGQVFGLNSKSGEIITQKTLDFEEIKEYSIVVEARDGG--GLVAQCTVEINIQDENDNRPEITVRSLLEMIPENAPPGTLIALIKIHDGDSGENGEVNCRLD--------DEVPFKIISSSKNSYKLVTDRALDRELTPEYNVTITATDRGKPPLSSSTKVTLHVGDVNDNAPLFH---QASYLVYIAENNPPGASIAQVSASDPDL--GSNGHVSYSII----ASDLEPKSLWS----YVTVNAQSGVVFAQRAF-DHEQLRSFQLTLQARDHGSPTLSANVSMRVLV----GDRNDNAPRVLYPALEPDGSALFDMVPRAA 578          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 266.929 bits (681), Expect = 1.927e-73
Identity = 229/781 (29.32%), Postives = 369/781 (47.25%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCD--PKSPTPDLCILQFQ--MTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ----AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSP 2820
            + EE P  +L+  +A+   +      +K +V          + Y   + ++ +I  T   +DRE L      + C +  P +P    CIL+F+  +T    N +  +++  IE++D+NDN+P+F +   T+ + EN  +G +    ++ D D+      S E+      +E F  ++ +DQ     +L ++ +LDRE  D++ L I   DGG+ P   + ++ + + D NDN PK+    +   + E+ PI H +I++ A D D G N ++ Y F    ++    +R    L+  +G I VQ  +D E L +  +R  V+AKD G     S    V +TV D+NDN P I+     +   +D +  I E+V     VA + V+D D G+   V C +  +  FQL       +   K Y L T   +D E +  Y I I   D G P L+ST  L + V D NDN P+F  ++ +   PENN  G+ +  V A+D D   N  ++YSL     A+ + +I    G +      DRE  D Y   V+A D G   L  ++ V + +LD ND+ PKF L  Y FS+ E+      VG V  ID D GENA++   ++     F I   +G  IL S + DRE+ S Y  ++ A DGG P       V IN+ D NDN P    PS+ ++ +     ++    ++Q+ A D D     +  +TY      S+   +P         LF I SH G + L  +     +    ++ ++  D G P
Sbjct:   42 VPEEQPPNTLIGSLAADYGLPDVGHLYKLEV---------GAPYLRVDGKTGDIFTTETSIDREGL------RECQNQIPGNP----CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF----HQAPEVVRRLLRLDRNTGLITVQGPVDREDLST--LRFSVLAKDRGA-TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTG-TILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRL-GETVSQVTAEDID--SGINAELTY------SIAGGNP-------YGLFQIGSHSGAITLEKEIERRHHGLH-RLVVKVSDRGKP 778          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 266.929 bits (681), Expect = 1.927e-73
Identity = 229/781 (29.32%), Postives = 369/781 (47.25%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCD--PKSPTPDLCILQFQ--MTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ----AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSP 2820
            + EE P  +L+  +A+   +      +K +V          + Y   + ++ +I  T   +DRE L      + C +  P +P    CIL+F+  +T    N +  +++  IE++D+NDN+P+F +   T+ + EN  +G +    ++ D D+      S E+      +E F  ++ +DQ     +L ++ +LDRE  D++ L I   DGG+ P   + ++ + + D NDN PK+    +   + E+ PI H +I++ A D D G N ++ Y F    ++    +R    L+  +G I VQ  +D E L +  +R  V+AKD G     S    V +TV D+NDN P I+     +   +D +  I E+V     VA + V+D D G+   V C +  +  FQL       +   K Y L T   +D E +  Y I I   D G P L+ST  L + V D NDN P+F  ++ +   PENN  G+ +  V A+D D   N  ++YSL     A+ + +I    G +      DRE  D Y   V+A D G   L  ++ V + +LD ND+ PKF L  Y FS+ E+      VG V  ID D GENA++   ++     F I   +G  IL S + DRE+ S Y  ++ A DGG P       V IN+ D NDN P    PS+ ++ +     ++    ++Q+ A D D     +  +TY      S+   +P         LF I SH G + L  +     +    ++ ++  D G P
Sbjct:   42 VPEEQPPNTLIGSLAADYGLPDVGHLYKLEV---------GAPYLRVDGKTGDIFTTETSIDREGL------RECQNQIPGNP----CILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTF----HQAPEVVRRLLRLDRNTGLITVQGPVDREDLST--LRFSVLAKDRGA-TPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTG-TILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRL-GETVSQVTAEDID--SGINAELTY------SIAGGNP-------YGLFQIGSHSGAITLEKEIERRHHGLH-RLVVKVSDRGKP 778          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdhb21 (protocadherin beta 21 [Source:MGI Symbol;Acc:MGI:2136759])

HSP 1 Score: 250.751 bits (639), Expect = 1.433e-69
Identity = 202/667 (30.28%), Postives = 339/667 (50.82%), Query Frame = 1
Query:  517 LKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVK------LYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKG-YSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP--KFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHP 2448
            L   +R ++ EE+ +GS +  I   +++   +    ++V+     D     Y     ++  +    KLDRE+LC      +  +P       CIL FQ+  +   N ++  Q  + +ED+ND++P+FL     + + E+   G    FQ+ DA         I+ + S     YF  +L +D  K      L L++ LDRE   +  L++TA+DGGS P +GT++V + + D+NDN P++    + V + E+  ++ L+IK+ A D D G NG++ Y F +I  +    ++  F ++  SGE+R+++ LD+E +QS  I +  I  D G     S  + + + V D+NDNPP I   SL    +  I EN  +   VA  S+ D D+G+ G + C I++K   L  L  P  K  Y+L T + +DRE+   Y I +  +D G P LT+   + + + D NDN P F  T Y   + ENN    +IG ++ATD D+  N H+ YSL    +      +++SI+++ G L A +  D ET   + F V A D G   LSS +LV + +LD ND+ P   + +Q   +     +P  + PG  V +V A+D D G+NA +++ L        F +   +G++  R+  +  E+ + ++ L ++  D G P
Sbjct:   27 LATTWRYSVPEEMETGSSIANIIKDMDVGD-LAARGARVI----FDDY-QPYLRLELETGNLLLNEKLDREALC------SSSEP-------CILHFQVLLE---NPLQFFQAELLIEDINDHTPTFLEKLIFLNISESATPG--TSFQMDDAQDLDIGMNGIQ-NYSISPNPYFYLKL-KDSGKGRRYPELVLVRSLDREKEASISLILTAMDGGSLPRSGTVLVQVVVLDVNDNAPEFERTLYEVQVPENSSVDSLVIKVSATDLDSGINGEISYSFSHISRD----VQKTFEIHPTSGEVRLKRLLDFEVIQSYTINIQAI--DGGG---LSGKSAIIVQVTDVNDNPPEIVITSL----MSSIPENGLSEMVVAVFSLRDQDSGENGRMMCSIEDK---LPFLLKPTFKNFYTLVTEHPLDRESRAEYNITVMISDLGTPRLTTQHTITVHISDINDNAPAFTQTTYTMFVRENNSPALHIGTISATDSDLGSNAHITYSLLPPQDQRLALTSLISINADNGQLFALRALDYETLQAFEFRVGATDRGSPALSSQALVRVVVLDDNDNAPFVLYPMQNASAPCTELLPRAAEPGYLVTKVVAVDRDSGQNAWLSFQLLKATEPGLFSVWAHNGEV--RTTRLLSERDVPKHRLLLLVKDNGDP 649          

HSP 2 Score: 123.635 bits (309), Expect = 4.045e-28
Identity = 145/502 (28.88%), Postives = 222/502 (44.22%), Query Frame = 1
Query: 1396 SGEIRVQQKLDYEYLQS---PEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS---LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKI--ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSY-SYEIKVHIRAVDHGSPQLSSQTYLIVKVISD 2865
            +G + + +KLD E L S   P I    +  +N  +   +      + + DIND+ P      L K     I E+             D D G  G  N  I  N  F L   D+   + Y  L    S+DRE   S  +I+   D G    + T ++ ++V D NDN P F  TLY+ ++PEN+ +   +  V+ATD D   NG + YS   +S + +    I   +G +   +  D E    Y+  + A D G   LS  S + + + DVND+ P+  +    S IPE+      V      D D GEN ++   ++ +   F + P       ++    +DRE  + Y + V+ SD G P    +  + ++I D+NDN P F   +     + V  N  P   I  I A DSDL   ++  ITY LLP        PQ +     +L  I++  GQLF +      +  ++E +V   A D GSP LSSQ  + V V+ D
Sbjct:   79 TGNLLLNEKLDREALCSSSEPCILHFQVLLENPLQFFQA-----ELLIEDINDHTPTF----LEKLIFLNISESATPGTSFQMDDAQDLDIGMNGIQNYSISPNPYFYLKLKDSGKGRRYPELVLVRSLDREKEASISLILTAMDGGSLPRSGTVLVQVVVLDVNDNAPEFERTLYEVQVPENSSVDSLVIKVSATDLDSGINGEISYSFSHISRDVQKTFEIHPTSGEVRLKRLLDFEVIQSYTINIQAIDGG--GLSGKSAIIVQVTDVNDNPPEIVITSLMSSIPENGLSEMVVAVFSLRDQDSGENGRMMCSIEDKLP-FLLKPTFKNFYTLVTEHPLDRESRAEYNITVMISDLGTPRLTTQHTITVHISDINDNAPAF---TQTTYTMFVRENNSPALHIGTISATDSDL--GSNAHITYSLLP--------PQDQRLALTSLISINADNGQLFALRALDYETLQAFEFRVG--ATDRGSPALSSQALVRVVVLDD 553          
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 253.832 bits (647), Expect = 3.596e-69
Identity = 217/701 (30.96%), Postives = 346/701 (49.36%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLL-DSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSH--VGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLS 2613
            T++EE+P   L+  +   + +S       +  ++F L+  + D       + + EI  T  ++DRE LC         D +      C  + ++    D     ++++   +ED+NDN+P F  +   I + EN  +        + D D  +   ++ ++  S    G +           +L + K LDRE  D + + +   DGG    + T I+ +++ D NDN P +I +   VSI E+ PI   + +L A D D+G N ++++ F N+ +    RL   F LN+ +G I V++ LD E  +SP  +L V+A D G     +    V + V DINDN P  +I+ I    +    + EN     ++A I+V D D+   G V C  D++  F+L  +    +  + L T   +D E+   Y I +   D G P L  + +L I V+DENDN P+F  +     +PENN  G  +  ++ATD D  +N  + Y L  +A    ++D  TG LTA K+ DRE  +KY FTV+A+DNG   L S++ V++T+LD ND++P F   +Y F +PE      TVG +   D D GEN+ +T  +     QF IDP SG +I  + + DRE+   Y   V A DGG  S      V IN+ DVNDN P+F  P S  +   V  +  P  ++ ++ A D D+ 
Sbjct:   29 TVREEMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDREKLC----AGIVLDAR------CFYEVEVAVLPDEI-FRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRL---FHLNTTTGLITVKEPLDRE--ESPSHKLLVLATDGGSTPARA---TVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRPV---FSNQFLLETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQRTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQFTIDPQSG-VIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPSTNPGTVVFKVVAIDDDIG 706          

HSP 2 Score: 162.155 bits (409), Expect = 6.478e-40
Identity = 166/553 (30.02%), Postives = 264/553 (47.74%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDAD----SKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKH-LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXX--XXXXQPKWITE--NFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLR----NFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA--ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-----ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            + + D NDN P F+  +  + + EN  +G  + +   +DAD    +++    S  V  S++ K  F+         L  +K  LDRE   + KL++ A DGGS P   T++VN+   +  +     ++I    N +V + E+ P+N  I  +   DKD  +NG+V   F +  +E   RLR    N FLL + +        LD+E  +   I+L  +A D G+  ++  S+++ I V D NDN P      ISLS      + EN     Q+  IS  D D+G+  E++  +        +LD    +   LT    +DRE    Y   +   D G P L S   + + V D+NDN PIF    Y F +PE+      +G +  TD D  EN  V  S+    +   +ID  +G +  +  FDRE  + Y+F V A D G    SS++ V + ++DVND+ P F        + + +P  +NPG  V +V AID DIG NA++ Y +    ++  F I+  SG I L+   +  + +  + + V A+D G P
Sbjct:  237 VSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLV--SNIAKRLFH---LNTTTGLITVKEPLDREESPSHKLLVLATDGGSTPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTC-FTD--HEVPFRLRPVFSNQFLLETAAF-------LDFESTREYAIKL--LAADAGKPPLNQ-SSMLLIKVKDENDNAPVFTQSFISLS------VPENNSPGAQLTKISATDADSGQNAEISYMLGFDAPPEFNLDQ---RTGILTAVKKLDREKQEKYYFTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPESLPKHGTVGLITVTDPDYGENSAVTLSILDVNDQF-TIDPQSGVIRPNISFDRERQESYTFYVKAEDGGRVSRSSTARVTINVVDVNDNKPIFIDPPSNYSFEWVLPS-TNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSD-LGLHRVIVKANDLGQP 759          

HSP 3 Score: 108.997 bits (271), Expect = 2.205e-23
Identity = 111/399 (27.82%), Postives = 182/399 (45.61%), Query Frame = 1
Query: 1738 GYSLTTHNSIDRETIGSYIII-IKC---NDFGFPSLTSTRVLNI--MVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTG----SLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ-----FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPV--FQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            G   TT   IDRE + + I++  +C    +         R++ I  ++ED NDN P+F +T+    IPEN+ +        A D DI  NG   Y L  S N   +  I++  G     L   KE DRE  D Y   V   D G    SS++++ +++ D ND+ P F E +   SIPE++  G +V Q+ A D DIGENA+I ++     S      F ++  +G I ++   +DRE+   ++L V+A+DGG    +  T++    +  ++ P +      +  N  V +S N   N  IA I   D D      ++  TD+ + + L P              ++ N F +++          F     + E  + + A D G P L+  + L++KV
Sbjct:   82 GEIFTTGARIDREKLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRYSLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSVTQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEP-LDREESPSHKLLVLATDGGSTPARA-TVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFTDHEVPFRLRP--------------VFSNQFLLETAA--------FLDFESTREYAIKLLAADAGKPPLNQSSMLLIKV 456          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q5DRC3|PCDBH_PANTR (Protocadherin beta-17 OS=Pan troglodytes OX=9598 GN=PCDHB17 PE=3 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.388e-72
Identity = 219/664 (32.98%), Postives = 326/664 (49.10%), Query Frame = 1
Query:  532 RQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS---DADSKLFSTKSIEVDGSHVGKEYFN--ARLYQDQVK---LYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNP-LTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA------EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP--KFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHP 2448
            + ++ EE  SGS V  +A  + +       +       +L   + +Y    ++S  +    KLDRE LC D       DP       CIL FQM  K   N V+ IQ  ++L+DVND++P FL ++  + + E    G     +++   D  S      SI  +       YF+   R + D  K   L L + LDRE     +L +TA+DGGS P  GT  V I I DINDN P++    + V + E+ PI  L+I + A D D G +G++ Y F    N+    +   F +NS++GEIR+++ LD+E +QS    + V A D G     S    V I V+DINDN P +    L  D L    E V     VA   ++DPD+G  G++ C I +    L  L  P L   Y+L T  ++DRE+   Y I I   D G P L +   + ++V D NDN P F  T Y   + ENN    +IG V+ATD+D   N  V YSL           ++VSI+++ G L A +  D E   ++ F V A D G   LSS +LV + +LD ND++P   + LQ   +     +P  + PG  V +V A+D D G+NA ++Y L        FG+   +G++  R+A +  E+  +++ L V+  D G P
Sbjct:   32 KYSVLEERDSGSFVANLAKDLGLGVGELAARGA----RILSKGNKQYLQLERKSGNLLLKEKLDREELCGD------IDP-------CILHFQMLLK---NPVQFIQGELQLQDVNDHAPEFLENEILLKISEGSHPGTSFPLKIAQDLDVGSNTVQNYSISTN------SYFHLFTRNHSDGKKYPELVLDQALDREEQPQLRLTLTALDGGSPPRIGTSQVLIVIVDINDNVPEFAQRRYEVQVPENTPIGSLVITVSARDLDAGTHGELSYSFFQYSNQ----IIQAFEINSITGEIRLKKALDFEEIQS--YHMEVEASDGGG---LSGKCTVAIEVMDINDNAPELTMSLLISDILENSPETV-----VAVFGISDPDSGNNGKMMCSIQD---HLPFLLKPTLENFYTLLTEGALDRESRAEYNITITVTDLGTPRLKTEYNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQNPHLPLASLVSINTDNGHLFALRSLDYEALQEFEFRVGATDRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEV--RTARLLSERDAAKHRLVVLVKDNGEP 650          

HSP 2 Score: 120.939 bits (302), Expect = 2.286e-26
Identity = 136/507 (26.82%), Postives = 212/507 (41.81%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYLQS---PEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV---SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKI--ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            + +  L   SG + +++KLD E L     P I    +   N  + I        + + D+ND+ P      L  + L KI E              D D G     N  I  N  F L + ++   K Y  L    ++DRE      + +   D G P    T  + I++ D NDN P F    Y+ ++PEN  +G  +  V+A D D   +G + YS    +  I+    I+S TG +   K  D E    Y   V A D G   LS    V + ++D+ND+ P+  +    S   +++P   V      D D G N K+   +Q     F + P       +L    +DRE  + Y + +  +D G P  + E  + + + DVNDN P F   +  +  + V  N  P   I  + A D D    T+ ++TY LLP        PQ+      +L  I++  G LF +      +   E +  + A D GSP LSS+  + V V+
Sbjct:   72 KQYLQLERKSGNLLLKEKLDREELCGDIDPCILHFQMLLKNPVQFIQGE-----LQLQDVNDHAPEF----LENEILLKISEGSHPGTSFPLKIAQDLDVGSNTVQNYSISTNSYFHLFTRNHSDGKKYPELVLDQALDREEQPQLRLTLTALDGGSPPRIGTSQVLIVIVDINDNVPEFAQRRYEVQVPENTPIGSLVITVSARDLDAGTHGELSYSFFQYSNQIIQAFEINSITGEIRLKKALDFEEIQSYHMEVEASDGG--GLSGKCTVAIEVMDINDNAPELTMSLLISDILENSPETVVAVFGISDPDSGNNGKMMCSIQDHLP-FLLKPTLENFYTLLTEGALDRESRAEYNITITVTDLGTPRLKTEYNITVLVSDVNDNAPAF---TQTSYTLFVRENNSPALHIGSVSATDRD--SGTNAQVTYSLLP--------PQNPHLPLASLVSINTDNGHLFALRSLDYEALQ-EFEFRVGATDRGSPALSSEALVRVLVL 552          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 266.159 bits (679), Expect = 2.907e-72
Identity = 230/779 (29.53%), Postives = 370/779 (47.50%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQ--MTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV-SDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQ----AISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLT---KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSP 2820
            + EE P  +L+  +A+          +K +V          + Y   + ++ +I  T   +DRE L         C  + P  D CIL+F+  +T    N +  +++  IE++D+NDN+P+F +   T+ + EN  +G +    + SD D+      S E+      +E F  ++ +DQ     +L ++ +LDRE  D++ L I   DGGS P   + ++ + + D NDN PK+   ++   + E+ PI H +I++ A D D G N ++ Y F    ++    +R    L+  +G I VQ  +D E L +  +R  V+AKD G     + + VV +TV D+NDN P I+     +   +D +  I E+V     VA + V+D D G+   V C +  +  FQL       +   K Y L T   +D E +  Y I I   D G P L+ST  L + V D NDN P+F  ++ +   PENN  G+ I  + A+D D   N  ++YSL     A+ + +I   TG +      DRE  + Y   V+A D G   L  ++ V + +LD ND+ PKF L  Y FS+ E+      VG V  ID D GENA++   ++     F I   +G  IL S + DRE+ S Y  ++ A DGG P       V IN+ D NDN P    PS+ ++++     ++    ++Q+ A D D     +  + Y      S+   +P         LF I SH G + L  +     +    ++ ++  D G P
Sbjct:   64 VPEEQPPNTLIGSLAADYGFPDVGHLYKLEV---------GAPYLRVDGKTGDIFTTETSIDREGL-------RECQNQLPG-DPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTF----HQAPEVVRRLLRLDRNTGLITVQGPVDREDLST--LRFSVLAKDRGTNPKSARAQVV-VTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDFVIQNGTG-TILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFD--SGVNAELIY------SIAGGNP-------YGLFQIGSHSGAITLEKEIERRHHGLH-RLVVKVSDRGKP 800          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9Y5E7|PCDB2_HUMAN (Protocadherin beta-2 OS=Homo sapiens OX=9606 GN=PCDHB2 PE=1 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 2.318e-71
Identity = 205/616 (33.28%), Postives = 320/616 (51.95%), Query Frame = 1
Query:  682 NKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE---IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV------KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP--KFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHP 2448
            ++Q+ ++    KLDRE LC          P  P    C+L FQ+  +   N ++  Q  + + DVND+SP FL+ +  + + E++  G    I+R Q  D  +      +I  +       +F+  L QD +      +L L + LDRE     +L +TA+DGGS P +GT +V I + DINDN P++    + V I ED P+   +  + A D D+G NG++ Y F    ++    +R  F L++ SGE+ ++QKLD+E +Q+  + +   A D G     S + VVF+ V+D+NDNPP +   +L    + +I EN+Q+   +A  SV+DPD+G  G + C I  D   F   S++N     Y+L    ++DRET   Y I I   DFG P L +   + ++V D NDN P F  T Y   + ENN    +IG V+ATD+D   N  V YSL    +      ++VSI+++ G L A +  D E    + F V A D G   LSS +LV + +LD ND++P   + LQ   +     +P  + PG  V +V A+D D G+NA ++Y L        FG+   +G++  R+A + RE+  ++  L V+  D G P
Sbjct:   80 DRQTGDLLLNEKLDREELC---------GPTEP----CVLPFQVLLE---NPLQFFQAELRIRDVNDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNF------HFHLNL-QDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAF----SQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQ--ATDGGG---LSGTCVVFVQVMDLNDNPPELTMSTL----INQIPENLQDTL-IAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVEN----FYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALQSLDYEALQAFEFRVGAADRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEV--RTARLLRERDAAKQRLVVLVKDNGEP 652          

HSP 2 Score: 126.331 bits (316), Expect = 4.915e-28
Identity = 139/505 (27.52%), Postives = 230/505 (45.54%), Query Frame = 1
Query: 1396 SGEIRVQQKLDYEYLQSPE---IRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQL---LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI---VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAI-DLDIGENAKITYHLQARFSQFGIDPISG-KIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            +G++ + +KLD E L  P    +    +  +N  +   +      + + D+ND+ P    + L K+ L KI E++            D D G     N  I  N +F L    SLD  +     L  + ++DRE      + +   D G P  + T ++ I V D NDN P F   LY+ +IPE++ +G  +  V+A D DI  NG + Y+ S  +E I     + + +G L   ++ D E+   Y+  + A D G   LS + +V++ ++D+ND+ P+  +    + IPE  N   T+  V ++ D D G+N ++   +Q     F    +     ++ S  +DRE  S Y + +  +D G P  + E  + + + DVNDN P F   +  +  + V  N  P   I  + A D D    T+ ++TY LLP        PQ       +L  I++  G LF +      S  YE     +  + A D GSP LSS+  + V V+
Sbjct:   83 TGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQAE-----LRIRDVNDHSP----VFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILP--QLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAFSQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQATDGG--GLSGTCVVFVQVMDLNDNPPELTMSTLINQIPE--NLQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAF---TQTSYTLFVRENNSPALHIGSVSATDRD--SGTNAQVTYSLLP--------PQDPHLPLASLVSINADNGHLFALQ-----SLDYEALQAFEFRVGAADRGSPALSSEALVRVLVL 554          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q5DRD2|PCDB2_PANTR (Protocadherin beta-2 OS=Pan troglodytes OX=9598 GN=PCDHB2 PE=3 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 9.157e-71
Identity = 203/616 (32.95%), Postives = 320/616 (51.95%), Query Frame = 1
Query:  682 NKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE---IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV------KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE------AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP--KFELQYFFS-----IPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREK-ISRYELKVIASDGGHP 2448
            ++Q+ ++    KLDRE LC          P  P    C+L FQ+  +   N ++  Q  + + D+ND+SP FL+ +  + + E++  G    I+R Q  D  +      +I  +       +F+  L QD +      +L L + LDRE     +L +TA+DGGS P +GT +V I + DINDN P++    + V I ED P+   +  + A D D+G NG++ Y F    ++    +R  F L++ SGE+ ++QKLD+E +Q+  + +   A D G     S + VVF+ V+D+NDNPP +   +L    + +I EN+Q+   +A  SV+DPD+G  G + C I  D   F   S++N     Y+L    ++DRET   Y I I   DFG P L +   + ++V D NDN P F  T Y   + ENN    +IG V+ATD+D   N  V YSL    +      ++VSI+++ G L A +  D E    + F V A D G   LSS +LV + +LD ND++P   + LQ   +     +P  + PG  V +V A+D D G+NA ++Y L        FG+   +G++  R+A +  E+  +++ L V+  D G P
Sbjct:   80 DRQTGDLLLNEKLDREELC---------GPTEP----CVLPFQVLLE---NPLQFFQAELRIRDINDHSPVFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNF------HFHLNL-QDSLDGIILPQLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAF----SQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQ--ATDGGG---LSGTCVVFVQVMDLNDNPPELTMSTL----INQIPENLQDTL-IAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVEN----FYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSLLPPQDPHLPLASLVSINADNGHLFALQSLDYEALQAFEFRVGAADRGSPALSSEALVRVLVLDANDNSPFVLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEV--RTARLLSERDAAKHRLVVLVKDNGEP 652          

HSP 2 Score: 126.716 bits (317), Expect = 3.272e-28
Identity = 140/505 (27.72%), Postives = 230/505 (45.54%), Query Frame = 1
Query: 1396 SGEIRVQQKLDYEYLQSPE---IRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQL---LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAI---VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAI-DLDIGENAKITYHLQARFSQFGIDPISG-KIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYE----IKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            +G++ + +KLD E L  P    +    +  +N  +   +      + + DIND+ P    + L K+ L KI E++            D D G     N  I  N +F L    SLD  +     L  + ++DRE      + +   D G P  + T ++ I V D NDN P F   LY+ +IPE++ +G  +  V+A D DI  NG + Y+ S  +E I     + + +G L   ++ D E+   Y+  + A D G   LS + +V++ ++D+ND+ P+  +    + IPE  N   T+  V ++ D D G+N ++   +Q     F    +     ++ S  +DRE  S Y + +  +D G P  + E  + + + DVNDN P F   +  +  + V  N  P   I  + A D D    T+ ++TY LLP        PQ       +L  I++  G LF +      S  YE     +  + A D GSP LSS+  + V V+
Sbjct:   83 TGDLLLNEKLDREELCGPTEPCVLPFQVLLENPLQFFQAE-----LRIRDINDHSP----VFLDKEILLKIPESITPGTTFLIERAQDLDVGTNSLQNYTISPNFHFHLNLQDSLDGIILP--QLVLNRALDREEQPEIRLTLTALDGGSPPRSGTALVRIEVVDINDNVPEFAKLLYEVQIPEDSPVGSQVAIVSARDLDIGTNGEISYAFSQASEDIRKTFRLSAKSGELLLRQKLDFESIQTYTVNIQATDGG--GLSGTCVVFVQVMDLNDNPPELTMSTLINQIPE--NLQDTLIAVFSVSDPDSGDNGRMVCSIQDDLPFFLKPSVENFYTLVISTALDRETRSEYNITITVTDFGTPRLKTEHNITVLVSDVNDNAPAF---TQTSYTLFVRENNSPALHIGSVSATDRD--SGTNAQVTYSLLP--------PQDPHLPLASLVSINADNGHLFALQ-----SLDYEALQAFEFRVGAADRGSPALSSEALVRVLVL 554          
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Match: sp|Q9Y5G0|PCDGH_HUMAN (Protocadherin gamma-B5 OS=Homo sapiens OX=9606 GN=PCDHGB5 PE=2 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.472e-69
Identity = 215/663 (32.43%), Postives = 330/663 (49.77%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTK----SIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAI-----VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQA-RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
             R  I EE+P GS+V  +A+ +  S   + T K +V       S +  YF  + +S E+    +LDRE +C           K P    C L+F+  A+   N +    V +E+ED+ND++P F  +   + + E+ + G     +V+ DAD  L S +    S+    S + KE  +   Y +   L L K LDRE     +LV+TA+DGG  P +GT  + I +TD NDN P +  + + VS++E+VP    ++++ A D+D G N ++ Y F         R    F LNS SGEI  Q+KLD+E  ++ E  + V  +D G  +       V I + D NDN P +   SL    L  I EN      +A I ++D D+G+ GEVNC++  +  F+++S        Y L T  ++DRE    Y + I   D G P L+S+  + + + D NDN P+FH   Y   +PENN  G  I  V A+D D+  NG V YS ++S+ E +     VS+ + +G + A + FD E    +  T+ ARD G   LS++  + + + D ND+ P+             F  +P  + PG  V +V A+D D G NA ++YH LQA     F +   +G++    A  DR+  +R  L V   DGG P
Sbjct:   33 IRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRV-------SSEKPYFTVSAESGELLVSSRLDREEIC----------GKKPA---CALEFEAVAE---NPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPE---LALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSF--------YRTGQIFSLNSKSGEITTQKKLDFE--ETKEYSMVVEGRDGGGLVAQ---CTVEINIQDENDNSPEVTFHSL----LEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDA-ARQRLLVAVRDGGQP 648          

HSP 2 Score: 132.109 bits (331), Expect = 9.122e-30
Identity = 153/552 (27.72%), Postives = 241/552 (43.66%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYL--QSPEIRLHVIA-KDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN---------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL-----PFPSVNY--PHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATA 2958
            + +F +++ SGE+ V  +LD E +  + P   L   A  +N     H     V + + DIND+ P     S       +I E+ Q   +       D D G       ++  N +F L+  +      Y  L    ++DRE    + +++   D G P L+ T  L I V D NDN P+F+  +Y+  + EN   G  +  V+ATD+D   N  + YS     + I S++S +G +T  K+ D E + +YS  V  RD G   L +   V + I D ND++P+         I E++ PG  +  ++  D D GEN ++   LQ          +  KII  S N         +DRE+   Y + + A+D G P       V ++I DVNDN PVF   S     V+V  N  P   IAQ+ A+D DL    + +++Y ++     P    +Y     QS +   Q  FD +    QL           ++E+ +  R  D GSP LS+   L V V     D+  +   +  P      +A+  +V   A
Sbjct:   72 KPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYH-----VNVEIEDINDHTPKFTQNSFE----LQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQ-IFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGG--GLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGE--------VPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYL---VSVPENNPPGASIAQVCASDLDL--GLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYE----QL----------RTFELTLQAR--DQGSPALSANVSLRVLV----GDRNDNAPRVLYPALGPDGSALFDMVPRAA 578          

HSP 3 Score: 84.7297 bits (208), Expect = 4.132e-15
Identity = 118/463 (25.49%), Postives = 201/463 (43.41%), Query Frame = 1
Query:  526 LFRQTIKEELPSGSLVLQIASP-------VEIS-SFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIE--LEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKD--KLFK-IKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVED 1869
            ++R +++E +P G+ VLQ+++         EI+ SF +T                + F  N +S EI T  KLD E      E K               ++ M  +  +    + Q  +E  ++D NDNSP          + EN   G  I   ++ D DS      + ++ G    K   +++   +  KL     LDRE    + + ITA D G  P + ++ V ++I D+NDN P +   ++ VS+ E+ P    I ++ A D D+G NG+V Y      + E   L ++  +++ SG +  Q+  DYE L++ E+ L   A+D G   + S +  + + V D NDN P +   +L  D   LF  +    +    V  +   D D+G    ++  +       L SL   L  G   T     DR+      +++   D G P L++T  L+++  D
Sbjct:  246 VYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRT---------------GQIFSLNSKSGEITTQKKLDFE------ETK---------------EYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSK---NSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSI-MASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQ--ARDQGSPAL-SANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLG--LRTGEVRTARALGDRDA-ARQRLLVAVRDGGQPPLSATATLHLVFAD 662          

HSP 4 Score: 65.0846 bits (157), Expect = 3.641e-9
Identity = 79/257 (30.74%), Postives = 113/257 (43.97%), Query Frame = 1
Query: 1909 QFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRE------TSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENA--KITYHLQARFSQFGIDPISGKIILRSA---NIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITY 2640
            ++RIPE    G  +G++ ATD            L  ++E    ++ + +G L  S   DRE       +    F  +A +  P +      V + I D+NDHTPKF    F   I E + PG       A D DIG N+  K    L   FS    +   G      A    +DRE+ S + L + A DGGHP   G T + I + D NDNPPVF   +     V++  N  P   + Q+ A D D  +  ++ ITY
Sbjct:   34 RYRIPEEMPKGSVVGNL-ATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAEN--PLNFYH---VNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVF---NRDVYRVSLRENVPPGTTVLQVSATDQD--EGINSEITY 279          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A183ABS0 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4405 PE=4 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 4.540e-102
Identity = 291/940 (30.96%), Postives = 448/940 (47.66%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEI----SSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCI-----------------------LQFQMTA----KADN----NNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDGS------------------HVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITEN--------------------------FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYE----YLQSPEIRLHVIAKDN---GEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL-----------------FKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLL----------------------SLDNPLTKG------YSLTTHNSIDRETIGSYIIIIKCNDFGFPS-LTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTV-IARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN------------------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPS--SKNNEVNVSCNQMPNHLIAQIRANDSDLSQ------------ATDNRITYILLPFPSVNYPHPQSRL-SIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            + EELP GSLV+ + S + +    S+F         ++ L+++ D + F     S  +    +LDRE LC   + + CC+ ++  P + +                       +  Q TA     A+N    N + +I V + L+DVND++P F    +++ V E+  +  + Q FQ+SD D+ +     +++D +                   +    F  +L +D V L L+  LDRE+V  + +V+TAIDG    P +  L + I++TD NDN P WI ++                          F+V++ E   +  LI  L A+D DVG+N ++ Y  +       + L ++F + S +GE+R++ +LDY+     L  PEI + VI +D+   G ++    + VV IT  D+ND  P I    L    L                 F + EN    Q +ASI VNDPDTG GG+V+C + +  F L                       +L + +T        Y L +   +DRE +  + +++ C D      L ST+ L+I V DENDN P F S+      PEN+  GQ IG +NATDKD+ EN  + + +     + V + + TG +  +  FDRET  +  F V +A  +G    ++S+ V + +LD NDH P F   YFFSIPE+S PG  VG + A D D G+N K+ Y L      F +D  SGK+ +RS+                   +DRE+   YEL VIA DGG+P  +  T+V+I + DVND+ P F++P+     + +NVSC Q+ + LIA++ ANDSD  +            +  +RIT  +    +VN P     L     N F+I+S+ GQLFLI+    CS   EI++ IRA D G P LSS   L + V
Sbjct:   14 LPEELPPGSLVVDLNSNLHVKNLQSAFESGSTPLSFQYRLMNTFDGRLFRVGSHSGRMTVASRLDRELLCASQKAQFCCNARASLPSILMSDPNWKEESDPVSKGQRCHLVAHVSIQSTALQHKDAENSPVPNQMALIYVYLRLDDVNDHTPQFTTQSNSLNVAEDTPVSTVLQYFQISDPDAGINGLNQVKLDVNPLTTVDPKTIHDNPSAINMMKNNPFEVKLSRDGVSLLLVHPLDREIVAAYDVVLTAIDGDRLKPRSSQLNIRIHVTDANDNAPVWIQQSDQGDLSSSYHSIMNVHEVSQSSQNTVFNVTVPEGTQVGALIYWLQAKDADVGDNARLQYAIDTSAPGGLTAL-DYFSVQSTTGEVRLRTQLDYDSASLQLSRPEIEVPVIVRDSPRVGRQLSAKATLVVRIT--DVNDIYPIIMVSPLQPIPLHNAYSGNTLGDGHTPASFGVWENRPPGQPIASILVNDPDTGDGGKVSCSVQSDFFTLAPESGKSEYFPNYQSEQFLGVKSTLGDTITPSNSGPVTYHLLSKQHLDREVVPRHQVVLTCRDHDRSRPLVSTQRLDIEVLDENDNPPEFSSSPIVLTCPENSPPGQVIGRLNATDKDVGENARLRFWVDDRDASWVGVHAQTGDVRVNTVFDRETETEREFVVYVADSDGSQGHTASTTVKVRVLDENDHAPHFIDLYFFSIPENSPPGTEVGYIRAEDEDEGDNGKVHYLLHPPSRDFELDRDSGKLAVRSSGFEGMRPVLTDTGKLRVSLLDREQQDTYELTVIAEDGGNPPRKVTTVVHIGLSDVNDHAPQFRYPTPHGPGSLLNVSCAQLSSQLIARVHANDSDSGRNGEVEYSIVREHSYSSRITREIFNEDAVNAPSADPLLEGPTANHFEINSYNGQLFLIHPIMDCSRPAEIRLLIRAKDGGDPPLSSTAMLTIYV 950          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4V6RGX9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006574 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 5.771e-91
Identity = 262/863 (30.36%), Postives = 420/863 (48.67%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSFMK----THKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKS------------------PTPDLCILQFQM-----------------TAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVD----------------------GSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWIT----------EN------------FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQS----PEIRLHVIAKDN---GEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL---------------FKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLL---------------SLDN-PLTKG--------YSLTTHNSIDRETIGSYIIIIKCNDFG-FPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDN-GPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN------------------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQF--PSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVN 2667
             ++EEL  G+++ ++++   + + +     T   +  ++ L+++ DS  F     S ++    +LDRE+LC   + + CC+ ++                  P   LC L   +                 T  A  N + ++ + I L+D+ND++P F +   T+ V E+  +G + Q F+V+D D+     + +++                        + V    F+ RL +D   L L   LDRE +  + L +TA+DG   +P +  L + + +TD NDN P W+           EN            F+VSI ED  +  L+  L A D DVG+N ++ Y  +       + L N+F + S +GE+R++ +LDY+   +     EI + +  +DN   G  ++     V+F+ V+D+ND  P I A  LS   L               F + EN    Q VASI V+DPDTG GG+V+C + +  F+L                S+ N P + G        Y L +   +DRE I  + +++ C D      L STR L+I V DENDN P F ++L +   PEN+  GQ IG VNATDKD+ EN  + + ++  + + +SI   TG +  +  FDRE   +  FTV   D+ G +  ++S+ V + ILD NDH+P+F   YFFS+ E+S PG  +GQ++A D D GEN K+ Y L+    +F I+  +GK+ +RSA                   +DRE+   YEL ++A DGG P  +  TI++I + DVND+ P F++  P    + +NVSC Q+ N +IA++ ANDSD  Q  +  I Y ++   SVN
Sbjct:   70 AVQEELSPGAIITELSTHPLVKNLITQSDGTQIHETFQYRLMNTFDSHLFRITGNSGQLTIATRLDREALCASQKAQFCCNNRAQIPSSLMSDESWKLIETVPKSQLCHLVAHISLQPNKPASRSESGAGQTGVAQINRLALVYLYIRLDDINDHAPQFASPTTTLNVAEDATVGSVLQYFRVTDPDAGANGLRDVKLSVAPLSGTSLSANSRPIEPMRGISTGVLANPFDVRLSRDGASLLLQAALDRESIPAYDLTLTALDGDPISPKSSQLNLRVLVTDANDNAPTWVRPLVNANKLQPENADVHIIDQSIPQFNVSISEDTQVGALVFWLQARDADVGDNARLTYAIDTGAPGGLTAL-NYFSVQSTTGEVRLRAQLDYDSASANSNGAEIEVPITVQDNPHIGRPLM--ARAVLFVRVLDVNDIHPIIVASPLSPVPLRRPFLMNAVPSQYTSFGVWENQPAGQPVASILVSDPDTGGGGKVSCSVQSDYFRLAGESIKPEFFETIQSQSISNYPFSDGELISGPITYQLISTQILDREHIPRHQVLLTCRDHDQSKPLVSTRRLDIEVLDENDNAPEFIASLIELTCPENSPPGQIIGVVNATDKDVGENARLRFWVNEASTSWISIHQQTGEVRVNTVFDREQETERRFTVFVSDSVGSTAHTASAEVCIRILDENDHSPQFVDLYFFSVSENSPPGTEIGQIKADDADSGENGKVYYSLRQPSKEFEINKNTGKVTVRSARSDVINLVKPDFTKSPFTLLDREQQDSYELAIVAEDGGDPPRRATTIIHIGVSDVNDHAPQFRYPIPHGPGSVLNVSCAQLSNQIIARVHANDSDSGQ--NGEIEYSIIRDISVN 927          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: K1R047 (Protocadherin-11 X-linked OS=Crassostrea gigas OX=29159 GN=CGI_10016818 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.534e-89
Identity = 263/836 (31.46%), Postives = 428/836 (51.20%), Query Frame = 1
Query:  553 LPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKY---FFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTA-KADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQD-----QVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG--PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ-FGIDPISG---KIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISF-LFGILCLLKRK 3006
            +PS + V  IA+   I + +     K ++F + +  ++ Y   F   + +  ++T   +DRE +C             PT   CIL   +   K DN  +++I+VL+ ++D+NDN P+F     ++ + E+  +G  +      D DS+  S  S        G   F+ R   D      +++ + K LDRE+ D ++LVI A D GS    GTL VNI + D NDN P ++   ++++++ED     +II L AED D+G+NG+V YEF +      S++++ FLLN  +GEI++   LDYE  Q  + +  VIA+DNG   + S   +V ITV+DINDN P I  I+L       + EN +  Q +A++ V D D G+ G VNC I N+NF ++ +    +  + +T  + +DRE +  + + I C DFG P  T+     + V D NDN P+F   +Y+   PENN +G  + HV ATDKD  ENG V Y    N +   +I+  +G ++A+  FDRE     +F VIA DNG      +S++ V + I D ND  P F   +Y   +PE+    K + Q  A+D DIG N +  + ++  +S  F ID   G   KI+L     DREK   Y  ++   D G P+      V++ ++D+NDNPP   +P+ +NN +++S   +P  +IA++ AND+D  +  +  +TY ++    V              LF ID+  G + L  + P    +    + I   D G P  ++ T+L++ V     +K +  N I           I+ +V +  ++IS  L  I+C+++++
Sbjct:    1 MPS-TFVGNIANDSNIRNEVTPVMLKQLKFQIWNGGNTAYDKLFRIIESTGRLETAKLIDREEVC------------QPTSS-CILSLGVAVFKPDNELLKVIKVLVTVDDINDNFPAFPQPSISLQISESSDIGHTLLTSTAHDGDSE--SQNSALTYQLLSGGNTFSVRTVPDVDSRENLEIVVEKKLDREVQDFYQLVIVAKDSGSPQRNGTLHVNITVLDSNDNAPSFLNNTYNITVQEDQAKGTVIINLSAEDDDIGDNGRVTYEFSS---RTSSQVKDAFLLNETTGEIKISSPLDYE--QETKYQFVVIARDNGRTSL-STQVIVNITVLDINDNAPQIN-INLPPGGT-GVVENAEIGQYIATVVVTDSDGGENGTVNCTISNENFNIVKM---FSNIFKITLGSRLDRERVPEHNVTINCFDFGKPPKTNKTFFYVKVSDVNDNVPVFSQNIYEADFPENNNIGDMVVHVTATDKDEGENGQVTYKF-KNLQPYFAINPTSGIISANHIFDRENMSDLTFQVIASDNGVNGQKFTSTATVVVRITDKNDEYPIFSRNRYDIIVPEEQPISKPIEQFSAVDKDIGGNGQFYFRIEEGYSNIFTIDASGGLKTKILL-----DREKKEEYHFQIYVIDRGTPALTSSANVSLYLKDINDNPPQVYYPNDRNNSISLSLQSVPKTIIARVIANDTD--KGVNAHLTYSIIQGNVV-------------KLFSIDNQTGVIRL-ERVPVEEEAGTYNLVIAVTDSGVPSKTNWTHLVIIV----GEKSNSQNLI-----------IVIVVCSVTMVISLALIMIICIIRKR 772          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A5J4NUF5 (Protocadherin delta 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0011773 PE=4 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.353e-89
Identity = 255/843 (30.25%), Postives = 405/843 (48.04%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKT--HKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKS------------------PTPDLCILQFQMTAK-----------------ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDG-----------------------SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWI-----------------------TENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQ----SPEIRLHVIAKDN---GEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL---------------FKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLS------------------------LDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFG-FPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDN-GPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRS-------------------ANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPS--SKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            I+EELP G+ ++ ++S   + + + +    +   ++ L+++ DS  F  +  S ++    +LDRE+LC   + + CC+ ++                  P   LC L   ++ +                 A ++ +E+I + I L+D+ND++P F     ++ V E+  +G +   F++ D D+  +    +++                         S V    F ARL +D V L L+  LDRE +  + + +TA DG    P +  L + + +TD+NDN P W+                       T  F+VS+ ED PI  +I  L A D D G+N ++ Y  +       + L ++F + S +GE+R++ +LDY+        PEI + VI +D+   G ++  S    +++ ++D+ND  P I A  LS   L               F I EN    Q VASI V+DPDTG GG+V+C ++++ F+L                          +  P T  Y L +   +DRE I  + +++ C D      L STR L+I V DENDN P F  +       EN   GQ IG +NATDKD+ EN  + + +       VS+ S+TG +  +  FDRE   +  F V   D  G +  ++S+ V + ILD NDH P F   YFFSIPE+S PG  VG+V A D D GEN KI Y L+    +F +D ++GKI +RS                   +++DRE+   YEL VIA DGG P  +  T+V+I + D+ND+ P F++P+     + +NVSC Q+ + +IA++ ANDSD
Sbjct:   49 IQEELPPGTTIIDLSSHPVLKNLLTSNLQTADGFQYRLMNTFDSHLFRISPSSGQLSLATRLDREALCASQKAQFCCNIRAQIPTTLLSEVSWKPVENVPKSQLCHLVAHISLQPNKDHLHSKELIDQQNLAQSSRLELIYLYIRLDDINDHTPQFATPVTSLNVPEDTPVGNLLHYFRIFDPDAGSYGLHEVKLTAVPLSSGNLQSSQQISSNSRGDTSSPVTSHPFEARLSRDGVSLILLSPLDRETIPAYDVTLTATDGDKLKPKSSQLSLRLLVTDVNDNSPMWVQQRRQEESDSLESDEIILPNEPATTQFNVSMPEDTPIGSMIYWLQARDFDTGDNARLQYAIDTSAPGGLTAL-DYFSVQSTTGEVRLRTQLDYDTTSVEATGPEIEVPVIVRDSPRVGRQL--SARATLYVHILDVNDIYPVIVASPLSPMPLRKPFQTQLSSVHQTTFGIWENQPPGQPVASILVSDPDTGDGGKVSCSVNHEFFKLAGESIKTDRFPTYPSSDYQDITAMNGIVGPTT--YQLISVQKLDREQIPRHQVLLTCRDHDRVRPLVSTRRLDIEVIDENDNAPHFEDSPVVLVCQENAPPGQIIGRINATDKDVGENARLRFRIDDVNSNWVSVHSHTGEVRVNTVFDREIETERQFLVFVSDGIGSTAHTTSTQVRVRILDENDHAPHFTDLYFFSIPENSPPGTEVGRVSAEDEDSGENGKIHYLLRQPSKEFDLDKVTGKITVRSPKHDNSLGLGRSDFGSSPISSLDREQQDAYELTVIAEDGGDPPRRSTTVVHIGLSDLNDHAPQFRYPTPHGPGSVLNVSCAQLSSQVIARVHANDSD 886          

HSP 2 Score: 90.8929 bits (224), Expect = 1.626e-14
Identity = 92/350 (26.29%), Postives = 159/350 (45.43%), Query Frame = 1
Query: 1069 KLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSL-----------DNPLTKG---YSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLG------------QYIGHVNATDKDIEENGHVIYSLSSNAEAI 2031
            +L  ++ LDRE +   ++++T  D     P   T  ++I + D NDN P +      +  +E+ P   +I ++ A DKDVG N ++ +  +++ +       N+  ++S +GE+RV    D E     E +  V   D      H+ ST V + ++D ND+ P+   +       F I EN     +V  +S  D D+G+ G+++  +   +K F L  +           DN L  G   +  +  +S+DRE   +Y + +   D G P   ST V++I + D ND+ P       QFR P  +  G            Q I  V+A D D   NG + YS+  +++ +
Sbjct:  576 QLISVQKLDREQIPRHQVLLTCRDHDRVRPLVSTRRLDIEVIDENDNAPHFEDSPVVLVCQENAPPGQIIGRINATDKDVGENARLRFRIDDVNS-------NWVSVHSHTGEVRVNTVFDREI--ETERQFLVFVSDGIGSTAHTTSTQVRVRILDENDHAPHFTDL-----YFFSIPENSPPGTEVGRVSAEDEDSGENGKIHYLLRQPSKEFDLDKVTGKITVRSPKHDNSLGLGRSDFGSSPISSLDREQQDAYELTVIAEDGGDPPRRSTTVVHIGLSDLNDHAP-------QFRYPTPHGPGSVLNVSCAQLSSQVIARVHANDSDSGRNGEIEYSIVRSSQLM 904          
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Match: A0A4E0RFC9 (Protocadherin-11 Y-linked OS=Fasciola hepatica OX=6192 GN=D915_002722 PE=4 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 2.558e-87
Identity = 259/845 (30.65%), Postives = 405/845 (47.93%), Query Frame = 1
Query:  541 IKEELPSGSLVLQI-ASPVEI---SSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPD-----------------------LCILQFQMT--------AKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDGSHVG------------------KEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGS-NPNTGTLXXXXXXXXXXXXQPKWITEN--------------------------FSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYE----YLQSPEIRLHVIAKDN---GEEIIHSISTVVFITVIDINDNPPNI-----QAISLSKDKL-----------FKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQL------------------------------LSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPS-LTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARD-NGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN------------------IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPS--SKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            I EELP GSLV+ + A+P+     ++F  +      ++ L+++ DS+ F     S  +    +LDRE LC   + + CC+ ++  P                        L  +  Q T         K+  N + +I V I L+DVND++P F    +++ V E+  +G + Q +Q+SD D+ +     +++D + +                      F  ++ +D V L L++ LDRELV  + +V+TAIDG    P    L + I++TD NDN P WI ++                          F+V++ E+  +  LI  L A+D DVG+N ++ Y  +       + L ++F +   +GE+R++ +LDY+    +    E+ + VI +D+   G ++    + VV IT  D+ND  P I     Q I +    L           F + EN    Q +ASISVNDPDTG GG ++C + +  F L                               S   P+T  Y L +   +DRE I  + I++ C D      L ST+ L+I V DENDN P F + +      EN+  GQ IG + ATDKD+ EN  + Y +     + V + + TG +  +  FDRE   +  F V   D +GP+  ++S+ V + +LD NDH+P F   YFFSIPE+S PG  VG ++A D DIGEN K+ Y L     +F +D  SGK+ +R++                   +DRE+   YEL V+A DGG+P  +  T+V+I + DVNDN P F +P+     + +NVSC Q+   LIA++ +NDSD
Sbjct:   58 IPEELPPGSLVIDLNANPLVKNIQTAFEGSSGPLSFQYRLMNTYDSRLFRVGSHSGRMTVAARLDRELLCTSQKAQFCCNARNALPSSLFSDPNWKEDNDSVAKSQRCHLLAHISIQSTILRSGDADGKSAVNQMALIYVYIRLDDVNDHTPQFTTQSNSLNVAEDTPVGTVLQYYQISDPDAGVNGLDQVKLDVTPMSTVDPKKIRDNLDAVTLFKSNPFETQVSRDGVSLLLVRALDRELVAAYDVVLTAIDGDRLKPKFSQLNLRIHVTDANDNPPIWILQHDQSTVTMPDYFLTHTPSPTEAAQNPRFNVTVPENTQVGALIYWLQAKDPDVGDNARLQYAIDTSAPGGLTAL-DYFSVQPTTGEVRLRSQLDYDSASLHFSKSEMEVPVIVRDSPRIGRQLSAKATLVVHIT--DVNDMYPVIVASPLQPIPMHSHHLGSVLHEEAQTTFGVWENRPPGQPIASISVNDPDTGDGGTISCSVQSDFFTLTPENEKSEYFSEFTNQPVFASNKNSMISTDASYPGPIT--YHLLSFQRLDREAIPKHQIVLTCRDHDRSRPLVSTQRLDIEVLDENDNPPEFPNQVIVLTCAENSPPGQIIGRLTATDKDLGENARLRYWVDDRDASWVGVHALTGDVRINTVFDREAEKEREFMVYVVDSDGPTRHTASATVKVQVLDENDHSPLFTDLYFFSIPENSPPGTEVGFLQAEDEDIGENGKVYYMLNPPSREFELDRDSGKLTVRTSGFDPVHQSLTDSGKMRVSPLDREQQDTYELTVVAEDGGNPPRRATTVVHIGLSDVNDNAPQFSYPTPHGPGSVLNVSCEQLSTQLIARVYSNDSD 897          

HSP 2 Score: 131.339 bits (329), Expect = 6.880e-27
Identity = 135/516 (26.16%), Postives = 217/516 (42.05%), Query Frame = 1
Query: 1417 QKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNI--QAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSL-TSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKE-------------------FDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPG------------KTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQI--RANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            Q+LD E +   +I L     D    ++ +    + I V+D NDNPP    Q I L+        EN    Q +  ++  D D G+   +   +D+++   + + + LT    + T    DRE       ++   D   P+  T++  + + V DEND+ P+F + LY F IPEN+  G  +G + A D+DI ENG V Y L+  +     +D ++G LT                        DRE  D Y  TV+A D G     ++++V++ + DVND+ P+F      S P    PG            + + +V + D D G N +I Y                       +I RE +  +  + I   GG   F   T            P  F+  S+K +E   + + +P   + +     N ++        ++ +L+  P+ N+             F+I+SH GQLFLI+    CS   EI++ IRA D G P LSS   L + V
Sbjct:  593 QRLDREAIPKHQIVLTCRDHDRSRPLVST--QRLDIEVLDENDNPPEFPNQVIVLT------CAENSPPGQIIGRLTATDKDLGENARLRYWVDDRDASWVGV-HALTGDVRINT--VFDREAEKEREFMVYVVDSDGPTRHTASATVKVQVLDENDHSPLF-TDLYFFSIPENSPPGTEVGFLQAEDEDIGENGKVYYMLNPPSREF-ELDRDSGKLTVRTSGFDPVHQSLTDSGKMRVSPLDREQQDTYELTVVAEDGGNPPRRATTVVHIGLSDVNDNAPQF------SYPTPHGPGSVLNVSCEQLSTQLIARVYSNDSDSGRNGEIEY-----------------------SIVRENV--FIQRFIREAGGDELFNTTTEE----------PKTFRN-STKEDEGKTNDSHVPMDAVTEFFDHINVTNTRHTKSAPVSDLLIGGPTANH-------------FEINSHNGQLFLIHPITDCSRPAEIRLLIRAKDGGIPSLSSTAMLTIYV 1040          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh2ac (protocadherin alpha-C2 [Source:NCBI gene;Acc:103030246])

HSP 1 Score: 268.855 bits (686), Expect = 2.342e-74
Identity = 205/633 (32.39%), Postives = 325/633 (51.34%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE----VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAI-----VSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ--ARFSQFGIDPISGKI 2367
             R TI EEL +G++V  I   + +   ++T  ++ +  S  DS   +YF  N ++ ++    ++DRE+LC   E +          D C+L  ++  +   N +E+  V +E+ D NDN+P F   +  + + E  K G   RF +  A     ++ S+         H+  +          ++L L K  DRELV + +LV+TA DGGS P +GT  +N+ + D NDN PK+ +  + V ++E+ PI  L+IKL A D+D G NG VYY F +   E   R+R  F +++ +GEIRV+  +D+E   S E+ +  + + +G   +H     V + V+D+NDNPP+I   +LS      ++E+ +    VA ISVND D+G+  +V  +I   N  F++ S  N     Y++ T   +DRE + SY + I   D G P+L+S+ V+ + V D NDN P F  T Y   + ENN     +  V ATD D  EN  + Y+ L+ N   I     VSI   TG + A + FD E   ++ F V A+DNG   LS  + +Y+ ++D NDH P+F            +I  ++  G  V +  A D D G+NA + Y L+  A    F +   +G+I
Sbjct:   34 IRYTIPEELETGAVVGDIVRDLGLD--LRTLSARRIRISS-DSA-RRYFNINHKTGKLLVSDRIDRETLC---EFR----------DACLLNLEVVVE---NPLEVHNVEVEILDANDNAPLFPRDEYQLEISEAAKPG--ARFPIEGAQDSDDASNSVRHYRLSTNEHLALDSNKPPANGKHIELVLKKPFDRELVPSHQLVLTATDGGSPPRSGTAKINVRVLDTNDNVPKFDSSVYKVKLRENSPIGALVIKLNATDRDEGTNGDVYYSFSSYTPE---RVRQMFSMDTDTGEIRVKSNVDFEETNSYEMYIQAMDRGHGAVAVH---CKVVVEVLDVNDNPPDIVLSTLSS----PVREDARADTVVALISVNDRDSGQNKQVTLDIIPPNLPFKIKSFRN----HYTIVTSAFLDREAVSSYNVTITAVDGGTPALSSSMVIRVEVADVNDNPPRFEQTSYTVYVTENNAPSAPLCVVKATDPDANENARITYTVLNDNNHGISVASYVSIKPATGEVYALRSFDFEKLREFHFQVKAQDNGVPPLSRVATIYVYVMDSNDHAPRFVHPASNVSHTVETILRNAEAGVLVTRALAWDGDAGQNAWLLYALEHPAELDLFKVHEHTGEI 630          

HSP 2 Score: 143.665 bits (361), Expect = 3.313e-34
Identity = 139/516 (26.94%), Postives = 237/516 (45.93%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQQKLDYEYL----QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQL-----LSLDN--PLTKG--YSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS----NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK-IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            R +F +N  +G++ V  ++D E L     +  + L V+ ++  E  +H++     + ++D NDN P           LF   E    + + A      P  G     +     ++++L     L+LD+  P   G    L      DRE + S+ +++   D G P  + T  +N+ V D NDN P F S++Y+ ++ EN+ +G  +  +NATD+D   NG V YS SS        + S+D++TG +      D E ++ Y   + A D G   ++    V + +LDVND+ P   L    S + ED+     V  +   D D G+N ++T  +      F I        I+ SA +DRE +S Y + + A DGG P+     ++ + + DVNDNPP F+     +  V V+ N  P+  +  ++A D D ++  + RITY +L     N  +    ++ Y     I    G+++ +  F       E    ++A D+G P LS    + V V+
Sbjct:   75 RRYFNINHKTGKLLVSDRIDRETLCEFRDACLLNLEVVVENPLE--VHNVE----VEILDANDNAP-----------LFPRDEYQLEISEAAKPGARFPIEGAQDSDDASNSVRHYRLSTNEHLALDSNKPPANGKHIELVLKKPFDRELVPSHQLVLTATDGGSPPRSGTAKINVRVLDTNDNVPKFDSSVYKVKLRENSPIGALVIKLNATDRDEGTNGDVYYSFSSYTPERVRQMFSMDTDTGEIRVKSNVDFEETNSYEMYIQAMDRGHGAVAVHCKVVVEVLDVNDNPPDIVLSTLSSPVREDARADTVVALISVNDRDSGQNKQVTLDIIPPNLPFKIKSFRNHYTIVTSAFLDREAVSSYNVTITAVDGGTPALSSSMVIRVEVADVNDNPPRFE---QTSYTVYVTENNAPSAPLCVVKATDPDANE--NARITYTVL-----NDNNHGISVASY---VSIKPATGEVYALRSF-DFEKLREFHFQVKAQDNGVPPLSRVATIYVYVM 559          

HSP 3 Score: 87.8113 bits (216), Expect = 5.746e-17
Identity = 110/466 (23.61%), Postives = 201/466 (43.13%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQ------DQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEF--ENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN-----PLT-KGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF--------HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDV 2184
            + + D NDN P F +S   + ++EN  +G  + +   +D D      +    D  +    Y   R+ Q      D  ++ +  ++D E  +++++ I A+D G         V + + D+NDN P  +    S  ++ED   + ++  +   D+D G N +V  +    N+  + +S  RN +        I     LD E + S    + + A D G   + S S V+ + V D+NDNPP  +  S +      + EN      +  +   DPD  +   +   + N N   +S+ +     P T + Y+L    S D E +  +   +K  D G P L+    + + V D ND+ P F        H+     R  E  VL   +    A D D  +N  ++Y+L   AE  +  +  +TG +  ++    + S  +S TV  RD+G    S+S+ + + ++++
Sbjct:  233 VRVLDTNDNVPKFDSSVYKVKLRENSPIGALVIKLNATDRD------EGTNGDVYYSFSSYTPERVRQMFSMDTDTGEIRVKSNVDFEETNSYEMYIQAMDRGHGAVAVHCKVVVEVLDVNDNPPDIVLSTLSSPVREDARADTVVALISVNDRDSGQNKQVTLDIIPPNLPFKIKS-FRNHY-------TIVTSAFLDREAVSS--YNVTITAVDGGTPALSS-SMVIRVEVADVNDNPPRFEQTSYT----VYVTENNAPSAPLCVVKATDPDANENARITYTVLNDNNHGISVASYVSIKPATGEVYAL---RSFDFEKLREFHFQVKAQDNGVPPLSRVATIYVYVMDSNDHAPRFVHPASNVSHTVETILRNAEAGVL---VTRALAWDGDAGQNAWLLYALEHPAELDLFKVHEHTGEIRTTRRVYEDNSTVFSLTVHVRDHGLPPRSASATINVAVMEL 671          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 263.077 bits (671), Expect = 2.460e-72
Identity = 232/715 (32.45%), Postives = 354/715 (49.51%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSF-MKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEIKTLV-KLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE----VDG-SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            I+EEL    L+  I   + IS     T  S  + + L+  + D+        + EI T   ++DRE LC  P  ++           C  + ++     N+   +I++ I ++D NDN+P F +    I + EN  +    RF +  A        S+     V+G S  G +       +   +L + ++LDRE  D + + I   DGGS   + T I+ + +TD+NDN+P +      V I E  P+   +++L A D DVG N ++ Y F     +     R  F LNS +G I VQ+ LD E  ++   +L V+A D       S    V I V D+NDN PNI     IS +   +   +++  N + +A I+V+D DT   G+V C I+ +  F L ++ DN     Y L T   +D E    YI  I  +D G PSL  T ++ + +EDENDN PIF   + +  + ENN    Y+  + ATD+D   N  ++Y L  NA +   +D  TG LTAS+ FDRE  +++ FTV ARDNG   L S + V +TILD ND++PKF   +F F + E+     TVG +   D D GENA ++  +      F +DP +G +I  + + DRE+ S Y   V A D GHP       V IN+ DVNDNPP+  +P S  +   V  + +P  ++A++ A D D     + + T +
Sbjct:   30 IREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDS---------ECSFEIEVVILP-NDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMF---GTQVSPATRRLFALNSTTGLITVQRPLDRE--ETANHKLSVLASDGSSS---SARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTK-IALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN----QYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTG-VIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIV 717          

HSP 2 Score: 104.76 bits (260), Expect = 3.290e-22
Identity = 165/635 (25.98%), Postives = 266/635 (41.89%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP------IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF-----QFPSSKNNEVNVSCNQMPNH-LIAQIRANDSD--------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNP---IWTPEKKSH----WTAIISLVVATAILISFLFGILCLLK 3000
            P + +   ++SI E+  IN       A D D+G N    YE  N ++          ++ +  GE    + VQQ LD E   +  +++ V   ++G     S + ++ +TV D+NDN P  +   +       I E+      V  +   D D G   E+      ++     +L +L++  T G  +T    +DRE   ++ + +  +D    S  +T  +N  V D NDN P      I   T     + E + +   I  +  +DKD + NG VI  +  +    + ++  N   L  S   D E + +Y F ++A D+G   L+ ++LV + + D ND+ P F       ++ E++     +  + A D D G NA+I Y L    S F +D  +G ++  S   DRE   R+   V A D G  + Q +  V + I D NDN P F     QF  S+N         +P +  +  I   D+D        LS   DN   +IL P+  V          I  N+ FD +               SY++++    RAVD G P  SS   + + VI D++D     NP   I+ P   S      +AI   VVA    +    G+   LK
Sbjct:  139 PMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSA-----FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV---EDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIE----VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNS--TTGL-ITVQRPLDREETANHKLSVLASDGSSSSARATVTIN--VTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTG-VLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSEN---------LPKYSTVGVITVTDADAGENAVVSLSILNDNE-NFILDPYTGV----------IKSNVSFDREQQS------------SYTFDV----RAVDSGHPPCSSAAKVTINVI-DVND-----NPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELK 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 263.077 bits (671), Expect = 3.430e-72
Identity = 232/715 (32.45%), Postives = 354/715 (49.51%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSF-MKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEIKTLV-KLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIE----VDG-SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            I+EEL    L+  I   + IS     T  S  + + L+  + D+        + EI T   ++DRE LC  P  ++           C  + ++     N+   +I++ I ++D NDN+P F +    I + EN  +    RF +  A        S+     V+G S  G +       +   +L + ++LDRE  D + + I   DGGS   + T I+ + +TD+NDN+P +      V I E  P+   +++L A D DVG N ++ Y F     +     R  F LNS +G I VQ+ LD E  ++   +L V+A D       S    V I V D+NDN PNI     IS +   +   +++  N + +A I+V+D DT   G+V C I+ +  F L ++ DN     Y L T   +D E    YI  I  +D G PSL  T ++ + +EDENDN PIF   + +  + ENN    Y+  + ATD+D   N  ++Y L  NA +   +D  TG LTAS+ FDRE  +++ FTV ARDNG   L S + V +TILD ND++PKF   +F F + E+     TVG +   D D GENA ++  +      F +DP +G +I  + + DRE+ S Y   V A D GHP       V IN+ DVNDNPP+  +P S  +   V  + +P  ++A++ A D D     + + T +
Sbjct:   30 IREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDS---------ECSFEIEVVILP-NDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMF---GTQVSPATRRLFALNSTTGLITVQRPLDRE--ETANHKLSVLASDGSSS---SARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTK-IALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDN----QYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTG-VIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIV 717          

HSP 2 Score: 104.76 bits (260), Expect = 3.698e-22
Identity = 165/635 (25.98%), Postives = 266/635 (41.89%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP------IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF-----QFPSSKNNEVNVSCNQMPNH-LIAQIRANDSD--------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNP---IWTPEKKSH----WTAIISLVVATAILISFLFGILCLLK 3000
            P + +   ++SI E+  IN       A D D+G N    YE  N ++          ++ +  GE    + VQQ LD E   +  +++ V   ++G     S + ++ +TV D+NDN P  +   +       I E+      V  +   D D G   E+      ++     +L +L++  T G  +T    +DRE   ++ + +  +D    S  +T  +N  V D NDN P      I   T     + E + +   I  +  +DKD + NG VI  +  +    + ++  N   L  S   D E + +Y F ++A D+G   L+ ++LV + + D ND+ P F       ++ E++     +  + A D D G NA+I Y L    S F +D  +G ++  S   DRE   R+   V A D G  + Q +  V + I D NDN P F     QF  S+N         +P +  +  I   D+D        LS   DN   +IL P+  V          I  N+ FD +               SY++++    RAVD G P  SS   + + VI D++D     NP   I+ P   S      +AI   VVA    +    G+   LK
Sbjct:  139 PMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSA-----FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV---EDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIE----VHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNS--TTGL-ITVQRPLDREETANHKLSVLASDGSSSSARATVTIN--VTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTG-VLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSEN---------LPKYSTVGVITVTDADAGENAVVSLSILNDNE-NFILDPYTGV----------IKSNVSFDREQQ------------SSYTFDV----RAVDSGHPPCSSAAKVTINVI-DVND-----NPPIVIYPPSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELK 713          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 255.373 bits (651), Expect = 8.448e-70
Identity = 221/711 (31.08%), Postives = 355/711 (49.93%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK--ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRF-QVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISLS--KDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLL-----SLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            ++EE P  +L+  +A+   +      +K +V          + Y   + ++ EI  T + +DRE+L      K+C     P    C L+F+++      N +  +I+  IE++D+NDN+P F +   T+ V+EN  +G      Q +D D++       ++         F+ ++  D+     +L ++ +LDREL D++ L I A+DGG+     + ++ + ITD NDN P++   ++   + E+ P+ + ++++ A D D+G NG++ Y      +     L+    +   +G I V+  LD E + S   + HVIA+D G     S +T V I V D NDN P   I+ I L    D +  I E++     VA + V+D D G+   V C +  +  FQL      S+DN   K Y L T   +D E I  Y + I   D G P+L+ST  L + V D NDN PIF   L++    E N  G+ +  V A D D   N  ++YS+   S+   +  ID ++G + A    DRE  ++Y F V A D G PSH  ++++V + +LD ND+ PKF L  Y FS+ E+  P   VG V  +D+D GENA++   ++     F +   +G  IL S + DREK S Y  ++ A DGG P       V IN+ D NDN PV   PS+ +    +S    P+ ++  + A D D
Sbjct:   29 VREEQPPNTLIGSLAADQGLPDSGHLYKLEV---------GAPYLRVDGKTGEIFTTEIPIDRETL------KDCRIKGKP----CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQ----IERSTGIISVKGPLDREEISS--FKFHVIARDKGPSP-KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDN--KKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVV-IKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTG-TILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDID 708          

HSP 2 Score: 136.732 bits (343), Expect = 4.269e-32
Identity = 158/562 (28.11%), Postives = 240/562 (42.70%), Query Frame = 1
Query:  844 IIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKH-LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSV--------SIKEDVPINHLIIKLLAEDKDVGNN--------GKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIK--ENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP---KFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPS 2451
            +++V+I   D NDN+P F  S     V EN  +G     QV   DS L     IE                +    +  +K  LDRE + +FK  + A D G +P + T  V+I +TD NDN P        +        +I ED+P+   +  +   DKD G N        G V ++     +      + +FL        +    LDYE ++  + R+ ++A D+G   + S +++  + V D NDN P      +    LF+++  E  Q  ++V  +   D D+G   E+   I  D+    L  +D        +   + +DRE    Y   +   D G PS   T  + I V D NDN P F  + Y F + EN      +G V   D D  EN  V  S+  +    V + + TG++ +S  FDRE    Y+F + A D G    SS   V + +LD ND+ P   K     F  +   + P   V  VEA D+D G NA++ Y +        F I P  G+I L +  + R+    + L V  SD G PS
Sbjct:  228 LLRVVIT--DANDNAPQFEKSSYEAEVSENSPVG-YSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFL--------QTTTPLDYERIR--DYRVEIVAVDSGNPALSSTNSL-RVQVTDTNDNSP------IFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEID---PSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKL-TKELTRKHGGLHRLVVKVSDRGKPS 764          

HSP 3 Score: 119.398 bits (298), Expect = 1.022e-26
Identity = 152/582 (26.12%), Postives = 249/582 (42.78%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFR--------IPENNVLGQYIGHVNATDKDIEEN--------GHVIYSLSSNAEAIVSIDSNTGS-LTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFG---IDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL--FDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISD 2865
            P++ +   ++S++E+  +        A D+D   NG + Y+       E S L +  + N   GE    + V   LD E   S ++ ++ +  D G    +S S ++ + + D NDN P  +  S   +    + EN      V  +  ND D G  GE+   I   +  +  +         ++    +DRE I S+   +   D G    +ST  ++I V D+NDN P         R        I E+  +G  +  V  +DKD  EN        G V + L    ++  S+D+     L  +   D E    Y   ++A D+G   LSS++ + + + D ND++P F    F     E++ PG+ V  V A+D D G NA++ Y + A  S  G   IDP SG++  RS  +DRE   RYE +V A+D G PS +G   V I + D NDN P F   S      +V  N  P   +  +   D D  +                   + Q +LS+  ++  F + +  G +      ++    SY++ +K    AVD G P  SS   + + V+ +
Sbjct:  129 PQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLS--AGPEASALFSLQMAND-RGEKLPQLIVLGNLDRELKDSYDLTINAV--DGGTPSRYS-SALLRVVITDANDNAPQFEKSSYEAE----VSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS--SVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSP-LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYS---FSVLENMPPLSPVGMVTVLDMDKGE-------------------NAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLK----AVDGGEPPRSSYVGVTINVLDE 671          

HSP 4 Score: 58.151 bits (139), Expect = 5.354e-8
Identity = 94/345 (27.25%), Postives = 146/345 (42.32%), Query Frame = 1
Query: 1903 LYQFR--IPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSL-TASKEFDRETSD-------------KYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR------FS-QFGID---PISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            LY  R   P N ++G       A D+ + ++GH +Y L   A   + +D  TG + T     DRET               + S T + ++  P  +       + + D+ND+TP+F       S+ E+++ G T    +A D D   N  + Y L A       FS Q   D    +   I+L   N+DRE    Y+L + A DGG PS     ++ + I D NDN P F+     + E  VS N    + + Q++ANDSDL    +  I Y +      + P P+        +  I+   G + +         S   K H+ A D G    SS TY+ ++V
Sbjct:   26 LYHVREEQPPNTLIGSL-----AADQGLPDSGH-LYKLEVGA-PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGR----IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVL--GNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFE---KSSYEAEVSENSPVGYSVLQVKANDSDL--GPNGEIEYTIH---QASDPVPK--------MLQIERSTGIISVKGPLDREEIS-SFKFHVIARDKGPSPKSSTTYVSIEV 340          
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 256.529 bits (654), Expect = 1.859e-69
Identity = 205/658 (31.16%), Postives = 331/658 (50.30%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK--ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRF-QVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQ----VKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--NIQAISLS--KDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLL-----SLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            ++EE P  +L+  +A+   +      +K +V          + Y   + ++ EI  T + +DRE+L      K+C     P    C L+F+++      N +  +I+  IE++D+NDN+P F +   T+ V+EN  +G      Q +D D++       ++         F+ ++  D+     +L ++ +LDREL D++ L I A+DGG+     + ++ + ITD NDN P++   ++   + E+ P+ + ++++ A D D+G NG++ Y      +     L+    +   +G I V+  LD E + S   + HVIA+D G     S +T V I V D NDN P   I+ I L    D +  I E++     VA + V+D D G+   V C +  +  FQL      S+DN   K Y L T   +D E I  Y + I   D G P+L+ST  L + V D NDN PIF   L++    E N  G+ +  V A D D   N  ++YS+   S+   +  ID ++G + A    DRE  ++Y F V A D G PSH  ++++V + +LD ND+ PKF L  Y FS+ E+  P   VG V  +D+D GENA++   ++     F +   +G  IL S + DREK S Y  ++ A DGG P
Sbjct:   65 VREEQPPNTLIGSLAADQGLPDSGHLYKLEV---------GAPYLRVDGKTGEIFTTEIPIDRETL------KDCRIKGKP----CFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQ----IERSTGIISVKGPLDREEISS--FKFHVIARDKGPSP-KSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDN--KKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVV-IKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFVVQNGTG-TILSSISFDREKESSYTFRLKAVDGGEP 692          

HSP 2 Score: 138.658 bits (348), Expect = 1.360e-32
Identity = 158/562 (28.11%), Postives = 240/562 (42.70%), Query Frame = 1
Query:  844 IIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKH-LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSV--------SIKEDVPINHLIIKLLAEDKDVGNN--------GKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIK--ENVQNVQQVASISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTP---KFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPS 2451
            +++V+I   D NDN+P F  S     V EN  +G     QV   DS L     IE                +    +  +K  LDRE + +FK  + A D G +P + T  V+I +TD NDN P        +        +I ED+P+   +  +   DKD G N        G V ++     +      + +FL        +    LDYE ++  + R+ ++A D+G   + S +++  + V D NDN P      +    LF+++  E  Q  ++V  +   D D+G   E+   I  D+    L  +D        +   + +DRE    Y   +   D G PS   T  + I V D NDN P F  + Y F + EN      +G V   D D  EN  V  S+  +    V + + TG++ +S  FDRE    Y+F + A D G    SS   V + +LD ND+ P   K     F  +   + P   V  VEA D+D G NA++ Y +        F I P  G+I L +  + R+    + L V  SD G PS
Sbjct:  264 LLRVVIT--DANDNAPQFEKSSYEAEVSENSPVG-YSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFL--------QTTTPLDYERIR--DYRVEIVAVDSGNPALSSTNSL-RVQVTDTNDNSP------IFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEID---PSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDVGNFV-VQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKPSNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKL-TKELTRKHGGLHRLVVKVSDRGKPS 800          

HSP 3 Score: 119.013 bits (297), Expect = 1.575e-26
Identity = 150/581 (25.82%), Postives = 248/581 (42.69%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIR---VQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFR--------IPENNVLGQYIGHVNATDKDIEEN--------GHVIYSLSSNAEAIVSIDSNTGS-LTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFG---IDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL--FDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISD 2865
            P++ +   ++S++E+  +        A D+D   NG + Y+       E S L +  + N    ++    V   LD E   S ++ ++ +  D G    +S S ++ + + D NDN P  +  S   +    + EN      V  +  ND D G  GE+   I   +  +  +         ++    +DRE I S+   +   D G    +ST  ++I V D+NDN P         R        I E+  +G  +  V  +DKD  EN        G V + L    ++  S+D+     L  +   D E    Y   ++A D+G   LSS++ + + + D ND++P F    F     E++ PG+ V  V A+D D G NA++ Y + A  S  G   IDP SG++  RS  +DRE   RYE +V A+D G PS +G   V I + D NDN P F   S      +V  N  P   +  +   D D  +                   + Q +LS+  ++  F + +  G +      ++    SY++ +K    AVD G P  SS   + + V+ +
Sbjct:  165 PQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLS--AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAV--DGGTPSRYS-SALLRVVITDANDNAPQFEKSSYEAE----VSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDS--SVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSP-LDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYS---FSVLENMPPLSPVGMVTVLDMDKGE-------------------NAQVQLSVEPDVGNFVVQNGTGTILSSISFDREKESSYTFRLK----AVDGGEPPRSSYVGVTINVLDE 707          

HSP 4 Score: 57.7658 bits (138), Expect = 8.402e-8
Identity = 90/345 (26.09%), Postives = 144/345 (41.74%), Query Frame = 1
Query: 1903 LYQFR--IPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSL-TASKEFDRETSD-------------KYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGI----------DPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            LY  R   P N ++G       A D+ + ++GH +Y L   A   + +D  TG + T     DRET               + S T + ++  P  +       + + D+ND+TP+F       S+ E+++ G T    +A D D   N  + Y L A      +          + +   I+L   N+DRE    Y+L + A DGG PS     ++ + I D NDN P F+     + E  VS N    + + Q++ANDSDL    +  I Y +      + P P+        +  I+   G + +         S   K H+ A D G    SS TY+ ++V
Sbjct:   62 LYHVREEQPPNTLIGSL-----AADQGLPDSGH-LYKLEVGA-PYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGR----IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVL--GNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFE---KSSYEAEVSENSPVGYSVLQVKANDSDL--GPNGEIEYTIH---QASDPVPK--------MLQIERSTGIISVKGPLDREEIS-SFKFHVIARDKGPSPKSSTTYVSIEV 376          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 257.684 bits (657), Expect = 1.882e-71
Identity = 224/718 (31.20%), Postives = 363/718 (50.56%), Query Frame = 1
Query:  514 QLKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEI-KTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNN--VEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV---SDADSKLFSTKSIEV---DGSHVGKEYFNARLYQDQVKL-YLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRL--RNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP-NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN--FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            + K+ +R  + EEL  G+ +   +  + ++ +      KV+  S  +         N ++ E+     K+DRE+LC         DP     D C +  Q+           ++I+V I +ED+NDN+P+F     T+ V EN   G  +RF +   +D DS+    +  E+   D + V     +     +  K+ YL+  K LDRE    +++ + A+DGGS P++G+ ++ IN+TD NDN P +     +V I E+ P+   +++L A D+D G+N +V Y          S    +  F L+  SG + V   L+ E  +SP  R+ ++A D G E + + +TV        +++P   I+ I    + +  I E       VA I+V+DPD G  G V C I N    FQL  L  P    Y L T  ++D ET   Y++ IK  D G  SL+ T  + I + D NDN P+F    Y+  +PENNV+G+++  V+ATD+D+++N  ++Y L  +A  +  +D  TG ++ +++ DRE    YSFT++A+D G   L  ++ V + +LDVND+ P+F L  F F + E+     TVG V   D D GEN ++   +    ++  F IDP SG +I  +   DRE+   Y L+V A+DGG P       V I++ D+NDN P+   P S      V    +P  ++ ++ A D+D
Sbjct:   36 EFKVSYR--VAEELREGAFIGNPSVDLRLADYNLELTYKVM-LSKAEDAAPPLVRVNPRTGELFAAGRKMDREALC------GGQDPG----DECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAG--KRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNRE--ESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYP--NQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESG-MIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDND 733          

HSP 2 Score: 121.324 bits (303), Expect = 5.355e-28
Identity = 153/529 (28.92%), Postives = 231/529 (43.67%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSK-------LFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITE------NFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNV--QQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-----QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIIL 2373
            I + D NDNSP F  ++  + + EN  +G  + +   SD D+           T +        GK  F  RL Q+   + +   L+RE    ++++I A D G  P   T  V + +TD+NDN P           N  + I E   +N  +  +   D D+G NG V     N   E   +L+     N    E R  + LDYE     E  + + A D G   + S +  V I ++D NDN P      +  +  +K+     NV  + + ++S  D D  K  E+   +      +  +D P T   SLT    +DRE   +Y   I   D G P L     + + V D NDN P F    + F + EN      +G V   D D  ENG V  S L ++   + SID  +G + ++  FDRE    Y   V A D G    SS+  V + ++D+ND++P   +      Y F +P  + PG  V +V A+D D   NA++ YH+      + F IDP+ G I L
Sbjct:  255 INVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLF--RLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYN--PEVPFQLKKLTYPNQYLLETR--ETLDYETKN--EYVVQIKAADAGATSL-SRTMSVTIKLLDSNDNAP------VFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMD-PETGIISLTEQ--LDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPR-TLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITL 764          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 221.09 bits (562), Expect = 9.890e-60
Identity = 180/665 (27.07%), Postives = 319/665 (47.97%), Query Frame = 1
Query:  523 LLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIK-HLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA--ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL------SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVND------HTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKIS--RYELKVIASDGGHPSF 2454
            +  +  + EE P+G+LV +++   ++   +  H S+   F L+   D       +    +     +DRE  C           ++P+   C+++F +         +++   +EL D+ND++P F  S+  + + E+V LG  +      D D    + ++  +D +        AR    +    ++K  LDRE    + L +TA DGG  P +GT +V I + D NDN P +   + +V+++ED     +++ L A D D G NG+V Y F +  + E   +R  F L+  +G++ ++ +LD+E   + E  + + A+D G   I +    V + V DINDN P I+   I  S+     + E       V  ++V+D D+ + G V C +  + +F+LL    P    Y + T++S+DRE +  Y ++++ +D G P   + R   + + DENDN P FH + Y+  + ENN  G Y+  V A D D E NG + Y++       ++    VSI+ ++G++ A +  D E     +F V ARD+G   L +++ V + I+D ND      H P         +P D+  G  V  V A D D   N +++Y +     +  F I+ + G++   +A++     S  R+ L V+  D G P+ 
Sbjct:   29 ITVKYALYEEQPAGTLVGRLSD--DLQGRVAEHPSR--HFRLMRRDDFSLVHVEEADGTVSAREVIDREQQC----------GQAPS---CVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAE---VRRLFQLDPKTGKLSLKGQLDHEL--NSEYEISIQARDMGPSSIPA-HCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLL----PYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERNLFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPAL 666          

HSP 2 Score: 62.7734 bits (151), Expect = 4.920e-10
Identity = 79/294 (26.87%), Postives = 130/294 (44.22%), Query Frame = 1
Query: 2026 AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG----PSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGI------DPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            ++V ++   G+++A +  DRE     + + + R +     P  L       + +LD+NDH P F   +    I E    G  V    A DLD+G NA   YHL     +FG+      D      ++  + +DRE+   Y L++ A DGG P   G T+V I + D NDN PVF   S     V V  +  P  ++  + A D D  +  +  + Y        ++  P    +  + LF +D   G+L L  +      + E ++ I+A D G   + +   ++V V  DI+D
Sbjct:   73 SLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDEN-ERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCN---VTVREDATPGTVLLTLNATDVD--EGPNGEVVY--------SFSSPVD--AEVRRLFQLDPKTGKLSLKGQLDH-ELNSEYEISIQARDMGPSSIPAHCKVLVHV-EDIND 348          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.904 bits (507), Expect = 8.192e-53
Identity = 201/714 (28.15%), Postives = 327/714 (45.80%), Query Frame = 1
Query:  676 FCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLC-------ILQFQMTAKA-DNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE----------------IQRFQVSDADS-----KLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWI-TENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQ--QKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL----FKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHS--------TLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS--SNAEAIV---SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGK------IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIA-QIRANDSDLSQATDN 2628
              N+ S E+   ++LDRE+LC++             PD C        +Q    AK   ++N+ ++ V + + D+ND++P+F      + + E+  +G                 IQ +++S A         FS    + D    G           +  L L + LDRE V +++L++   DGG+   +G++++ I + D NDN P ++      V I E   +   +++L A D D G NG + Y F        ++      ++  +G + V+  +KLD E +  P  RL V+A+D G+ +  S S  V + + D NDN P  + I+L  + L     KI EN+ +   V  ISV+DPD G  G V+  ++      L+  N +   + L T   +D E    Y + +   D G P L+    L I V D NDN P+F +         +Y+  + EN   G  + ++ ATD D   NG + ++LS  +  E++    S++  TG LT +   DRE   +Y  +V A D G     + ++V +T+LD ND+ P F          Y F + E+++ G  VG V   DLD G+NA++  +L     + G D I G       ++     +DRE   +YEL V A D G P+      V+I + D NDN PV   P++ +   +V        L+   + AND D   A DN
Sbjct:   75 IVNELSGELSVALRLDREALCME------------EPDACRSTGFMHTVQVAAMAKGQGSSNLRLLDVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQ--AALHVDGTTGLVTVRNAEKLDRETM--PVHRLVVVARDGGQ-LSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQ--FLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNL---VREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDID---AGDN 763          

HSP 2 Score: 117.472 bits (293), Expect = 7.629e-27
Identity = 146/559 (26.12%), Postives = 238/559 (42.58%), Query Frame = 1
Query: 1372 NFFLLNSLSGEIRVQQKLDYEYLQSPE------------IRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS----------------------LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-----SSNAEAIVSIDSNTGSLTA--SKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-----QYF----FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSAN-IDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNN-----EVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQN---LFDIDSHGGQLFLINKFPT-CSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISD 2865
            +  ++N LSGE+ V  +LD E L   E            +++  +AK  G   +  +   V + V DIND+ P  +A  L+      I E+    ++V      DPD G     +  I   +   L L  P +   S                      L     +DRE + SY +++   D G P L+ + +L I+V D NDN P+F        RI E++ +G  +  + A D D   NG + YS      S   +A + +D  TG +T   +++ DRET   +   V+ARD G    S+S  V + + D ND+ P FE+     +Y       I E+   G  V  +   D D+G +  +   L+         P   + +L++   +D E+  +Y + V+A+D G P       + I++ D+NDN PVF  P+S        EV++  N     ++  + A D+D     +  IT+ L            S L+  ++   LF ++   GQL L           YE+ V   A D GSPQ  ++  + V V+ +
Sbjct:   72 SLCIVNELSGELSVALRLDREALCMEEPDACRSTGFMHTVQVAAMAKGQGSSNLRLLD--VQLLVRDINDHAPAFRAPHLN----VSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQL-GPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDAD--SGPNGAITFTL------------SELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVE--ACDGGSPQRKARAIVRVTVLDE 607          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 177.563 bits (449), Expect = 4.948e-45
Identity = 180/624 (28.85%), Postives = 294/624 (47.12%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVP-----INHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDN----PLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGF--PSLTSTRV-LNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIV----------SIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQF-PSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITY 2640
            QV I +EDVNDN P F   +  + V+EN   GE I     +DAD    +  +  V     G    +A        L   + LDRE   ++ L + A DG    +     +++ + D NDN P++    +S  + ED          +I  +LA D D G  G+V Y      +E+       F L+ ++G + V + LD E      +R    A D G     + +  +++ V+D NDN P++Q  SL+     ++ E+      +  IS  D D G    VN E++   F + S D      +     L+   ++DRE    Y ++++ +D     P+  S+ V +++++ D NDN P F S       PE++ +G  +  V A D D   N +V Y+L+++ E             ++++ TG +   +E DRE    Y+ TV+A D G   L+S++ + +T+ D ND+ P+F   +Y  +I ED  PG  V ++ A D D G N ++ Y + +      F +DP+ G + + +  +DRE+ + YEL V A DGG P+      V + + DVND  P FQ  P + +   N    Q P  LI Q+ A D DL   +  ++TY
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAA----SGVLRASRRLDREERASYLLTVRASDGTHATDA---RLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAP--SEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRAR--ATDGGG---LAATARLYVNVLDANDNAPSVQNDSLAA----EVPEDAPPGTSLLRISATDDDEG----VNAELE---FSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSAL-APEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAV-ARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHAREN---TQGPPVLILQVVARDDDL--GSSGQVTY 2092          

HSP 2 Score: 169.859 bits (429), Expect = 1.153e-42
Identity = 193/692 (27.89%), Postives = 322/692 (46.53%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFL-----NSQDTIYVKENVKLGEIQRF-QVSDADSKLFSTK-SIE-VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSN-PNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID----NKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
             +I+L DVNDN P+        +  +  V E+   G +     V+DADS   + + S+  V G+  G    +A        L +   LDRE +  + L I A D G     + T  + + + D+ND+ P++    ++ ++ E  P    +  + A D D G N K+ Y   +  +        +F ++  +G +    K+D E   S  + L++ A+D G +   +  T + +T++D+ND PP    +      +    EN      V S+S  D D G+ G V    D     +  ++  LD+   K   +TT  S+DRE +  Y ++++  D G P L ST  + ++V D NDN+P+F+   Y   I EN   G  +  V ATD D   NG V Y L++   A   +++ TG+++     DRE    Y   V A D G     S ++V +T+ D  D  P F    Y F + E+  PG  VG V A  LD+  NA +TY + +  +   F I+   G+I   +A IDRE+ + Y+L+V+A+ GG     GE  V++ + DVN++ PVF   S    EV+++ ++  N     +RA D D     +  + Y       +   +   +  I+ +        GQL++  +    +   E  + + A+D G   LSS   + V V+ D++D K
Sbjct:  211 AVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGND------LGWFSVDESTGLVTTDGKVDREVASS--VVLNISAQDQGAQP-KTAYTSLTVTLLDVNDEPP----LFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGK---VTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANA-IDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASY---EVSIAEDEPVNSRFFSVRATDKD--SGKNGEVKY------EIGEGNGGEKFGIFPD--------GQLYVRYELDRETRE-EYSLTVSAMDTGVEPLSSSVTVNVTVL-DVNDNK 859          

HSP 3 Score: 169.474 bits (428), Expect = 1.502e-42
Identity = 162/563 (28.77%), Postives = 270/563 (47.96%), Query Frame = 1
Query:  805 FQMTAKADNNNVEI-IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRF---QVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL----QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARF---SQFGIDPISGKIILRSANIDREKISR-YELKVIASDGGHP 2448
            +Q+   A++  V     V + + DVN+++P F  +   + + E+  +    RF   + +D DS        E+ G   G E F   ++ D  +LY+   LDRE  + + L ++A+D G  P + ++ VN+ + D+NDN+P + + ++     E+  +  L+  + A D D G+NG V Y FE  +          F L+S +G I   +  D E L     +      V+A D G          V + V D+NDNPP   A S+ +     + E+  N+ Q+  ++ +D D G  G +   I+  N     ++D    +   +T   S+DRE   SY +++   D G   L ++  + + V DENDN P F  +L      E+  +G+ +  + A+D+D   +G V Y++ + N  A  +ID +TGS+  ++  D ET   Y   V A D G    SS++++ + + D ND+ P F     F SI E+   G  V  V A D D   N ++ Y +  +F   + F IDP SG+I   +A IDRE     +E+ V A+D   P
Sbjct:  727 YQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVN--SRFFSVRATDKDSGKNGEVKYEI-GEGNGGEKFG--IFPDG-QLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVN--------FELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQF-AKSVYQ---ASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQ---ITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICT-AAEIDREVTGGLFEVTVRATDKAIP 1267          

HSP 4 Score: 160.614 bits (405), Expect = 7.467e-40
Identity = 183/650 (28.15%), Postives = 284/650 (43.69%), Query Frame = 1
Query:  649 LDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQ---VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGK---EYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGG---------EVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETI------GSYIIIIKCNDFGFPS-LTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIP--EDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF 2514
            L + D+  F  N  +  + T V LDRE                   +  + Q Q+TA  D  ++       V I + D  D  P+F     +  V ENV  G  +     S  D     T  I V G   G    E+   R++           +DRE    ++L + A  GG     G   V++ + D+N++ P +   ++ VSI ED P+N     + A DKD G NG+V YE       E+     F +     G++ V+ +LD E  +  E  L V A D G E + S S  V +TV+D+NDN P       S   +F   E  +    V ++   D D G  G         +VN E+D++  ++ SL                DRE +       S+   +   D G P  L     + + V+D NDN P F  ++YQ  + E+      +  V A+D D   NG + Y+++  N     ++D++TG +T     DRE +  Y+  V A D+G S L++S  V + +LD ND+ P+F  +   S+   E +  G+ +  + A D D G +  + Y + A    + F ID  +G + L +  +D E    Y L V A DGG P     TI+ +++ D NDNPP F
Sbjct:  593 LTAGDAARFQVNAVTGAVSTRVSLDRE-------------------ERAVYQLQVTA-LDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLI-VSGDQRGSFSIEWSGGRIFT-------ANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEK-----FGIFPD--GQLYVRYELDRETRE--EYSLTVSAMDTGVEPLSS-SVTVNVTVLDVNDNKPLFN----SSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASL-------------RVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF-TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFL-ARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAF 1182          

HSP 5 Score: 159.073 bits (401), Expect = 2.433e-39
Identity = 206/763 (27.00%), Postives = 317/763 (41.55%), Query Frame = 1
Query:  634 VEFSLLDSMDSKY---FFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKEN-VKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN----FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRET------SDKYSFTVIARDNG-PSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEI----KVHIRAVDHGSPQLSSQTYLIVKV 2856
            V ++    M ++Y   F  +  + ++ TL  LDRE L   P V    D  SP           TAK          V + + D+NDN P F   Q    + EN      +     +D D     T   ++      +   NA       ++     LDRE    ++L +TA+DGG        IV I + D  D  P +  +++S  + E+V    L+  + A   D+  N  V Y    +  ++    R  F +    G I     +D E  +    +L V+A   G     S+S +V     D+N++ P     S        I E+     +  S+   D D+GK GEV  EI   N    F +   D  L   Y L      DRET   Y + +   D G   L+S+  +N+ V D NDN P+F+S+ Y F   E   +G  +G V ATD D   NG V YS     +    +DS TG + + + FDRE       +  +SF+V+A D G P  L   + V + + DVND+ P+F    Y  S+ E ++    + +V A D+D G N  + Y +       +F +D  +G+I L   ++DRE+ + Y L V A+D G         V + + D NDNPP F   +     V+   +     L+  + A+D D   + D R   +                      F ID   G +FL  +       +E     ++++ A D G P  SS T L+V V
Sbjct:  481 VRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSP-------PLGSTAK----------VTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRV----SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLI--VSGDQ----RGSFSIEWSGGRIFTANAIDRE--EQAFYQLRVVANSGGVAGEASVSVLVH----DVNNHAPVFDRASYE----VSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-DGQLYVRYEL------DRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDASTGQITLL-GSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF---TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIV---------------AGNTHATFAIDRSTGSVFLARRL-----DFETQRLYRLNVSAEDGGRPPRSSATILVVHV 1172          

HSP 6 Score: 153.295 bits (386), Expect = 1.341e-37
Identity = 190/716 (26.54%), Postives = 317/716 (44.27%), Query Frame = 1
Query:  796 ILQFQMTAKADNNNVEIIQ-----VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIE-VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI---DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQL---------FLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            I  + +T  A +N   + +     +++ + DVND++P F  S     + E    G  ++     DADS L +      V G+ +G  +F+  + +    +     +DRE+  +  L I+A D G+ P T    + + + D+ND  P +    +  +  E+      ++ + A D D+G NG V Y F+    +  ++ R  F L+SL+G++   + LD E L+  E  L V A+D G   + S + V  + V D+NDN P    +         I EN      V +++  DPD G  G V  ++   D   FQ+    N +T   +++T  S+DRE    Y + +   D G     S  ++ I V D  D  P F    Y F + EN   G  +G V+A+  D+  N +V Y + S +     SI+ + G +  +   DRE    Y   V+A   G   ++  + V + + DVN+H P F+   Y  SI ED         V A D D G+N ++ Y +       +FGI P  G++ +R   +DRE    Y L V A D G         VN+ + DVNDN P+F   +S +   +    Q    L+  ++A D+D    ++  +TY        ++  PQ         F++DS  G++          LI +    S+S+ +     A D G P+       +   + D++D
Sbjct:  303 IPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFS--VDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFD---PDMPAQYREMFRLDSLTGKVTTLKSLDREELE--EYPLVVQAQDRGSPPLGSTAKVT-VVVGDLNDNHPVFYPVQY----FASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQV----NAVTG--AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDL--NANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP-DGQLYVRY-ELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF---NSSSYVFHFCEEQEVGSLVGAVQATDAD--AGSNGGVTY--------SFEKPQVN-------FELDSETGRIASLRVFDREALIRQGGAASFSFSVV----ATDGGRPKPLQDRATVQVFVQDVND 967          

HSP 7 Score: 146.747 bits (369), Expect = 1.335e-35
Identity = 158/555 (28.47%), Postives = 252/555 (45.41%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDT-IYVKENVKLGEIQRFQVS-DADSK-------LFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISL-SKDKLFKIKENVQNVQQVASISVNDPDTGKG-GEVNCEIDNKNFQL-LSLDNPLTKGYS-LTTHNSIDRETIGSYIIIIKCNDFGFP-SLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH----LQARFSQ-FGIDPISGKI-ILRSANIDREKISRYELKVIASDGGHP 2448
            +V + + DVNDN+PSF       +  KE+  +G       + D D          +   S   +G  V       R +   + L     LDRE   ++ L + A DGGS    G L VN+ + D NDN P +    +  S+ ED P+   +  LL   +     G +   F+                   +G +  +Q LD+E  +  +  L + A D G   +   +T V I ++D+NDN P I+ + L    +   + E+       A ++V D D+    GE++  I   N +    L  P   G   L   + +DRE I  Y + I  +D G P + ++T  L + V D ND+ P F  + Y   + E    G Y+  V A D D   N  + YS+ S N     S+D +TG +T   + DRE +      + A+D G    ++ + + +T+LDVND  P F + +Y  +  E+S PG  V  V A D D+GEN  + Y+    + A++ + F +D ++GK+  L+S  +DRE++  Y L V A D G P
Sbjct:    8 EVRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAF---LHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGR-----GPLAVPFD-----------------PKTGMVSTRQPLDFEARR--QYTLSLRAADGGNPPLSGRATAV-IQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKS--LDREELEEYPLVVQAQDRGSP 532          

HSP 8 Score: 143.665 bits (361), Expect = 1.254e-34
Identity = 165/627 (26.32%), Postives = 265/627 (42.26%), Query Frame = 1
Query:  622 KSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKA-DNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKL-GEIQRFQVS-----DADSKLFSTKSIEVDGSHVGKEYFNA-RLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVI--DINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNS-------IDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDS-NPGKTVGQVEAIDLDIGENAKITY--HLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
            ++ +V +S+L   +   F  +  S  ++   +LDRE                         + +T +A D  +    ++ + + D NDNSP F     +  V E+    G+  R  +      DADS  F   +  +  S        A  L+     L + + LDRE    + L   A DGG    T  L VN+   + N   P    ++ +  + ED P    ++++ A D D G N ++  EF     + E R   F + N   G++ V + LD E  +     L V   D        +S+ V +++I  D+NDN P   A +  +  L      V  V  VA++   DPD+G+   V   +     +           ++L T          +DRE   SY + +   D G P LTST  L + V D NDN P F    Y+  I E+   G  +  ++A D D   NG + Y ++S +      +D   G+L  ++  DRE +  Y   V ARD G    S ++ V +T+ DVND +P F+L  Y     E++  P   + QV A D D+G + ++TY          F + P     +LRS  +DRE   ++ L + A+D
Sbjct: 1547 QNALVTYSVLSGSEGA-FVVDAASGVLRASRRLDREERA---------------------SYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDN--APSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAEL--EFSISSGDPEGR---FAVGND--GQLSVARALDRE--RQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAP---AFTSPRSALAPEDSPVGAV--VATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRS--LDREAQPQHVLIITATD 2133          

HSP 9 Score: 110.538 bits (275), Expect = 1.606e-24
Identity = 76/224 (33.93%), Postives = 115/224 (51.34%), Query Frame = 1
Query: 1807 CNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNP-GKT----VGQVEAIDLDIGENAKITYHLQARF------SQFGIDPISGKIILRSANIDREKISRYELKVIASDGG 2442
               F  P ++S   + I VED NDN P+F     +  + EN   G+ I  ++ATD D  +N  V YS+ S +E    +D+ +G L AS+  DRE    Y  TV A D   +H + + L  + + D ND++P+F    Y F + ED+ P GKT    +G V A D D G   ++TY L            FG+ P++G + + +  +DRE  + Y L+  A+DGG
Sbjct: 1488 AGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDG--THATDARL-SVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNV-TRPLDRESRACYVLRARATDGG 1707          

HSP 10 Score: 97.0561 bits (240), Expect = 2.026e-20
Identity = 88/348 (25.29%), Postives = 145/348 (41.67%), Query Frame = 1
Query: 1510 TVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLD--------NPLTKG--YSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF------FSIPEDSNPGKTVGQVEAIDLD------------IGENAKITYHLQARFSQFGIDPISGKIILRSAN-IDREKISRYELKVIASDGGHPSFQGET 2466
            T V + V D+NDN P+     + +      KE+    +QV   +  D D G  G     +++  ++++S +         P+TK     L T   +DRE   SY + ++  D G P       +N+ V+D NDN P F    Y+  + E++ +G  +       +D+   G             V  D  TG ++  +  D E   +Y+ ++ A D G   LS  +   + +LDVND+ P     Y        S+ E + PG     V   D D            +G N +  + L A         + G  +L+ A+ +DRE+I  Y L ++ASD G P  +  T
Sbjct:    7 TEVRVVVGDVNDNAPSFPEPGVME---VAFKEDAAVGRQVLLDTAVDRDVGPNG-----VNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL-------RDLLHRGR--------GPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHA-------PGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSAT 324          

HSP 11 Score: 96.2857 bits (238), Expect = 3.364e-20
Identity = 155/643 (24.11%), Postives = 272/643 (42.30%), Query Frame = 1
Query:  631 VVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPK-SPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQ-RFQVSDADSKLFSTKSIEVDGSHV-GKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNF-----FLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVI--DINDNPPN-IQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLL-SLDNPLTKGYSLTTHNSIDRETI-GSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQF----RIPENNVLGQYIGHVNAT-----DKDIEENGHVIYSLSSNAEAIVSIDSNTG---SLTASKEFDRETSDKYSFTVIA------RDNGPSH-----LSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYH-LQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
             + +++ +  +   F  +  + +I  L  LDRE       V +  D   SP    C +               +QVL    D NDN P F  S  ++   E+ ++GE+      SD D+      S +V  + V G  +    + +    ++L + LD E    ++L ++A DGG  P +   I+ +++ D NDN P ++  +   SI E++PI   +I + A D D   NG+++Y             R F     F ++  SGEI    ++D E +      + V A D    +    S +  +TV+  D NDN P  +   ++  D L     +V     V ++  +DPD  +   V   +   +  +L  LD    +   + T   +DRE+  G++ + +   +    +  + R  N ++     N   F+  L +F      P N + GQ I   ++        D E  G +++        ++ +    G    L A      + + +  F V +      RDNG        +SS + V +++ DVND+ P F + +    + E++  G+ +  + A D D G+NA +TY  L      F +D  SG ++  S  +DRE+ + Y L V ASDG H
Sbjct: 1006 ALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVA--------------VQVL----DENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTG----PSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIA----------RQFPPGAHFTIDPESGEICTAAEIDRE-VTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSV-----VGTLQASDPDEAENAAVRYAVTGGDAAILFRLDR---RTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIA----NSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFT-----LLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASG-VLRASRRLDREERASYLLTVRASDGTH 1597          

HSP 12 Score: 64.6994 bits (156), Expect = 1.347e-10
Identity = 73/267 (27.34%), Postives = 112/267 (41.95%), Query Frame = 1
Query: 1849 LNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENG---HVIYSLSSNAEA-IVSIDSNTGS----LTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQF----PSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            + ++V D NDN P F    + +    E+  +G+ +    A D+D+  NG   H    +S N E  +V     T      L  +   DRE +  Y+  V A D G         V +T+ D ND+ P FE   Y  S+ EDS               +G   +   H          DP +G +  R   +D E   +Y L + A+DGG+P   G     I + DVNDN P  +F    P++++  V+ S    P  + A +   D+D
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDS--------------PVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQP-LDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESA--APGTVAALVTVTDAD 258          
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006212.1 (pep scaffold:Pmarinus_7.0:GL476841:227071:229326:-1 gene:ENSPMAG00000005617.1 transcript:ENSPMAT00000006212.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 169.474 bits (428), Expect = 1.770e-44
Identity = 137/421 (32.54%), Postives = 208/421 (49.41%), Query Frame = 1
Query: 1243 IKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA--ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-----------DNKNFQLLSLDNPL--------TKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETS-DKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
            I E+ P+   ++++ A D D G NGKV Y   +  +   S       L+S SG + V   LD E  ++   RL ++A D       S +  + I V D ND PP I+   I+ ++       +   +   +A ISV+D D+G GG V+  I           D ++    + D P            Y L T   +DRE    +++ +   D G P L+ST V+ + V D NDN P F   +Y+  + EN   G  +  V ATD D+ +NG V+YS+   + +   I+  TG +TAS+  DRE +   Y+  V+A D G   LS+++ V + ILD ND+ P+FEL  F F + E+   G  +G+V A D D G+N K+ Y +    + F IDP +G +I    + DREK   Y L+V A D
Sbjct:    2 IPENSPVGTPVVRVQASDPDEGENGKVQYRLASWSSSSSS----SQPLDSSSGLVVVWGLLDRE--EADVHRLVIVATDCAPSRPASATATLTIVVGDENDTPPEIELRIIARTEGDAVTADDTDDDGFPIALISVSDRDSGSGGVVSLSISLDGDEESAGKDEEDEAGAAADLPFRVRRLPPSPDRYLLETGVGLDRERRERHVVRVVAKDSGVPRLSSTAVVFVRVADANDNPPTFPRRVYEAAVAENGPPGLRVASVMATDADVGKNGAVVYSIERPSSSAFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRILDRNDNAPQFELPDFHFYVRENQPAGNIIGRVSAWDPDEGDNGKLEYAITVVNALFSIDPDTG-VIRAGFSFDREKQHFYTLEVRARD 415          

HSP 2 Score: 125.946 bits (315), Expect = 3.689e-30
Identity = 87/251 (34.66%), Postives = 132/251 (52.59%), Query Frame = 1
Query: 1471 AKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK--IKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRE-TIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARD---NGPSHLSSSSLVYLTILDVNDHTPKF 2205
            AKD+G   + S + VVF+ V D NDNPP          ++++  + EN     +VAS+   D D GK G V   I+  +     ++  LT G  +T   S+DRE   G Y + +  +D G P L++T  + + + D NDN P F    + F + EN   G  IG V+A D D  +NG + Y+++    A+ SID +TG + A   FDRE    Y+  V ARD      S LSSS+ V++ ++D +D+ P+F
Sbjct:  205 AKDSGVPRLSS-TAVVFVRVADANDNPPTF------PRRVYEAAVAENGPPGLRVASVMATDADVGKNGAVVYSIERPSSSAFRIE--LTTGL-VTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRILDRNDNAPQFELPDFHFYVRENQPAGNIIGRVSAWDPDEGDNGKLEYAITV-VNALFSIDPDTGVIRAGFSFDREKQHFYTLEVRARDLDQTPTSRLSSSARVFIHVVDEDDNAPEF 444          

HSP 3 Score: 53.9138 bits (128), Expect = 2.048e-7
Identity = 66/246 (26.83%), Postives = 111/246 (45.12%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHV-GKEYFNARLYQDQVKLYLI---KHLDRE-LVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYE--YLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA 1566
            V + + D NDN P+F        V EN   G  +     +DAD        +  +G+ V   E  ++  ++ ++   L+   + LDRE     + L + A D G  P + T  V + I D NDN P++   +F   ++E+ P  ++I ++ A D D G+NGK+ Y          + +   F ++  +G IR     D E  +  + E+R   + +     +  S S  VFI V+D +DN P   A
Sbjct:  219 VFVRVADANDNPPTFPRRVYEAAVAENGPPGLRVASVMATDAD--------VGKNGAVVYSIERPSSSAFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRILDRNDNAPQFELPDFHFYVRENQPAGNIIGRVSAWDPDEGDNGKLEYAI--------TVVNALFSIDPDTGVIRAGFSFDREKQHFYTLEVRARDLDQTPTSRL--SSSARVFIHVVDEDDNAPEFLA 446          

HSP 4 Score: 50.447 bits (119), Expect = 2.194e-6
Identity = 86/349 (24.64%), Postives = 142/349 (40.69%), Query Frame = 1
Query: 1918 IPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNT---GSLTASKEFDRETSDKYSFTVIARDNGPSH-LSSSSLVYLTILDVNDHTPKFELQYF-----------------FSIP------EDSNPGKTV-------GQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSA-NIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            IPEN+ +G  +  V A+D D  ENG V Y L+S + +  S        G +      DRE +D +   ++A D  PS   S+++ + + + D ND  P+ EL+                   F I        DS  G  V       G  E+   D  + A     L  R  +  + P   + +L +   +DRE+  R+ ++V+A D G P      +V + + D NDNPP F     +  E  V+ N  P   +A + A D+D+ +  +  + Y      S+  P          + F I+   G +                + + A D G P LS+   +IV+++
Sbjct:    2 IPENSPVGTPVVRVQASDPDEGENGKVQYRLASWSSSSSSSQPLDSSSGLVVVWGLLDREEADVHRLVIVATDCAPSRPASATATLTIVVGDENDTPPEIELRIIARTEGDAVTADDTDDDGFPIALISVSDRDSGSGGVVSLSISLDGDEESAGKDEEDEAGAAADLPFRVRR--LPPSPDRYLLETGVGLDRERRERHVVRVVAKDSGVPRLSSTAVVFVRVADANDNPPTFP---RRVYEAAVAENGPPGLRVASVMATDADVGK--NGAVVY------SIERPS--------SSAFRIELTTGLVTASQSLDREDAPGGYALAVVASDRGVPPLSATATVIVRIL 329          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 226.483 bits (576), Expect = 7.131e-60
Identity = 217/688 (31.54%), Postives = 336/688 (48.84%), Query Frame = 1
Query:  847 IQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV--KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPL-----TKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI-SDISD 2874
            + + I + DVNDN P F  +     + E+  +G+ +   + SDADS      + EV    +  +  N+     +V   + ++K LDRE V  + L + A D G+ P + T+ V I + D+ND  P++  + +S +I+EDVP+N L+  + A D D G+NG+V++E  +  +       NFF +N ++GE+RV+QKLDYE +      L V A+D G+  +++  T V I +ID+NDN P      +S      I EN    Q+   +   D D G  GE+        F  +  D P      T G S+     +DRE +  +   IK  D G P    T  + I + D NDN P F    Y   I EN+  G  +  V A D D     +V+YS+  SS  +    I+   G +T S   +  T   Y F+V A D     LSS++LVY+ + D N H P+F+ + Y   + ED++ G +V  V A D D G NAKI+Y +     +F +D  +G +I  + ++DREK+  Y  +V A+D G P  + ++ V I+I DVNDN PVF  PS    E  V  +  P   + ++ A+D+D+ +        I+  F S             Q  F IDS  G +  +      +   E ++ + A D G+P    Q  + VKVI  D+ D
Sbjct:  112 MDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSG----SNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND------MNFFSINRINGEVRVKQKLDYEMIGV--FNLLVTAQDKGQPFLYN-QTTVDIALIDVNDNAPQF----VSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEI-------TFSFMQNDLPFSINENTGGISI--KEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTG-VIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSY---EAKVREDIRPGGRVIEVSASDADIGKNAQ-----IIYSFASNGDG---------QGTFTIDSTQGIIRTLKPLDRETIP-EYELTVVATDQGTP--PGQASVKVKVILEDVKD 747          

HSP 2 Score: 198.749 bits (504), Expect = 2.451e-51
Identity = 215/754 (28.51%), Postives = 349/754 (46.29%), Query Frame = 1
Query:  634 VEFSLLDS-MDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIE-VDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARF---SQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            V++ +L+S  D+  F   + S  +  + KLDRE              K PT     LQ Q   + +      + V I L DVND +P F     +  ++E+V + + +   + +D D         E V G+ +   +F+      +V++   + LD E++  F L++TA D G         V+I + D+NDN P++++ +F   I E+  +     ++ A DKD G NG++ + F  ++N+        F +N  +G I ++++LD E  + P+    + A+D G       + +  IT++DINDNPP        ++    I EN +    V  +   DPD+G    V   + +         NP  +G  +T   +++  T   Y+  +  +D     L+ST ++ + V D N + P F    Y   + E+  LG  +  V ATD+D   N  + YS+++      S+D  TG +  +   DRE  D Y F V A D+G   L + S VY+ I DVND+ P F +  Y   + ED  PG  V +V A D DIG+NA+I Y   +       F ID   G II     +DRE I  YEL V+A+D G P  Q    V + +EDV D+PP+F+ P     EV V  +  P   +  ++A   DLS  T        + +  V    PQ        +FDI+ + G +  + K    + S E ++ +RA    SP  +  T ++   + DI+D
Sbjct:  163 VKYCILNSDGDNSAFSIGEVSGAVTVMKKLDRE--------------KVPTY---TLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM--NFFSINRINGEVRVK--QKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF--MQNDLP------FSINENTGGISIKEELDRE--KVPKFTFGIKARDKGVPFKEGTAQIT-ITLLDINDNPPKFS----QEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINP--QGL-ITLSCTLNYNTKHVYVFSVSASD---GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEF-SVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQG-IIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLY---EVTVPEDTPPRSPVITVKAKSQDLSPETG-------MMYSIVRGNSPQ--------VFDINPNTGAIQTLMKLDYETQS-EYRLTVRATL--SPFFTETTVMV--YLKDIND 849          

HSP 3 Score: 181.415 bits (459), Expect = 6.763e-46
Identity = 168/532 (31.58%), Postives = 255/532 (47.93%), Query Frame = 1
Query:  880 DNSPSFLNSQDTIYVKENVKLGEI-QRFQVSDADSKLFSTKSIEVDGSH--VGKEYFNARLYQDQVKLYLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI---DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ---FGIDPISGKIILRSANIDREKISRYELKVIASDG 2439
            +N P F   Q+   V E+ ++G +      SD DS         +  S   +   YF+     DQ+   +   + LDRE +D     + A DGG     G + + IN+ D+NDN P +    ++  I ED  I   ++ + A D D G+NG+V Y   N   +  +     F +  +SG + V +KLD E  + P   L V A+D G     S +  V IT++D+ND  P       S      I+E+V   Q V ++   D D G  GEV  EI   ++ NF  ++  N       +     +D E IG + +++   D G P L +   ++I + D NDN P F S+ +Q  IPEN  +GQ    V A DKD   NG + +S   N +   SI+ NTG ++  +E DRE   K++F + ARD G      ++ + +T+LD+ND+ PKF + +Y  SI E+S  G +V QV+AID D G    + Y + +       F I+P  G I L S  ++      Y   V ASDG
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSI----DQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSA-----FSIGEVSGAVTVMKKLDRE--KVPTYTLQVQAQDQGNP-PRSATVTVKITLLDVNDCTPQFSKKVYSA----TIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRING-----EVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQN-DLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRINP-QGLITL-SCTLNYNTKHVYVFSVSASDG 521          

HSP 4 Score: 155.606 bits (392), Expect = 4.641e-38
Identity = 195/704 (27.70%), Postives = 319/704 (45.31%), Query Frame = 1
Query:  520 KLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN--AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLS 2613
            K ++  TI+E++P    V Q+ + V  +   +    +V  F ++   D  +F  N+ + E++   KLD E + +   +    D   P      L  Q T            V I L DVNDN+P F++S     + EN  +G E  R Q  D D       + E+  S +  +     + ++   + + + LDRE V  F   I A D G     GT  + I + DINDN PK+  E +  SI E+      ++++ A D D G    VY    +  ++   R+       +  G I +   L+Y    +  + +  ++  +G   + S + +V++ V D N + P  +  S S +    +KE+      V ++   D DTG   +++  I     +  S+D   T G  + T  S+DRE + +Y   +   D G P L +   + I + D NDN P+F    Y+ ++ E+   G  +  V+A+D DI +N  +IYS +SN   +   +IDS  G +   K  DRET  +Y  TV+A D G     +S  V + + DV D  P FE   Y  ++PED+ P   V  V+A   D+     + Y +    S   F I+P +G  I     +D E  S Y L V A+      F  ET V + ++D+NDN PV +   + +  +NV   ++P     +I A D D+S
Sbjct:  236 KKVYSATIREDVP----VNQLVTTVRATDCDQGSNGEVF-FEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQP-----FLYNQTT------------VDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHG----TNGEITFSFMQND-LPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRI-------NPQGLITLSCTLNY---NTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAE----VKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEF-SVDE--TTGV-IKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGA-IQTLMKLDYETQSEYRLTVRAT---LSPFFTETTVMVYLKDINDNTPVLE---AFHMNINVQEGKVPPEARYKIPAYDPDVS 884          

HSP 5 Score: 135.576 bits (340), Expect = 7.606e-32
Identity = 101/321 (31.46%), Postives = 157/321 (48.91%), Query Frame = 1
Query: 1543 DNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGY--------SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL--SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGET 2466
            +NPP  Q   L +D    + E+ +    VA++S +DPD+G  G +        + +    N ++  Y         +TT   +DRE +  +   +K  D G PSL     L I V D NDN PIF   +Y   IPE+  +G ++  V A+D D   NG V Y +  S    +  SI   +G++T  K+ DRE    Y+  V A+D G    S++  V +T+LDVND TP+F  + Y  +I ED    + V  V A D D G N ++ + + +    + F I+ I+G++ ++   +D E I  + L V A D G P    +T
Sbjct:   15 NNPP--QFSRLQEDA--SVSEDAEVGTVVATVSASDPDSGSNGMIR-------YSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQ-KLDYEMIGVFNLLVTAQDKGQPFLYNQT 323          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 218.779 bits (556), Expect = 1.405e-57
Identity = 216/705 (30.64%), Postives = 334/705 (47.38%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGE-VNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
            I+E  P+  + +  A+  +      +  +  + +SL  S ++K F  N ++ EI+T+  LD E                 T D     + M   A +        LI ++DVNDN+P F  S     V E+V +G I R Q++  D  +     +          YF       Q  +      DRE   ++++ + A DGGS   +G   V I I D+NDN+P + +  ++ S+ EDV I   ++ + A DKD GNN  + Y F +          + F L++++G + V + LD+E   S  + L V   D G   +   S +  I V DINDNPP     +       ++KEN     QV   S  D D+   G  V   I   +  + ++D   + G  ++   S D E    Y + ++  D G P    T  + I +ED ND+ P+F  + Y  +IPE+ V+G  +  V ATD D    G + Y L S N +   +ID+N+GS+  S E DRET+  YS  V ARD G +  SSS+ V + + D+ND++P F+  Y F + E S+PG  +GQV A D D   N  + Y L      F I+  +G I L++  +D EK ++Y + V A DGG PS    T+V + ++DVNDNPP  QF  S      V  N      +  + A D+D     + +I+Y +L
Sbjct:   79 IRENTPAAQVAIVTATDRD------SGTNAAITYSLF-SGENK-FMMNSKTGEIRTVTPLDHE-----------------TKD----SYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVR-QLTAVDLDVGINARLSYSLVSGDTSYFTV---DSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS------GNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSV--TDRGSPPLTDTSHL-LINVNDINDNPPVFSPSAYQS----RVKENTPAGTQV---SATDRDSSTNGALVFGIIKGNDDGVFTIDG--STGI-ISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKT-QLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPP--QFAKSLYT-CTVGENLAAGVAVCYVTATDAD--SGANGKISYSIL 725          

HSP 2 Score: 211.075 bits (536), Expect = 3.208e-55
Identity = 203/706 (28.75%), Postives = 333/706 (47.17%), Query Frame = 1
Query:  772 KSPTPDLCILQFQMTAKADNNNV----EIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYS-YEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            K+P        +Q+T  A +          QV I + +VNDN PSF++      + E+V +   + +   +D+D    +   +E    + G  +   ++ Q    + + K LDRE   N+ LV+ A + GS   +      I + D+NDN P +   +++ S+ E++PI   + K+ A D+D G N KV YE       +       F +N  +G +  ++ LD E   S  +R  V A D+G+    +++ +  +T+ D+NDN P     S SK  L  + EN  N   +  +  +DPD G  G V   I + N      +D+   +   +T    +DRE + SY + I   D G P   ST  + I V DENDN PIF S    + I E   +G  +  V ATD+D   N  V YS+     +  +I++  G LT  KE +RET   Y+ T+ A D G   ++S   + + + DVND+ P F  Q Y  S+ E+S    +V  V A D D+G NA + Y + +   +  F I+  SG +I+ +  +D E+ S+Y L+V A+D     +  +T V I + ++ND  P F   + +N   +V  N   +  + ++ A+D D               F S++Y     + S   + F ID   G +   +       S Y I+V  R  D G+P LS+ T++ +K++
Sbjct:  952 KTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVE---GNAGSSF---KIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSK-------FEVNPATGLVTTKRPLDREDQASYSLR--VTAMDHGKPSQSAVAAIT-LTINDLNDNSPQF---SQSKYTL-TVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGR---ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSG-VIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAF---TQQNYTASVRENSPTSTSVVKVSASDRD--------------SFGSLSYSIVGGKDS---DKFSIDQRSGIISTADVLDRELVSLYAIQV--RVTDAGNPPLSNLTWVTIKIL 1608          

HSP 3 Score: 201.06 bits (510), Expect = 4.382e-52
Identity = 208/679 (30.63%), Postives = 313/679 (46.10%), Query Frame = 1
Query:  850 QVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ---FPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFP---TCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
             +LI + D+NDN P F  S     VKEN   G   +   +D DS   ST    V G   G +     +      + + K  D E    + L + A D G      T  V I I D+ND+ P +   N+S  I E   I   ++ + A D D G  G++ Y   +        ++  F +++ SG IRV  +LD E   +P   L V A+D G     S + V  I + DINDN P  Q        +F++ E+     Q+  ++  D D    G+V   + + N  + S++   T    +T    +D E    Y++ +   D G PS +S  V+ +MV+D NDN P F  +LY   + EN   G  + +V ATD D   NG + YS LS N     ++D  TG +T     DRET   YS T+ A D       +++ V ++I D ND+ P F     F+I EDS  G  VGQ+ A D DIG N  +TY + +  + + F +DP SG + +RS  +DRE I  Y L V ASD G P       +++++ DVNDN P F+   F      + +V      +  + Q++  D D  + ++  IT  L    S N              F IDS G   F+++K P     + +Y++ V  R  D GSP  S+   + + +I
Sbjct:  361 HLLINVNDINDNPPVFSPSAYQSRVKENTPAG--TQVSATDRDS---STNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLIS------GNVKGAFNIDANSGSIRVSSELDRE--TTPSYSLQVEARDGGSTSRSSSTRVT-IALQDINDNSPIFQG-----PYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSD-NTDVFSIN---TSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSGILSVRST-LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASV------HSTVLQVKVEDKD--EGSNGAITLSLSGEGSDN--------------FTIDSTG---FVLSKTPLDYETTAAYQLTVTAR--DGGSPSKSATAQVKITII 988          

HSP 4 Score: 194.897 bits (494), Expect = 3.474e-50
Identity = 212/718 (29.53%), Postives = 332/718 (46.24%), Query Frame = 1
Query:  802 QFQMTAKADNNNV----EIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ-ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLF---LINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHW 2925
            Q+ +T  A +        +  V + ++DVNDN P F  S  T  V EN+  G  +     +DADS      S  +     G E     + +   ++     LDRE + ++ L I A DG          VNI+I D NDNQP + T     +I ED P    + +L A D+D+G NG V Y    I   +     N F L+  SG + V+  LD E +  P   L V A D G     SI+  + ++V+D+NDN P  +    S     +I+E+      V  + V D D G  G +   +  +     ++D   + G+ L+    +D ET  +Y + +   D G PS ++T  + I + + NDN P F S      IPE+  +  ++  +NATD D       I  +  NA +   ID ++G ++ +K  DRET+  Y+  V A + G    S  +   + +LDVND+ P F    Y  S+ E+   G+TV +V A D D GENAK+TY L     S+F ++P +G +  +   +DRE  + Y L+V A D G PS      + + I D+NDN P  QF  SK   + V+ N      I ++ A+D D     + R+TY ++   S N          + N F IDS  G++    ++++    SY     + I A D G P   S  ++ + V       ++  +PI+   + S+ 
Sbjct:  650 QYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSI---LSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAI--ISGNQG----NSFQLDPRSGILSVRSTLDRETI--PSYTLVVKASDAGSPQ-QSITASIHVSVLDVNDNAPRFEKSLFSG----EIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTID---STGFVLS-KTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDI--VEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRP-LDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSP--QFSQSKYT-LTVTENTANGSNILRVLASDPD--AGANGRVTYSII---SGN----------HGNAFRIDSTTGRITVVGVVDREALASY----NLTISAKDSGVPPWVSTAFVAITVA-----DENDNSPIFASNETSYG 1316          

HSP 5 Score: 190.274 bits (482), Expect = 8.255e-49
Identity = 218/720 (30.28%), Postives = 335/720 (46.53%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSF-LNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIK----VHIRAVDHGSPQLSSQTYLIVKV-ISDISDKKHHTNPIWTPE-KKSHWTAIISLVVATAILISFL 2976
            V+I+++D NDN+P F LNS     ++EN    ++     +D DS   +  +  +     G+  F       +++   +  LD E  D++ + I+A DG       T +  I + D+NDN P +    +   + EDV +  ++ +L A D DVG N ++ Y          S   ++F ++S  G IR +   D E   S ++ L   A+D G     S    V I ++D+NDN P    +  S      + E+V     + +++ +D D G   ++     + N     +LD     G  +T   S+D E   SY + +   D G P LT T  L I V D NDN P+F  + YQ R+ EN   G     V+ATD+D   NG +++  +  N + + +ID +TG ++ +K  D E   +Y  TV ARD G      ++ V + I DVNDH+P F    Y   IPE +  G TV  V A DLD G   ++ Y L +      F ID  SG I + S+ +DRE    Y L+V A DGG  S    T V I ++D+NDN P+FQ P        VS +  P H I Q+ A D+D S   D R                   LS   ++F I++  G + L  +       YE K    V + A D G+P  SS T  +VKV + D++D     NP   P+  KS +T  +   +A  + + ++
Sbjct:   56 VVIDVKDENDNAPEFPLNSY-VFNIRENTPAAQVAIVTATDRDSGTNAAITYSL---FSGENKFMMNSKTGEIR--TVTPLDHETKDSYTMRISAFDGKHT----TFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL-------VSGDTSYFTVDS-QGVIRTKGAFDRETKASYQVALR--AQDGGSP-SRSGQATVEIEILDVNDNRP----VFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLD--AVTGV-VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRV-SSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYV----FRVSESSSPGHQIGQVAATDADDSSNGDVRYA-----------------LSDNTDVFSINTSTGLITLKTQL-----DYEKKTQYMVTVTAKDGGTPSRSSLT--VVKVMVDDVND-----NP---PQFAKSLYTCTVGENLAAGVAVCYV 707          

HSP 6 Score: 177.948 bits (450), Expect = 5.875e-45
Identity = 203/684 (29.68%), Postives = 323/684 (47.22%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV-VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI---DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYS-YEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            I + DVNDN+P F        + EN+ +G+ + +   +D D    +  + E+      K   N        K    + LDRE   ++ L +TA+D G    +    + + I D+NDN P++    +++++ E+      I+++LA D D G NG+V Y   +  +       N F ++S +G I V   +D E L S    L + AKD+G  +   +ST  V ITV D NDN P    I  S +  + I E V    +VA ++  D D G   +V   I   D   F + +++        LT    I+RET+ +Y + I+ +D G P +TS + L ++V D NDN P+F+S  Y   + EN+     +  V A D D+  N  + YS+ S N E    I+S +G +  +   D E   +Y   V A D   S  ++ + V + ++++ND TP F  Q Y  S+ E+S    +V +V A D D      ++Y +       +F ID  SG II  +  +DRE +S Y ++V  +D G+P     T V I I D NDN P F    S +   ++  N  P+    ++ A D+D  + T+ RITY L            SR     + F I +  G + L       + S Y++ +  R  DHG+P  +S   + V VI DI+D +
Sbjct: 1087 IRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTK----RPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHG------NAFRIDSTTGRITVVGVVDREALAS--YNLTISAKDSG--VPPWVSTAFVAITVADENDNSP----IFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNG------VLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSG-IISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFD---SSSYSSSILENSAPSSFSFKLAATDAD--EGTNARITYNL------------SR----NDAFMIGASSGVITLAQPLDRENKSTYDLAIQAR--DHGTPPQASSITIRVTVI-DINDHR 1716          

HSP 7 Score: 169.088 bits (427), Expect = 2.820e-42
Identity = 215/794 (27.08%), Postives = 365/794 (45.97%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVV-EFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAK--ADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFS--TKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI----DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLT--STRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVI 2859
            + +++ E LP G  V ++ +    +   +   +KV  E S+    D+  F  N  +  + T   LDRE                   D      ++TA      +   +  + + + D+NDNSP F  S+ T+ V EN   G  I R   SD D+      T SI + G+H G  +   R+     ++ ++  +DRE + ++ L I+A D G  P   T  V I + D NDN P + +   S  I E V I   +  + A D+D G+N +V+Y    +R +  +     F +N+++G + V+++++ E +  P   L + A D G  ++ S   +  + V D+NDNPP    +  S+  +  ++EN      V +++ +D D G    +   I    D K F++ S     T G  +TT   +D E    Y + +   D  + + T  + RV+N+     ND  P F    Y   + EN+     +  V+A+D+D    G + YS+    ++   SID  +G ++ +   DRE    Y+  V   D G   LS+ + V + ILD ND++PKF+   + S I E+S P     ++ A D D G NA+ITY+L +R   F I   SG I L +  +DRE  S Y+L + A D G P       + + + D+ND+ P+    S + +   V  NQ     + +I A+D+D     +  +T+ LL              + ++++F +D+  G +     +++     Y+  I V     D G+P LSS   +I+ VI
Sbjct: 1104 YAKSLHENLPIGQTVAKVTA----TDRDEGENAKVTYELSV---GDTSKFEVNPATGLVTTKRPLDRE-------------------DQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI-ISGNH-GNAF---RIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI--VRGDTSA-----FAINAMNGVLTVKKEINRETV--PTYTLTIRASDRGSPMMTSDKELTVV-VNDVNDNPP----VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINS-----TSGVIMTT-TPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINL-----NDITPAFTQQNYTASVRENSPTSTSVVKVSASDRD--SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNL-SRNDAFMIGASSGVITL-AQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGS---VRENQPKETHVMRILASDAD--TGLNAELTFSLLS-------------NEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGV----ADKGNPSLSSVADVIIDVI 1815          

HSP 8 Score: 160.614 bits (405), Expect = 1.436e-39
Identity = 191/705 (27.09%), Postives = 327/705 (46.38%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNV----EIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDAD----SKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKT-VGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            +  T+ E   +GS +L++     ++S      +  V +S++       F  +  +  I  +  +DRE+L                       + +T  A ++ V        V I + D NDNSP F +++ +  + E V +G  +     +D D    +++F +  +  D S       N  L    VK    K ++RE V  + L I A D GS   T    + + + D+NDN P + ++++  S++E+   +  ++ + A+D DVG N  + Y    I   +E R    F +NS SG I     LD+E  +  +  L V A D+     ++  T V I VI++ND  P        ++    ++EN      V  +S +D D+  G      +  K+    S+D    +   ++T + +DRE +  Y I ++  D G P L++   + I + DENDN P F S+ Y   I EN+    +   + ATD D   N  + Y+LS N +A + I +++G +T ++  DRE    Y   + ARD+G    +SS  + +T++D+NDH P            ++ P +T V ++ A D D G NA++T+ L +    S F +D  +G I  +   +DRE+ + Y L++  +D G+PS      V I++ D +DN P FQ P+  N  V +S +      I Q+ A D D
Sbjct: 1208 YTLTVTENTANGSNILRV-----LASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALA---------------------SYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSI-VRGDTSAFAINAMNGVL---TVK----KEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSI--ISGNDEKR----FKINSTSGVIMTTTPLDFE--EKSQYGLEVTATDSK----YTAKTNVTIRVINLNDITPAFT----QQNYTASVRENSPTSTSVVKVSASDRDS-FGSLSYSIVGGKDSDKFSIDQ---RSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN-DAFM-IGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTK-VPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQ-PTEYN--VTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 136.732 bits (343), Expect = 2.952e-32
Identity = 154/541 (28.47%), Postives = 241/541 (44.55%), Query Frame = 1
Query: 1369 RNFFLLNSLSGEIRVQ-QKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPL---TKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS--QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILIS 2970
            +  F ++S +G I    +K D E       RL V+A+D      H   TVV I V D NDN P     S     +F I+EN     QVA ++  D D+G    +        + L S +N     +K   + T   +D ET  SY + I      F    +T V  I V+D NDN P F  ++Y+  + E+  +G  +  + A D D+  N  + YSL S   +  ++DS  G +     FDRET   Y   + A+D G    S  + V + ILDVND+ P F   QY  S+ ED   G  +  V A D D G NA + Y   +  +   F +D ++G ++  S ++D E+ S Y L +  +D G P     + + IN+ D+NDNPPVF  PS+  + V       P     Q+ A D D S  T+  + + ++                   +F ID   G +  I K P         + ++A D G P +   T  +   I D++D     +P+++P   S      +++ +T + ++
Sbjct:    9 QGMFTIDSSTGSITTTGRKFDRE--SESRYRLTVLAQDAANRC-HKGRTVVVIDVKDENDNAPEFPLNSY----VFNIRENTP-AAQVAIVTATDRDSGTNAAI-------TYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISA----FDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTG-VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS-PSAYQSRVK---ENTPAG--TQVSATDRDSS--TNGALVFGIIKGND-------------DGVFTIDGSTG-IISIAKSPDYENKTRYDLTVQARDRGVP-VKYDTAQVTIFIEDVNDH----SPVFSPSNYSKQIPESTVIGSTVVTVT 501          

HSP 10 Score: 122.094 bits (305), Expect = 7.606e-28
Identity = 129/415 (31.08%), Postives = 192/415 (46.27%), Query Frame = 1
Query: 1687 IDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL-QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF---QFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFP---TCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTP 2907
            +D  +  + ++D+  + G   TT    DRE+   Y + +   D          V+ I V+DENDN P F    Y F I EN    Q +  V ATD+D   N  + YSL S  E    ++S TG +      D ET D Y+  + A D    H +   L+  T+ DVND+ P F L  Y   + ED   G  V Q+ A+DLD+G NA+++Y L     S F +D  S  +I      DRE  + Y++ + A DGG PS  G+  V I I DVNDN PVF   Q+ +S + +V +         +  + A+D D     D R +     F S N  H           F +D+  G + +          SY+  + V     D GSP L+  ++L++ V +DI+D      P+++P
Sbjct:    4 MDGNDQGMFTIDS--STGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQ-VAIVTATDRDSGTNAAITYSLFS-GENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG--KHTTFVPLI--TVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVD--SQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGA------AMVTVTASDKDNGNNADLRYS-----FTSGNTNHA----------FTLDAVTGVVTVSRSLDFEQRSSYALGLSV----TDRGSPPLTDTSHLLINV-NDINDNP----PVFSP 378          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 218.394 bits (555), Expect = 2.667e-57
Identity = 185/575 (32.17%), Postives = 293/575 (50.96%), Query Frame = 1
Query:  787 DLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDT-IYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVG-------KEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN------FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-----IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPS 2451
            +L I++F    K+         VL+ ++D+NDNSPSF+      + V EN K    Q+    D+D    ST+S  +   +VG       K   +  LY D V       +DRE +D++ L I+A DGG+  N G L ++I + D NDN+P++   ++S +I E++ +   I+++ A DKD+G N ++ Y  E       S  +  F ++  +G I    +LDYE  +S    + V A+D G     S S +V I V+D+NDN P I  +S +    +++ EN     QVA +SV+D D+GK GEVN  ++  +      F +L+ ++ +  G SL      DRET   + +   C D G P  T+ +   I V D ND  P F    Y+ R+ EN  +   +  VNA D+D   N  ++Y++++  E+       +ID ++G +T + + DRE   +   TV+  D G   LS +  V + + D ND+ P F +  Y  S+ E+S  G  V Q+ A D DIGEN+ I Y +    + F +DP  G ++  S  +D E  S Y  +V A+DGG  S
Sbjct:   29 NLTIVEFSTPPKS-------YTVLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFR-QKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIET-----HSDPQAIFGIHPTTGVIVNNVRLDYEAKRS--YLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIH-VSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSL------DRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKG-LVTNSRTLDHEVQSSYTFQVAATDGGGRS 580          

HSP 2 Score: 187.578 bits (475), Expect = 8.876e-48
Identity = 205/697 (29.41%), Postives = 328/697 (47.06%), Query Frame = 1
Query:  805 FQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSID-RETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQ---MPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQ-LSSQTYLIVKVISDISD 2874
            FQ+ A           V + L D+NDN P F  S  ++   EN ++G+ I + +  D DS  F+     ++  +   E F+         + L K LDRE  DN+ L + A+DGG   +    IVNI + D+ND  P +    ++ +I+E      +I  + A  +D G N +V Y         +    N  L+NS +G + +Q ++D+E +  P + L V AKD G   +   + V  I VIDINDN P   + S+    L ++ E+        ++SV D D+G  G V+  + +    L +LD+  T   SLT    ID   +  SY + ++  D G P  +ST +L + V D ND  P+F +  Y   + E       I  V ATD D  ENG + Y+  S  +       N G +    + DRE  ++Y+  VIA D+G    SSS+ V + + DVND+ P F +  Y F + E+      +G V A D D G N  +TY    + +QF +D  +GKI   S  +DRE  + Y   ++A+DGG      +T V + + DVND  P F       N+ +V+ N+   + + L+  I  +D    Q  ++ ITY+++  P                 F ++   G L L++       ++   +H+ A D G  Q L + TY+ + V+ D++D
Sbjct:  569 FQVAATDGGGRSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGN-ADEVFSV---DGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSIS------KGNTDNIVLINS-TGTLYLQSEVDHEKI--PSLYLTVQAKDKGTPPLFGYANVT-IAVIDINDNSPQFNSSSI----LVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSN-TGALSLT--KLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITT-SQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFS-----KNKYSVTVNEDLPVGSSLLTLIATDDD--QQGPNSDITYMIVAGPKA---------------FSLNQVTGVLTLVSPLDR-EVTHRHILHVVASDKGGNQSLETITYIEINVL-DVND 1219          

HSP 3 Score: 168.703 bits (426), Expect = 5.577e-42
Identity = 183/604 (30.30%), Postives = 288/604 (47.68%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-----DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYS---LTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGE--NAKITYHL---QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF--QFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQAT 2622
            I ++D+NDN+P F+ S++  YV E+    E   FQV+     D D+         +     GK  F+  L    +KL  I  LD E V  + L I+A D GS P T   + N+ + D+NDN P++  + F  ++ E+ P    ++K+ A D+D G+N ++ Y   +    ++      F ++  SG I     LD E   +  + +H         +    ST V I V+D NDNPP      +S     K+ EN    + + +++V D D G   +V   I + N      D   T G S   L+T   +DRET  SY + ++  D   P  T+   + I +ED+NDN P+F  +LY   I E    G  I ++ A+DKD   NG+++Y+LS++   + SIDS TG + ++  F+     +Y+F  IA+D G     +   V + I D N+H P+F +  Y   I  +++    V  V A D D  +  N K+TY L   +   S F ++  +G  +  SA        R+ L +IA D G P  +G  IV I I ++ D+PP F  Q P+     V++  N      I  +RA  S  +Q T
Sbjct: 1426 IIIQDLNDNAPKFV-SRNLTYVMED----EPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK--FSLDLKTGVLKL--IGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK------FSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVS---STSVRINVMDRNDNPPKF----ISPVVTLKVPEN-SPARLIYTLTVQDLDYGNNTKVLYSIMSGN-----TDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGS-VRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPA----RVSIPENSKVGSYITTVRARASSDAQVT 1996          

HSP 4 Score: 156.377 bits (394), Expect = 2.674e-38
Identity = 228/833 (27.37%), Postives = 365/833 (43.82%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVL-IELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNA------RLYQDQVKLYLIKHLDRELVDNFKLVITAID-GGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNG---EEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS--QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ--FPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHG-SPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSH------WTAIISLVVAT 2955
            +  T+ E+LP GS +L + +  +        +    + + +     K F  N+ +  +  +  LDRE                      IL    + K  N ++E I  + I + DVNDN P F+N      V E + +G +         + + +  S + D   V  +  N       ++ +    +  ++ LD E+ + + L ++A D G     T   +V I + D NDN+P +        I E+VPIN  +  + A D D G N +++Y  ++         R  F +NS +G I+    +D E +   E  L V A D     ++ +++ +T+  I + D+NDN P      +S++  + +++   N  QV SI+  DPDTG+GG V   I + +    SLD  L  G  L    S+D E +  Y + I   D G P LTS ++ N++V D NDN P F   L+   + EN   G  +  V A D+D   N  + YS+ S  E    SID ++G +  +   DRE  D Y  TV A         SS+ V + ++D ND+ PKF        +PE+S P + +  +   DLD G N K+ Y + +  +   F I   +G+ +  +  +DRE  + Y+L V A D   P +     + I IED NDNPPVFQ    SS  +E+       P   I  + A+D D    ++  I Y L                +Y     IDS  G ++   +F T S   E      A D G  P+++     IV V   I DK +H         + H       +A++++V AT
Sbjct: 1124 YSVTVNEDLPVGSSLLTLIATDD------DQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDRE-----------------VTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVV--------AAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDS------QSPRAHFKINSETGLIQTTHPIDREEIS--EYSLKVRATDQAFTEQDRLYNTATLKII-IQDLNDNAPKF----VSRNLTYVMEDEPFNF-QVTSITALDPDTGQGGNVEYRIVSPDTGKFSLD--LKTGV-LKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENS-PARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGE-LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELT-----PPGTSILNLTASDKD--SGSNGNIVYTL----------SNDTYGVYS----IDSRTGIVYSAARFET-SIKQEYNFFCIAKDQGQDPKMA-----IVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTAT 1879          

HSP 5 Score: 151.369 bits (381), Expect = 9.114e-37
Identity = 175/605 (28.93%), Postives = 280/605 (46.28%), Query Frame = 1
Query: 1090 LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF-QLLSLDNPLTKGYSLTT-HNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR-FSQFGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHH 2886
            LDRE +    L +   D GS P +    V +N+TD NDN P +   +++ S+ E+ P    +++LLA+D D+G N  + Y                F L+   G +   + LD+E   S      V A D G     S +  V +++ D+NDN P     S S +      EN +  Q +  +   D D+ K       I+  N  ++ S+D     G  L T    +DRET  +Y++ +K  D G     +  ++NI V D ND  PIF    Y F I E++     IGHV+A  +D   N  V+YS+S  N + IV I+S TG+L    E D E       TV A+D G   L   + V + ++D+ND++P+F        +PED+  G T   V   D D G   ++++ L +   + F +D  +G + L    ID    +R Y L V A DGG P      ++ + + DVND  PVF    + +   +V     P+  I ++ A D D  +  + RI+Y              S++   +  F +  +GG++F+ +K        E  + + A+DHG+P+ SS   + V ++ D++D   H
Sbjct:  456 LDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTP--------FFLDPRKGLVTNSRTLDHEVQSS--YTFQVAATDGGG---RSCNATVHVSLTDLNDNQPVFDPSSYSVEYF----ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVD-----GSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKL-IDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF---GNWSYTAHVLETTPPDSNIIEVVATDVDSGE--NGRISYAF-----------DSKVDTSK--FGL-RNGGKIFIKSKLDREDIE-EYNLKVIAIDHGTPRRSSSADVKV-IVDDVNDNNPH 1015          

HSP 6 Score: 145.591 bits (366), Expect = 6.106e-35
Identity = 153/547 (27.97%), Postives = 251/547 (45.89%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV-----KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDV-GNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFI--TVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSL-TSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA-EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNG---PSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA-RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            V + ++DVNDN+P F  +    +VKEN  +   +     SD+D         E    HV    F+ ++ Q  V     K+   + LDRE   ++   I A DGGS+P      V + + D+ND  PK+    +SV++ ED+P+   ++ L+A D D  G N  + Y    +   +       F LN ++G + +   LD E        LHV+A D G     S+ T+ +I   V+D+NDN P    + +++     + E +     VA++   D D G  G+V  +I N N       N  T    ++T  ++D E    Y++ +   D G     TS +++ I VED NDN P F        I EN  +   +  + A D D   N  + Y++ S +  A   I+S TG +  +   DRE   +YS  V A D        L +++ + + I D+ND+ PKF  +    + ED      V  + A+D D G+   + Y + +    +F +D  +G + L   ++D E + +Y L + A+D G P
Sbjct: 1002 VKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSD---------EGSNGHVTYR-FDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMI--VAGPKA------FSLNQVTGVLTLVSPLDREVTH--RHILHVVASDKGGN--QSLETITYIEINVLDVNDNYP----VFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTG--VISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKL-IGSLDYEDVPQYTLHISATDLGSP 1519          

HSP 7 Score: 134.035 bits (336), Expect = 1.955e-31
Identity = 157/541 (29.02%), Postives = 254/541 (46.95%), Query Frame = 1
Query:  853 VLIELE--DVNDNSPSFLNSQDTIYVKENVKL-GEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKL-FKIKENVQNVQQVAS-ISVNDPDTGKGGEVNCEI--DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYII-IIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSS-SLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKT-VGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
             ++EL+  DVND SP F N   T +V E       I     +D DS      S   D S V    F  R   +  K+++   LDRE ++ + L + AID G+   + +  V + + D+NDN P +   +++  +KE+ P+   +  + A D D G+NG V Y F+    +        F+++  +G+I   Q LD E   S      ++A D G        T V + V D+ND  P       SK+K    + E++     + + I+ +D   G   ++   I    K F L    N +T    LT  + +DRE    +I+ ++  +  G  SL +   + I V D NDNYP+F +      +PE   +G  +  V A D D  +NG V Y + + N +    I+  TG ++  +  D E +++Y   V A D G     +S  LV + + D ND+ P F+     +   ++ P  T V  ++A D D G N++I Y +  Q+  + F I+  +G +I  +  IDRE+IS Y LKV A+D
Sbjct:  896 AMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFD-SKVDTSKFGLR---NGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ--------FIVDKQTGKITTSQVLDREAKAS--YVFSIVATDGGSSP-RVDKTQVTVIVRDVNDCSPK-----FSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL----NQVTG--VLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETG-LIQTTHPIDREEISEYSLKVRATD 1409          

HSP 8 Score: 131.724 bits (330), Expect = 1.062e-30
Identity = 191/706 (27.05%), Postives = 305/706 (43.20%), Query Frame = 1
Query:  844 IIQVLIELEDVNDNSPSFLN-SQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPI--NHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP--------NIQ-----------AISLSKDKLFKIKENVQNVQ----QVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYI-IIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA--IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNP-GKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFP---TCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            I+Q++I   ++ D+ P FLN +   + + EN K+G       + A S    T SI + G+  G+ ++    +   + +     LD E   NF+L + A   G     G +I++IN+ D NDN P +   N    + ED        ++K+ A D D G NGKV Y   +I    E+ +   F ++S +GEI   + LD E   S    L +   D+G     S +  V + V D+NDNPP        NI+            ++   DK  ++  N+++       +  +S  D D+G   ++       N   +        G  ++   +ID     S+I I ++  D G P   +   + I++  E    P F    Y  ++PEN ++G  +  V  TD      G  +  +S N E      I   +G ++ +K  D ET  ++   V A D+          VY+ + DVND  P F    + +   +  P G  V  V A D D G N ++ + +Q+   +  F ID  +G I  + A +D E I  + + V A+D G P    +  V I + D+NDNPPVF+ P    N+V V  N   N  + +I A D D     + R+++ ++                 Q LF ID   G L     F    T  Y Y +   I+A D G+P LSS   +IV V
Sbjct: 1947 IVQIVIG--NIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSI-ISGNK-GRAFY-VDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTY---SIWTGNEAGV---FTIDSTTGEITTAKLLDRETTAS--FDLVIRGTDSGIPP-KSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGV-ISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDN---AAGLPLGRISYNIENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRA-LDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGP--NDVQVLENLPLNSRLYEINATDRD--SGANARLSFTVIG-------------GTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLT--IKATDAGNPPLSSNITIIVNV 2610          

HSP 9 Score: 130.568 bits (327), Expect = 2.275e-30
Identity = 154/610 (25.25%), Postives = 262/610 (42.95%), Query Frame = 1
Query:  634 VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRE---SLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDV--GNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIR--LHVIAKDNGEEIIHSISTVVFITVIDINDNPP---NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHST--LYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEA-IVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELK 2421
            V +S++       F   + + E+ T  KLDRE   S  +  + K+   P              TA A+        + I +ED NDN P F  S  +  + E    G  I     SD DS         +     G    ++R       +Y     +  +   +     A D G +P    + V I I D N++ P++    + V I  +   + L+  + A D D     NGKV Y  ++ +N       + F++ S +G +R        +   P+ R  L++IA+D+G   +     +V I + +I D+PP   N     +S  +  K+   +  V+  AS            +V   I + N       +P T   S+ + +++D E+  ++ + +     G+ SL    +L+I V D NDN P FH +  L Q          +++  V ATD D   NG V YS+ +  EA + +IDS TG +T +K  DRET+  +   +   D+G    S++  V + + D+ND+ P F+     +I ED+  G  V  V A D D  + +++TY+L++  +        G  ILR +  D++  S  ++K
Sbjct: 1680 VLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPP------------YYTAFAN--------ITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTG----IVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNST-----SLFVVESNTGSVRTSAG----FSNPPQGRHALYIIAEDHGSPPLRGYG-IVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARAS---------SDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTD--KESRLTYNLKSASTP-------GIAILRVSATDQDSGSNAQIK 2237          

HSP 10 Score: 127.487 bits (319), Expect = 1.778e-29
Identity = 190/725 (26.21%), Postives = 305/725 (42.07%), Query Frame = 1
Query:  526 LFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKV-VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDAD-----SKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKG--GEVNCEIDN-KNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTG--SLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-IPEDSNPGKT--VGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYIL 2646
            LF  T+ E  P+G+ V      V+++++ +   S   + +S+   ++   F  +K S  I T   LDRE                   D   L    T  +    V    V I + D NDN P F++   T+ V EN     I    V D D       L+S  S   DG+          + +   +L     LDRE   +++L + A D      T    + I I D NDN P +    +S +I E  P    I+ L A DKD G+NG + Y   N            + ++S +G +    + +    Q  E     IAKD G++   +I   V I + D N++ P              I  N      V  ++  D DT K   G+V   +D+ KN   L +    T   S+ T         G + + I   D G P L    ++ I++ +  D+ P F + T  +  IPEN+ +G YI  V A       +  V YS +S N      +D  TG  S+ ++   D E++  +   ++A   G   L+   ++ + ++D ND++P F      + + ED+   K   V +V A D+D G N K+TY +        F ID  +G+I      +DRE  + ++L +  +D G P       V + + D+NDNPP+F  P S   EVN+  +     ++  + A D+D     ++R+TY L
Sbjct: 1545 LFIGTVSENKPTGTSV------VKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREK-----------------KDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFT--------IGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSN-------DTYGVYSIDSRTGIVYSAARFETSIKQ--EYNFFCIAKDQGQDPKMAI-VPVRIKIEDKNNHAPQFTKTPYE----VHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTG--SVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR---ASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKL-LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD-PLS---EVNIREDTRTGAVVTSVVATDTD----KESRLTYNL 2210          

HSP 11 Score: 127.487 bits (319), Expect = 2.106e-29
Identity = 142/468 (30.34%), Postives = 216/468 (46.15%), Query Frame = 1
Query: 1507 STVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN----FQLLSLDNPLTKGYSLTTHNS----IDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS--SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSH-LSSSSLVYLTILDVNDHTPKFELQYF----FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGI--DPISGK-IILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            S  V + V D+NDN P+    + +K  +F   EN ++ +Q   I+V D D G     +  I + N    F+L+S  +     Y+    N+    +DRE + SY++ I  +D G P+      L+I VED NDN P F +  Y   IPEN  +G  I  V+A+DKDI  N  + YS+   S+ +AI  I   TG +  +   D E    Y   V A D G SH LSSS++V + +LDVND+ P   + Y     + + E++  G  V +V   D D G+N ++   L+     F +  D ++ + II    ++DRE    + LK +  D G P    E    IN+ DVND  P F        E  V  N   N L+A + A D D    +++ + Y +      N    +S    Y + F ID   G +             ++ + +   D GSP LS    +IV +
Sbjct:   41 SYTVLVYVQDLNDNSPSFVRGTSAKLVVF---ENDKDFRQ-KLIAV-DSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFD---RHTYETRVWENATVNTLVAIVNAVDQDF--GSNSELVYTI-----ANTTESRS----YLHWFAIDPSSGMITTATDLDREQIP-QVVLTVLVHDRGSPPLSDNCSVIVNL 488          

HSP 12 Score: 115.161 bits (287), Expect = 1.244e-25
Identity = 95/342 (27.78%), Postives = 173/342 (50.58%), Query Frame = 1
Query: 1036 YFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRE--TIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTG 2055
            YF  R+ Q    + + K LD E    F LV++AID  +      + V IN++D+ND +P +    +     E +P+  +++ + A DKD G NG+V++  ++  +      +  F ++  +G IR Q+ LD+E +++  + +   A D G   +H+  +V  I V+D+NDNPP      +      ++ EN+    ++  I+  D D+G    ++  +     Q L L +  + G+ LTT+ + D E   +  Y + IK  D G P L+S   + + V DE++  P F+   Y+F +P N  +G ++G V ATD+D  + G V +   +     + +++ TG
Sbjct: 2349 YF--RIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD------KGSFAIDRKTGVIRTQRALDHETIKTHHVSVR--ATDEGSPPMHTDVSVT-IRVLDLNDNPP---VFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFS-GW-LTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTG 2674          

HSP 13 Score: 110.538 bits (275), Expect = 3.303e-24
Identity = 156/603 (25.87%), Postives = 260/603 (43.12%), Query Frame = 1
Query:  787 DLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIK----------HLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVS----IKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-----FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-----LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF 2514
            D  +L    +   +  N   +++ I +ED NDN P F N   +  + EN+ +G     QVS +D  + +   I+          ++   + D   ++ I            LD E   ++ +V+ A D GS+    +  +        ++    I  ++++     + E+  I   + ++   D D G NG+V    E        +   F +LN  S  I V Q LD E        L  +  D G+    +      I V D+ND  P     +       ++ EN      VA ++  D D G   E+   I N           ++D        +TT   +DRE I   ++ +  +D G P L+    + + + D NDN P F+ + Y   + EN+  G  +  + A D DI EN  ++YS L+ N      +D   G +T S+  D E    Y+F V A D G    S ++ V++++ D+ND+ P F+     ++YF    E++  G+++ Q++AID D  + A   + ++   +   F +D  SG I L    +DRE    Y L V A DGG      + IVNI + DVND PP+F
Sbjct:  136 DSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVG-TSILQVSASDKDIGTNAEIQ----------YSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMK---FDVLNDES-IIAVGQSLDRE--THDHFFLKAVCIDKGDP-PRTTEKSFRINVGDVNDCAPKFDRHTYET----RVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAID---PSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFF--LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGG--GRSCNATVHVSLTDLNDNQPVFDPSSYSVEYF----ENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDG-SGLITLAKL-LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIF 703          

HSP 14 Score: 103.605 bits (257), Expect = 4.143e-22
Identity = 141/625 (22.56%), Postives = 264/625 (42.24%), Query Frame = 1
Query:  859 IELEDVNDNSPSFLNSQDTIYVKENV---KLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHL----------------------------IIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKG-GEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF------ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILR-SANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD 2607
            I + D NDNSP+F  S     + E+    K   + +   +D DS      +  +     G E     +     ++   K LDRE   +F LVI   D G  P + T      +    ++ P        V+I+ED     +                            I+++ A D+D G+N ++ Y F  I N ++   +    +++ +G I  ++ +D   ++   I++ V A D G   +     +V++ +I   +  P  +  S       K+ EN      V ++ V D   G   G ++  I+N N+  +       +   ++ +  +D ET   +++++   D   PS      + I V D ND  P+F  + Y  +  E   +G  + +V+A DKD   NG V +++ S + +   +ID  TG +   +  D ET   +  +V A D G   + +   V + +LD+ND+ P F      ++Q   ++P +S     + ++ A D D G NA++++ +     Q  F ID  SG +    + + +   + +Y L + A+D G+P       + +N+ D ++  P F   +  + + +V  N      + Q+ A D D
Sbjct: 2055 INVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSI---WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKS-TNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFP-ITNSDQIDYK----IDADTGVISARRTIDVR-IRDSFIQIPVQAMDQG---VPPQRALVYVRIIITRE--PKFELPSY----FGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIG-----QRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSR----LYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRD 2648          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 196.052 bits (497), Expect = 1.501e-50
Identity = 199/685 (29.05%), Postives = 323/685 (47.15%), Query Frame = 1
Query:  667 KYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQ-VSDADSKLFSTKSIEV-DGSHVGKEYFNARLYQDQVKLYLI--KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISL---SKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-----------FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ----FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
            K F  N  +  I T  ++DRE+                       Q  +  +  N + + I V ++++D+NDN P F     T+ ++E++ +         +D D+    T    +  G +                L +I  K LDRE  D ++L ITA D G+    G  ++NI I D ND+ P +   ++  SI E+      I+++ A D+D G+NG + Y  +     +  +  + F L+S +G IR +Q LD+E   S     +VIA D G    + ++TV  I V+D NDN P ++   L   + DK  + + ++ N   +A I V D D+    +   +I N +           F  + L  PL            DRE +  Y + +   D G PS ++   + I V D NDN P F S  Y   I E    G Y+  +NATD D  +NG V YS++  N      +D  +G +T +K  DRE     + T+ A+D+G +  + S+ V +TI+D ND+ P+F +  Y  +I E ++ G TV QV A D+D G+N +ITY + +  +Q    F ++  +G ++   + +DRE  S Y   V+A D G P       V + I D+NDN PVF +P       ++  N+ P  L+ Q+ A D+D  + T+  I+Y ++
Sbjct:   40 KQFGFNSNTGVISTTARIDRETTT---------------------QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAID----WDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNS--YTFNVIASDGGVPSKNDLATVT-INVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINT-NIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPL------------DRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTG-VLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF-YPVEY--FASIMENEPPGKLL-QVTATDAD--EGTNAVISYDII 676          

HSP 2 Score: 184.882 bits (468), Expect = 3.976e-47
Identity = 167/544 (30.70%), Postives = 272/544 (50.00%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSH-VGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI----DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQV----EAIDLDIGENAKITYHLQARFSQ-FGIDPISGKIILRSANIDREKISRYELKVIASDGGHP 2448
            VLI++ DVNDNSP+F ++  T  + E  + G  + +   +D D     T S  + G + +G  +F        V     K LDRE V +  + ITA D GS P TG+  V + I D NDN+P+++  ++  +I E   I   ++++ A D D G+NG++ YE     +  ++++   F LN+ +G +  + +LD E          V+AKD+G+  + S S  V +T+ DINDN P    +    +    I EN +   ++  ++  D D G    ++ +I    +N NF + S     + G  ++T  S+D E    + +II   D G      T V+N+ V ++ DN P+F   +Y F + EN   G  +G V AT KD  +NG + Y++ S +   +  +DS  G +  + + DRE   +Y   VIAR      LS+ + V + +LD ND+ P+F      S+  D +    VGQV     A+DLD G+N  + Y L +       I+  SG I L     D ++ ++Y ++V+ASD G P
Sbjct:  411 VLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSGLVT--TAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEI----SSSDAQVNGLFELNTQTGVLWTKSQLDRE--TKSLYSFTVLAKDHGDPQLMS-SVKVELTISDINDNAPVFYPV----EYFASIMEN-EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDS-----STGV-ISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTS---SVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDE-TQYTVQVLASDSGSP 926          

HSP 3 Score: 164.466 bits (415), Expect = 8.424e-41
Identity = 179/584 (30.65%), Postives = 269/584 (46.06%), Query Frame = 1
Query:  760 CCDPKSP----TPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHV-GKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGG--SNPNTGTLXXXXXXXXXXXXQPKWIT----ENFSVSIK-EDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTV--VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-FQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN---AEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGH 2445
            C   K P    T D   L    T +     +    + I + D ND++P F  +     + EN K G  I R   +D DS         +D   +     F+  L      +   ++LD E+ +++   + A DGG  S  +  T+ +N+  T+ N  Q K IT     N   +I+ E+  IN  I  +L  DKD   N +   +  N   ++E   +  FL       I++Q+ LD E +    + L+V  K      + S ST+  V I V D+NDN P   + + + +    I E  QN   V  ++  DPD G  G V+  I   N      +D     G  +TT   +DRE + S  I I   D G    T +  + + + D NDN P F  + Y+  I E   +G  +  V+ATD D  +NG + Y +SS+      +  +++ TG L    + DRET   YSFTV+A+D+G   L SS  V LTI D+ND+ P F  ++YF SI E+  PGK + QV A D D G NA I+Y +        F ID  +G +I   A++D E    + L + A DGG+
Sbjct:  157 CVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFD--LDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLK-ITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITN--GDDEGCFKVEFLGFYF---IQLQKPLDRELVPFYNLTLNVTDKG-----VPSRSTLGFVLIDVTDVNDNSPAFTSNAYTAN----ISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVD--FQSGL-VTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTG-VISTLASLDHEVEEFFSLIISAKDGGN 718          

HSP 4 Score: 162.54 bits (410), Expect = 2.754e-40
Identity = 176/621 (28.34%), Postives = 286/621 (46.05%), Query Frame = 1
Query: 1069 KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYL-QSPEIRLHVIAKDN--GEEIIHSISTVVFITVIDINDNPP---------NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNF--QLLS---LDNPLTKGYSLTTH--NSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLS-SNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKI----SRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIV 2850
            KLY+ K L + L  ++ L++ A DGG    + ++ V I I D ND++  ++   F  ++ E+     L+  L+A   D      + Y    I +E        F ++  SG+I  + +LD E L ++    ++++  +    +  I     +V +TV D+NDN P          +  +SL    +F+IK               D D G         DN  F   L+S   +D       +   H   ++DRET  SY +++K  D    +L ST  + I V D ND  P+F  + Y   I E+ ++G  + ++NA+DKDI +NG + YS+S  N  A+  ++S TG L  +K  D ET+  Y  T+ A+D+G   LSS+  V + +LDVND+ P F  Q    ++ E+ N G  VG+  A D D G NA I + +  Q     F ++  + +I   +A ID E +      ++L V+A+D G P       + + + D NDN P F  P +       S N M       I A D D  + ++ ++TY              S +S     F++    GQL +I++ P     Y++   I+A D G P   +QT + V
Sbjct: 1001 KLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSL--ISSESH------FAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIK-------------AMDADEG---------DNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNSATCEITTIAA-IDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAA--AAGSSLNVM------TITAEDPD--RNSNGKVTY--------------SIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLT--IQASDGGQPSRQTQTVVSV 1564          

HSP 5 Score: 142.51 bits (358), Expect = 3.747e-34
Identity = 210/798 (26.32%), Postives = 343/798 (42.98%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVN--DNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKH-LDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKL-DYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRE------TSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHL--QARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINK--FPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            +  +I E  P G L+   A+  +  +      + V+ + ++   ++  F  +  +  I TL  LD E       V+                  ++AK   N       ++ +  +N  DN P FL       V ENV  G  + R   +  D      K+  +  + V  +  N  L      +  I   +DRE    + L + A  G   P +    VNI + D NDN P++ T +  V I     +  ++    A D D G NG V Y+         S       +NS SG I++ +KL D +  Q     + V+A D+G    HS  T+     I+   +PP     S     L     + Q    VA     D D+GK G++   I   N + L    P   G  L    S+ +   GSY +I++  D G PS +++  + I ++D ND+  +F +  ++F + EN+  G  +G + A   D      ++YSL S +E+  ++D  +G +T     DRE       S+ Y     A  N  +     ++V +T+ D+ND+ P F    Y  ++ E S PG  V +++A+D D G+NAK  Y L       +F I+  +G++ L S  +DRE  S Y L V A+D  + +      + I + D ND  PV  FP S +  VN++ + +   L+  + A+D D+ Q   N +         + Y      L+    +FD++S  G+L +     F T    YE+   I A DHG   LSS   + V V+ D++D
Sbjct:  642 YFASIMENEPPGKLLQVTATDADEGT------NAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHE-------VEE------------FFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKD------KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT-------SNAEGLLWINSTSGVIKLARKLTDGDETQ---YTVQVLASDSGSPPQHSTMTIHITLSIN---HPPKFTLSSYVTHVLASQPLSYQFFYVVAV----DQDSGKNGQLFYSIPQGNEEGLFGIFP---GGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLIS-SESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHL-SKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPV--FPES-DYTVNITEDALIGSLVINLNASDKDIGQ---NGL---------IKYSISNGNLAA---MFDVESATGRLIVAKSLDFETTQL-YELT--ITAQDHGLIPLSSTVNVTVNVL-DVND 1364          

HSP 6 Score: 129.798 bits (325), Expect = 3.012e-30
Identity = 175/651 (26.88%), Postives = 280/651 (43.01%), Query Frame = 1
Query:  529 FRQTIKEELPSGSLVLQIAS--PVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI---DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNP-GKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSF 2454
            +   I E   +GS VLQ+ +  P E         +  V +S+    D  +F  + QS  + T   LDRE +             S T  +         K  +  V +  +     D NDN P F+ S     + E   +G  + +   +D DS      + E+  S            Q  V L+    LDRE    +   + A D G      ++ V + I+DINDN P +    +  SI E+ P   L+ ++ A D D G N  + Y+     N         F ++S +G I     LD+E  +     L + AKD G +     + VV +TV++  DN P    + L +   F + ENV     V  +     D  K G ++  I   D  N  L+      + G  +  +  +DRE    Y++ +         L++   +NI V D NDN P F ++     I    ++GQ + +  A D D  +NG V Y L+SNAE ++ I+S +G +  +++       +Y+  V+A D+G     S+  +++T L +N H PKF L  + +    S P       V A+D D G+N ++ Y +     +  FGI P  GK+ +R + +   K S Y+L V A+DGG PSF
Sbjct:  430 YTANISELAQNGSYVLQLNATDPDE-------GDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVS------------SVTITITAQDHGSAPKTGSTTVTVTII-----DGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGV-LWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL-QVTATDADEGTNAVISYDIIGGNNNGN------FSIDSSTGVISTLASLDHEVEEF--FSLIISAKDGGNKYAAK-TAVVNVTVLNKADNLP----VFLYEMYNFTVYENVPKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVD-----STGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHIT-LSIN-HPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFP-GGKLYIRKSLLQALKGS-YDLIVRATDGGVPSF 1030          

HSP 7 Score: 123.25 bits (308), Expect = 3.573e-28
Identity = 192/812 (23.65%), Postives = 340/812 (41.87%), Query Frame = 1
Query:  526 LFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQ----VLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIK------HLDRELVDN----FKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVI--DINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN-----FQLLSLDNPLT---KGYSLTTHNSIDRETI----GSYIIIIKCNDFGFPSLTSTR---VLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV 2856
            ++  T+ E +P G+LV ++ +  +        K+  + ++++    +  F  +     IK    +DRE                        Q+ +   A    V+ +     V IE+ D NDN+P F  S   + +     +G++           +++  ++++D    G   +  +L  +   L  I        L R+L D     + + + A D GS P   T+ ++I ++  +   PK+   ++   +    P+++    ++A D+D G NG+++Y   +I    E  L   F    L     + Q L   Y       L V A D G   + S S  V +T+   D ND+    +++ ++    F + EN            + P T  G  V   +D+       + L+S ++      +   +TT   +DRE +    GS + I++     +   T  R   ++ + V D NDN P+F   +Y   + E ++ G  +  + A D D  +N    YSL S        I+S+TG L  SK  DRET+  Y+  V A D   ++L S++ + +T+ D ND  P F E  Y  +I ED+  G  V  + A D DIG+N  I Y +      + F ++  +G++I+ + ++D E    YEL + A D G         V +N+ DVNDN P+F         V ++  +  N      R   SD    T+  I +      S+    P    S+     +I +       +   P    S+++ V   A D GSP+LS++  + V+V
Sbjct:  745 MYNFTVYENVPKGTLVGRVYATTK-------DKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKA---------------------QYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQV-----------VYNAAAVDLDAGKNGLVRY--QLTSNAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITLSINH--PPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFY---SIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSY------DLIVRATDGG---VPSFSASVPVTIYIQDSNDH----RSLFVNNTFRFAVAEN------------SSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAM-YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIV-AKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLF-----PTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAF------SMYSQTPSKTFSVNSATCEITTIAA--IDLETMPAGRDSFQLVVM--ATDQGSPKLSTRKSITVQV 1468          

HSP 8 Score: 117.087 bits (292), Expect = 2.477e-26
Identity = 156/593 (26.31%), Postives = 248/593 (41.82%), Query Frame = 1
Query: 1207 QPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF-------HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTAS----------KEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQAR--FSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFL---INKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV---ISDISDKKHHTNPIWTP 2907
            +P++ T  +++ I+E + +N       A D D GNNG V Y   +  N     L         +  +  ++ LD E   +   +L++ A D G   +     ++ IT++D ND+ P    +      L  I EN +    +  +S  D D+G  G++   ID    Q  S+ +  +    + T  ++D E   SY   +  +D G PS      + I V D NDN P         H+     R  EN+++   I ++  TDKD   N        S  E  ++   + G               K  DRE    Y+ T+   D G    S+   V + + DVND++P F    Y  +I E +  G  V Q+ A D D G+N  ++Y +        F +D  SG ++  +  +DRE++S   + + A D G     G T V + I D NDN P F   S K     +S        + Q+ A D D     + RITY +            S  +    LF++++  G L+    +++     YS+ +     A DHG PQL S     VKV   ISDI+D      P++ P
Sbjct:   92 EPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRE--TTDFYQLNITATDRGTPALMGYC-LINITILDENDHAP----VFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIR-SENSLINTNIAYILVTDKDSNTN--------SQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSG-LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGT---ISEGASIGATVLQVSATDVD--SGDNGRITYEI-----------SSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTV----LAKDHGDPQLMSS----VKVELTISDINDNA----PVFYP 639          

HSP 9 Score: 112.849 bits (281), Expect = 5.744e-25
Identity = 137/521 (26.30%), Postives = 222/521 (42.61%), Query Frame = 1
Query: 1378 FLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASI-SVNDPDTGKGGEVNCEI----DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNA---EAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIP----------EDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKK 2880
            F  NS +G I    ++D E      ++L  +   N       IS  V + V DINDN P    +  +     +I+E++ +V     I +  DPD G  G V+  I    +   F L +   P      + T   +DRET   Y + I   D G P+L    ++NI + DEND+ P+F    Y   I EN   G  I  V+A D+D   NG + Y++  +A    +I  +DS+TG +   +  D E  + Y+F VIA D G    +  + V + +LD ND++P+ ++ Y   +P          E+S     +  +   D D   N++    +     +  F ++ +    I     +DRE +  Y L +  +D G PS      V I++ DVNDN P F   +S     N+S        + Q+ A D D  +  +  ++Y +     + +             F +D   G +           S  + + I A DHGS   +  T + V +I D +D K
Sbjct:   42 FGFNSNTGVISTTARIDRETTTQISLQLRTLNPSN-----QPIS--VQVQVDDINDNEPRFPTLYYT----LRIRESM-DVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITY---LPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAF---TSNAYTANISELAQNGSYVLQLNATDPD--EGDNGTVSYSITGGNDLGW-------------FQVDFQSGLVTTAKPLDREQVS-SVTITITAQDHGSAPKTGSTTVTVTII-DGNDNK 527          

HSP 10 Score: 103.219 bits (256), Expect = 4.356e-22
Identity = 133/522 (25.48%), Postives = 227/522 (43.49%), Query Frame = 1
Query:  640 FSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPE--IRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSN-AEAIVSIDSNTGSLTASKEFDRE-TSDKYSFTVIARD-NGPSHLSSSSLVYLTILDVN 2187
            +SL+       FF N  + E+     LDRE                 T     L  + T  ++ N     ++ I + D ND  P F  S  T+ + E+  +G  +     SD D          +   ++   +    +     +L + K LD E    ++L ITA D G  P + T+ V +N+ D+NDN P + T+  +++++E+V     + +  A D+D G N  + +   ++ ++  S+    F +NS + EI     +D E + +     +L V+A D G   + +  ++  + V D NDN P   +   +            +   V +I+  DPD    G+V   I + N    +L +P T G     H   D  TI  Y + I+ +D G PS  +  V+++  E      P F S  YQ  + EN V G  +  V A       NG++ Y L+S+ ++    +  +TG +  ++  DRE     ++  V A D  GPS  +SS+ V +T+ DVN
Sbjct: 1196 YSLVSGTGMDKFFINSSTGELHLSKTLDRE-----------------TTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMF---DVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAF---SMYSQTPSKT---FSVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSIT-VQVTDENDNSPGFVSPPAAA---------AGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNL-HPST-GQLQMIHQIPDNPTI--YQLTIQASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Match: EDO35413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLL0])

HSP 1 Score: 180.644 bits (457), Expect = 9.490e-46
Identity = 155/499 (31.06%), Postives = 241/499 (48.30%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEV-DGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI--------DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITY 2313
            V I ++DVNDN+P F + + T+ + ENV  G  +     +D D+   +  S     GSH  K   +A       ++Y     DRE  D++ + +TA D G+   + T +V + + D NDN PK+   ++   I ED  +   I  + A D D+G N ++ Y   +I + E++     F +N ++GEI V Q+LD E        + V A D G   + S S  + + V D ND+ P    + LS      I EN     ++ ++   D D+G    VN EI         N +F + S+         L T  ++DRET   + + +   D G P   S   + +++ D NDN P+F  + Y   + E  V+   I  V A D+DI  +G V Y ++   E  +  I+ NTG++  + + DRET  KY+  V A D G   LSS + V + +LD NDH P F        + ED+  G TV +V A+D D+G NA +TY
Sbjct:    1 VTITVQDVNDNAPVFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHGNKFAIDAS----SGRIYTTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTY---SIVSPEKAT----FSMNPVTGEITVGQRLDRE---GANYSIRVTATDLGTPPL-SASMEITVIVDDYNDHRP----VFLSHIGTVFIDENASPGTEIITLQAVDGDSG----VNAEIRYAFVTGNSNNSFTINSITG------RLRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSE-GVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTY 469          

HSP 2 Score: 176.022 bits (445), Expect = 2.105e-44
Identity = 159/472 (33.69%), Postives = 239/472 (50.64%), Query Frame = 1
Query: 1516 VFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN-CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF--ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS--QFGIDPISGKIILRSA-NIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFP--SSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTP 2907
            V ITV D+NDN P    +  S +    I ENV +   V +++  DPD G   +V+       +    ++D    + Y   T  + DRET   Y I +  +D G PS +ST V+ + V D NDN P F +  Y F I E+  +G  IG V+A+D DI EN  + YS+ S  +A  S++  TG +T  +  DRE ++ YS  V A D G   LS+S  + + + D NDH P F   +   F I E+++PG  +  ++A+D D G NA+I Y      S   F I+ I+G+  LR+A N+DRE   R+ L+V+A D G P     T V + + DVNDN PVF     +++ +E  V  N      I  + A D D+   +D  +TY +           Q R      LF I+ + G + +  K    + S +  + ++A D GSP LSS+  +IV V+    D+  H  P++TP
Sbjct:    1 VTITVQDVNDNAP----VFTSDEFTVSIAENVDDGTTVITVTATDPDAGDNAKVSYATYGGSHGNKFAIDASSGRIY---TTGTFDRETKDDYSINVTASDHGNPSKSSTCVVLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIGENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREGAN-YSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVF-IDENASPGTEIITLQAVDGDSGVNAEIRYAFVTGNSNNSFTINSITGR--LRTARNLDRETTPRFTLEVLAYDLGVPRKDSVTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESN------IVTVVAEDRDI--GSDGSVTYCIT----------QGREG---GLFVINENTGTIGITAKLDRETKS-KYTLRVQATDGGSPALSSEADVIVNVL----DQNDHA-PVFTP 434          

HSP 3 Score: 163.31 bits (412), Expect = 1.754e-40
Identity = 185/707 (26.17%), Postives = 316/707 (44.70%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQ------VASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLT-----ASKEFDR-ETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAID-LDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQ---FPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGS-PQLSSQTYLIVKVISDISDKKHHTNPIWTP 2907
            VL+ + D NDNSP F        + E+  +G  I     SDAD      ++  +  S V  E     +     ++ + + LDRE   N+ + +TA D G+ P + ++ + + + D ND++P +++   +V I E+      II L A D D G N ++ Y F            N F +NS++G +R  + LD E   +P   L V+A D G     S++ V  + + D+NDN P           +F + E    V +      + ++   D D G  G V   I       L + N  T    +T    +DRET   Y + ++  D G P+L+S   + + V D+ND+ P+F       ++ E+   G  +  V+A D D+  N  V YS              TG +T     A K F      + Y+ TV AR+  P H  + + + + +LD NDH P F +  Y     +D+  G ++G+VEA+D  D G NA + Y   +     +F + P +G++++ S+   R+ +++ Y ++V ASD G P       V + + + N +PPVF    + +S+N ++ V         +  + A D D  +  +  I+Y ++   S             Q  F I    G L+ ++K     +     +++ A D G  P+ S  T  I   + D++D     NP+++P
Sbjct:  106 VLVTVADNNDNSPKFPALHYVFDIAEDAAVGASIGTVSASDADIG----ENARLTYSIVSPEKATFSMNPVTGEITVGQRLDREGA-NYSIRVTATDLGTPPLSASMEITVIVDDYNDHRPVFLSHIGTVFIDENASPGTEIITLQAVDGDSGVNAEIRYAFVT------GNSNNSFTINSITGRLRTARNLDRE--TTPRFTLEVLAYDLGVPRKDSVTNVTVV-LRDVNDNQP-----------VFTMSEYAAEVSEGVVESNIVTVVAEDRDIGSDGSVTYCITQGREGGLFVINENTGTIGITAK--LDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYS--------------TGMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETGEVLIASSL--RDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVG------SALLTVTATDRDFGR--NGEISYDIIAGNS-------------QEYFGIGLTNGSLY-VSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRI--TLRDVNDN----NPVFSP 741          

HSP 4 Score: 128.642 bits (322), Expect = 8.586e-30
Identity = 152/581 (26.16%), Postives = 272/581 (46.82%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSD----ADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQ-NVQQVASISVNDPDT-----------GKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGF-PSLTS--TRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL-SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTIL----DVNDHTPKFELQYFFS--IPEDSNPGKTVGQVEAIDLDIGENAKITYHLQA--RFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPP 2508
            + IE+ D ND++P F+ S   ++  ++   G  I R +  D      + L   ++I  +G+         R+  +  ++ +   L  ++   + + + A D G    + T  V + +T+ N + P +    +  S  ED+ +   ++ + A D+D G NG++ Y+     ++E      +F +   +G + V + LDYE+ ++    L+V A D G+E   S +TV  IT+ D+NDN P    I    +   ++ EN       V S+   D D            G  G+    ID +  ++ +                 D E   S  ++I   D G  P  T+     ++I++   N+  P+F  +++   + EN  +G  +  V+ATDKD   +G V+Y L  S+ +    +DSNTG+L+ S + D E +   +  VIA++   + ++ SS+ + TI+    D ND  P+F L+  +S  + E S  G  V  V A+D D  +   I Y + A    + F +D ++G  +  +A +DRE I+ Y L V A+D G P   G   + + ++D+NDNPP
Sbjct:  514 IQIEVLDTNDHAPVFIKSVYLLFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTG------RFRVAPETGEVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQE------YFGIGLTNGSLYVSKPLDYEHQEN--YSLNVSATDGGKEPKTSYATV-RITLRDVNDNNPVFSPI----EYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEIRAT-------------VEFDFEVTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSDNQQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDAND-PPRF-LKSVYSAHVTEGSRIGHVVTNVTAVD-DDSDIRSIRYGISAGNTGNAFVMDAVTG-FVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPP 1058          

HSP 5 Score: 120.553 bits (301), Expect = 2.214e-27
Identity = 147/592 (24.83%), Postives = 246/592 (41.55%), Query Frame = 1
Query:  634 VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHV-----GKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYE---YLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPN-IQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGK-TVGQVEAIDLDIGENAKITYHLQARFS--QFGIDPISGKI 2367
            + ++ +    +  F  N  +  ++T   LDRE+              +P   L +L + +     ++   +  V + L DVNDN P F  S+    V E V    I      D D        I  DGS       G+E     + ++   + +   LDRE    + L + A DGGS   +    V +N+ D ND+ P +     +V ++ED      +IK+ A D DVG+N  V Y                      +G I + + + ++    L +P I    +   N     +     + I V+D ND+ P  I+++ L    LF +++    V      +V+  D G    V  E  + N        P T    +   +S+  +   +Y I ++ +D G P ++ T  + + V + N + P+F   +YQ    E+  +G  +  V ATD+D   NG + Y  ++ N++    I    GSL  SK  D E  + YS  V A D G    +S + V +T+ DVND+ P F  ++Y   + E++ P    V  V A D D      + Y +       +F ID  +G+I
Sbjct:  258 IRYAFVTGNSNNSFTINSITGRLRTARNLDRET--------------TPRFTLEVLAYDLGVPRKDS---VTNVTVVLRDVNDNQPVFTMSEYAAEVSEGVVESNIVTVVAEDRD--------IGSDGSVTYCITQGREGGLFVINENTGTIGITAKLDRETKSKYTLRVQATDGGSPALSSEADVIVNVLDQNDHAPVFTPATLTVKVQEDTGSGTTVIKVSAVDGDVGSNADVTYS---------------------TGMITLNRAIAFKPFSALPNPNIYNLTVRARNIYPPHYKADAAIQIEVLDTNDHAPVFIKSVYL----LFAVQDAGSGVSIGRVEAVDKFDYGPNALVRYEAISGNGTGRFRVAPETG--EVLIASSLRDDVNKTYYIRVRASDMGQPKMSDTAGVYVEVTERNLHPPVFSKAVYQTSENEDIAVGSALLTVTATDRDFGRNGEISYDIIAGNSQEYFGIGLTNGSLYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDKFVIDERTGEI 797          

HSP 6 Score: 100.908 bits (250), Expect = 2.316e-21
Identity = 125/488 (25.61%), Postives = 214/488 (43.85%), Query Frame = 1
Query: 1030 KEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDV-PINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNG--EEIIHSISTVVFITVIDINDN-PPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGY-------SLTTHNSIDRETIGSYII-IIKCNDFG---FPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSS-NAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-LQYFFSIPEDSNPGKTVGQVEAIDLDIGEN-AKITYHLQAR-FSQFGIDPISGKIILRSANIDREKISRYELKVIASD 2436
            +EYF   L      LY+ K LD E  +N+ L ++A DGG  P T    V I + D+NDN P +    +   + E+  P + ++  + A D+D      V Y       +++      F+++  +GEIR   + D+E   S    L + AKD G   +        V I +  +N+  P  +Q++  +      + EN      V  +S  D D G  G V        + LL  DN   +G+       +L+    +D E  G   + +I  N F     PS  +   + + V D ND  P F  ++Y   + E + +G  + +V A D D +    + Y +S+ N      +D+ TG +  + E DRE   +Y  TV A DNG   ++ ++ + +T+ D+ND+ P    L     + E+   G  V  + A D D+  N     Y +    +  F ++ +S  ++    ++DREK   Y + +  +D
Sbjct:  679 QEYFGIGLTNGS--LYVSKPLDYEHQENYSLNVSATDGGKEPKTSYATVRITLRDVNDNNPVFSPIEYRCELAENTTPRSVVVCSVRATDRDERGQQSVRYSILGGSGKDK------FVIDERTGEIRATVEFDFEVTMSS--FLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTAT-----VAENAPIGHSVLRVSATDKDKGPDGVVL-------YHLLGSDN--QQGFDLDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDP-PRFLKSVYSAHVTEGSRIGHVVTNVTAVDDDSDIR-SIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIAEYRLTVTATDNGTPPMTGNATLVVTLDDINDNPPHLTPLPCIGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFRLN-VSSGVVSTVKSLDREKQDAYNISIKVTD 1139          

HSP 7 Score: 86.2705 bits (212), Expect = 7.248e-17
Identity = 112/463 (24.19%), Postives = 188/463 (40.60%), Query Frame = 1
Query:  634 VEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNN------NVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITA---IDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIR-NEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKG-GEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEE 1986
            V +S+L       F  ++++ EI+  V+ D E                    + +  F M A  D              V I +  VN+  P F+ S  T  V EN  +G  + R   +D D          + GS   ++ F+  L  +   L +   LD E      L + A         P++      +      ++ P+++   +S  + E   I H++  + A D D         +  +IR         N F++++++G +R   +LD E +   E RL V A DNG   +   +T+V +T+ DINDNPP++  +      + ++ EN     QV +++  DPD     G     I   ++    L+  ++ G  ++T  S+DRE   +Y I IK  D     L++     I VED+NDN P   S        E   LG  +  V   D DI++
Sbjct:  775 VRYSILGGSGKDKFVIDERTGEIRATVEFDFE--------------------VTMSSFLMIAAKDEGLSPQRTADPPASVHILITGVNEFLPVFVQSVFTATVAENAPIGHSVLRVSATDKDKGPDGVVLYHLLGSD-NQQGFD--LDSNTGTLSVSGDLDNERAGIVTLRVIAKNLFQNSVTPSSVAHATIVVTVTDANDPPRFLKSVYSAHVTEGSRIGHVVTNVTAVDDD--------SDIRSIRYGISAGNTGNAFVMDAVTGFVRTAAELDREAIA--EYRLTVTATDNGTPPMTGNATLV-VTLDDINDNPPHLTPLPC----IGRVTENKPQGTQVMTLNAEDPDLNPNRGPFKYSISGSDYGSFRLN--VSSGV-VSTVKSLDREKQDAYNISIKVTDA--RGLSAVNFCMIHVEDQNDNRPKATSRDVYVHTFEGKFLGGVVADVRPDDPDIDD 1194          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: PCDH17 (protocadherin-17 [Source:NCBI gene;Acc:101168002])

HSP 1 Score: 261.922 bits (668), Expect = 1.020e-71
Identity = 207/661 (31.32%), Postives = 336/661 (50.83%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS---DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV---KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL------SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF------FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSF 2454
            ++ EE   G+++  IA      +  +  KS    F +L++        + +S  I T  ++DRE+LC         +PK      C L  ++ A    N+ EI  + I+++D+NDNSPSF +    I + EN   G   RF ++   D DS     K+ +V          + ++  D     +L + + LDRE   +  L++TAIDGG  P +G++ +N+ +TD NDN P +   ++ + I E++P   ++I L A D+D G+NG+V Y F    +E   R+++ F ++  +G I+VQ ++D+E  ++P I   V AKD G   I     +  + V D NDN P I  +S+ +     I E       +A + V D D+G+ G++ C +  N  F+L   ++     Y+L T   +DRET   Y + I   D G PSL +TR   + + DENDN P F  +LY  ++PENN+ G+Y+G + A D D+  NG V YS+        +    VS++   G++ AS+ F+ E +  + F V A+D G  H+ S+S V + ILDVND+ P   L           +P +   G  V  V+A+D D G++  +TY +        F IDP+ G++  R+A+   E+I+   EL V  +D G P  
Sbjct:   24 SVPEEQGPGTVIGNIAKDAGYGTIERGKKSN---FRVLENSAPHLVDVDPESGLIFTKQRIDRETLCRR-------NPK------CQLSMEVFA----NDKEICMIKIDIQDINDNSPSFPSDHVNIDISENAAAG--TRFPLTIAHDLDSGENGIKTYQVTRDDYNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAIDGGEYPRSGSMQINVRVTDSNDNSPVFEKSSYVIEIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASE---RIQDLFSIDPNTGVIKVQGEIDFE--ENPIIEFDVQAKDLGPNPIPGHCKIT-VKVQDKNDNSPVITFVSVRQGA---ISEAAPPDSVIALVRVTDKDSGRNGQLQCRVLGNVPFRLQENNDNF---YTLLTDRPLDRETRDEYNVTIVARDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYLGSILAHDPDVGRNGTVTYSILPSHIGDVSVYTYVSVNPTNGAIYASRSFNYEQTKSFEFKVQAKDGGSPHMESTSTVRVNILDVNDNLPVIILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHDHGDSGHLTYEITEGNDDHLFEIDPVGGEV--RTAHALWEEIAPVVELVVRVTDHGKPPL 648          

HSP 2 Score: 145.206 bits (365), Expect = 1.049e-34
Identity = 170/633 (26.86%), Postives = 284/633 (44.87%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLN-------SLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIF-HSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ-------ARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNN--EVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCLL--KRKYSLQES-NY 3030
            P + +++ ++ I E+          +A D D G NG   Y+    R++      N F L+       ++  E+ VQ+ LD E      + L  I   +G E   S S  + + V D NDN P  +  S     + +I EN+   + +  ++  D D G  G+V          +   L S+D P T    +     ID E        ++  D G   +     + + V+D+NDN P+    ++ Q  I E       I  V  TDKD   NG +   +  N    +   + N  +L   +  DRET D+Y+ T++ARDNG   L+++    + ILD ND+ P+F    Y   +PE++ PG+ +G + A D D+G N  +TY +        + ++   ++P +G I   S + + E+   +E KV A DGG P  +  + V +NI DVNDN PV   P  +N+  E+ V  N    +++A ++A D D        +TY +      N  H          LF+ID  GG++   +       +  +++ +R  DHG P LS+   LI+KV ++ +     +       +K HW   + L+V   I+   L  ++  +  K K+  +ES NY
Sbjct:  121 PSFPSDHVNIDISENAAAGTRFPLTIAHDLDSGENGIKTYQV--TRDD-----YNTFSLDLKVRGDGTIYPELVVQRPLDREDQSHHTLLLTAI---DGGEYPRSGSMQINVRVTDSNDNSPVFEKSSY----VIEIPENLPPGKILIDLNATDQDEGSNGQVVYSFTGYASERIQDLFSID-PNTG--VIKVQGEIDFEENPIIEFDVQAKDLGPNPIPGHCKITVKVQDKNDNSPVITFVSVRQGAISEAAPPDSVIALVRVTDKDSGRNGQLQCRVLGNVPFRLQENNDNFYTLLTDRPLDRETRDEYNVTIVARDNGIPSLNNTRSFTVKILDENDNAPRFTKSLYVLQVPENNIPGEYLGSILAHDPDVGRNGTVTYSILPSHIGDVSVYTYVSVNPTNGAIYA-SRSFNYEQTKSFEFKVQAKDGGSPHMESTSTVRVNILDVNDNLPVIILPLLQNDTAEIPVPRNVGIGYIVATVKAVDHD--HGDSGHLTYEIT---EGNDDH----------LFEIDPVGGEVRTAHALWE-EIAPVVELVVRVTDHGKPPLSAVAKLIIKVNTETAVGGGSS----ASGEKQHWDVSLPLIVILCIISVMLLAVMTAIAVKSKHHDKESGNY 715          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 256.144 bits (653), Expect = 5.771e-70
Identity = 237/716 (33.10%), Postives = 361/716 (50.42%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEIKTLV-KLDRESLCIDPEVKNCCDPKSPTPDL-CILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV---SDADSKLFSTKSIE-VDG-SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEID-NKNFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            I+EEL    L+  I   + IS +   T  S  + + L+  + DS        + EI T   ++DRE LC          P S   D  C  + ++     N+   +I++ I ++D NDN+P F +    I + EN  +    RF +   +D D+   S    E ++G S  G +       +   +L + ++LDRE  D + + I   DGGS   + T I+ + +TD+NDN+P +      V I E+ PI   +++L A D D+G N +++Y F    +    RL   F LNS SG I VQ+ LD E  ++   +L V+A D       +    V I V D+NDNPPNI     IS     +F  +++  N + +A I+V+D DT   G+V C I+ +  F L ++ DN     Y L T   +D E    Y   I  +D G PSL  T ++ + +EDENDN PIF   + +  + ENN    ++  ++ATD+D  +N  ++Y L  NA +   +D  TG LTAS+ FDRE  D++ FTV ARDNG   L + + V +T+LD ND+ PKF   +F F + E+     TVG +   D D GENA I+  +      F +DP SG +I  + + DRE+ S Y   V A D G P       V IN+ DVNDN P+  +P S  +   V  + +P  ++A++ A DSD     + + T +
Sbjct:   30 IREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLC----------PGSSFEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL---FALNSTSGLITVQRPLDRE--ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTK-IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN----QYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSG-VIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIV 717          

HSP 2 Score: 130.954 bits (328), Expect = 2.621e-30
Identity = 133/477 (27.88%), Postives = 210/477 (44.03%), Query Frame = 1
Query: 1522 ITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN--FQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIY----SLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-------IPEDSNPGKTVGQVEAIDLDIGENAKIT--------YHLQARF-SQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIR------AVDHGSPQLSSQTYLIVKVISD 2865
            I V D NDN P   +  ++      I EN     + A  S  DPDTG       E+ N    F L  ++ P  + +  L    ++DRE   +Y++ IK  D G P  +ST +L + V D NDN P+F     +  IPEN+ +G  +  + ATD DI  N  + Y     +S   + + +++S +G +T  +  DRE +  +  +V+A D   S   + + V + + DVND+ P  +L+Y  S       + E       +  +   D D   N K+         +HL+A + +Q+        ++  SA +D E    Y  K++ASD G PS     +V + +ED NDNPP+F  P     E+ V  N   +  +  + A D D     +  I Y L P  S                FD+D   G L       T S  ++ +   R      A D+G+P L +Q  +IV V+ +
Sbjct:  129 IIVKDTNDNAPMFPSPVIN----ISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQY--------LLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDED--SGKNAEIVYQLGPNAS---------------FFDLDRKTGVL-------TASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDE 564          

HSP 3 Score: 103.605 bits (257), Expect = 7.094e-22
Identity = 150/580 (25.86%), Postives = 247/580 (42.59%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN----CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP------IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD--------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            P + +   ++SI E+  IN       A D D G N    YE  N ++          ++ +  GE    + VQQ LD E   +  +++ V   ++G     S + ++ +TV D+NDN P  +   +       I EN      V  +   D D G   E++     ++     +L +L++  T G  +T    +DRE    + + +  +D       +T ++N  V D NDN P      I         + E + +   I  +  +DKD + NG VI  +  +    + ++  N   L  S   D E + +Y+F ++A D+G   L+ ++LV + + D ND+ P F       ++ E++     +  + A D D G+NA+I Y L    S F +D  +G ++  S   DRE   R+   V A D G P  Q +  V + + D NDN P F   +  + +  VS N      +  I   DSD        LS   DN   +IL PF  V          I  N+ FD +               SY++++    RA+D G P  SS   + + VI D++D
Sbjct:  139 PMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSA-----FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV---EDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIE----VHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNS--TSGL-ITVQRPLDREETAIHKLSVLASDGSSSPARATVIIN--VTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTG-VLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKF---THNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNE-NFILDPFSGV----------IKSNVSFDREQQ------------SSYTFDV----RAIDSGRPPCSSAAKVTINVI-DVND 669          

HSP 4 Score: 68.9366 bits (167), Expect = 3.120e-11
Identity = 97/338 (28.70%), Postives = 146/338 (43.20%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLI---KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP-NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVL 1851
            V + LED NDN P F      + V EN K    +     +D DS     K+ E+    V +   NA  +    K  ++   +  DRE  D F   +TA D G+ P      V + + D NDN PK+   +F   + E++P    +  +   D D G N  +     +I N+ E+     F+L+  SG I+     D E  Q       V A D+G     S + V  I VID+NDN P  I   S +  KL  +     +V  VA +   D DTG   E+   I + N + L   +P+T   +L    +     IG + +++  +D G+P    T VL
Sbjct:  454 VRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSG----KNAEI----VYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISL---SILNDNEN-----FILDPFSGVIKSNVSFDRE--QQSSYTFDVRAIDSGRPPCSSAAKVT-INVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSV--VAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPA--PTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh17 (protocadherin 17 [Source:NCBI gene;Acc:101155999])

HSP 1 Score: 255.758 bits (652), Expect = 1.928e-69
Identity = 204/674 (30.27%), Postives = 337/674 (50.00%), Query Frame = 1
Query:  538 TIKEELPSGSLVLQIA--SPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGE----------------IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEI-DNKNFQLL-SLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSL------SSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF------FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQ--FGIDPISGKIILRSANIDREKISR-YELKVIASDGGHPSF 2454
            ++ EE   G+++  IA  + + +    +  + K   F +L++        + QS  + T  ++DRE+LC         +PK      C L  ++ A    N+ EI  + I+++D+NDNSP F + Q  I + EN   G                 ++ +Q++  D  LFS   +EV     G ++          +L + + LDRE   +  L+++A DGG  P +GT+ +N+ + D NDN P +   ++ V I E+     ++I L A D D GNNG++ Y F     E   R+R  F ++S +G I++Q ++DYE  +SP I + V AKD G   I     V  + V+D NDN P+I  +S+ +     I E       +A + V D D+G+ G++ C +  N  F+L  + DN     Y++ T   +DRE    Y + I   D G P L ST+   + + DENDN P F  ++Y  +I ENN+ G+Y+G V A D D+ +NG V YS+        +    V++++  G++ A + F+ E    + F V+A+D G  HL S++ V +++ DVND+ P   L           +P +   G  V  V A+D D GE+ ++TY +     +  F IDP++G++  R+A+   E +S   EL +  SD G P+ 
Sbjct:   24 SVPEEQGPGTVIGNIAKDARLGLEQIGQGGQGKKANFRVLENSAPHLIDVDPQSGLLYTKQRIDRETLCKR-------NPK------CQLSMEVFA----NDKEICMIKIDIQDINDNSPVFPSDQIDIDISENAVPGTRFPLTSAHDPDAGENGLKTYQITRDDYNLFS---LEVKSRGDGTKF---------PELVIQRPLDREERSHHTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSYVVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPE---RIRELFSIDSRTGVIKIQGEIDYE--ESPVIEIDVQAKDLGPNPIPGHCKVT-VKVLDRNDNWPSIGFVSVRQGA---ISEAAPPGTVIALVRVTDKDSGRNGQLQCRVLGNVPFKLEENYDN----FYTVVTERPLDREMQDEYNVTIVAKDNGIPPLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNYEQIKYFDFKVLAKDAGSPHLESNATVRISVQDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGYIVTTVRAVDNDYGESGRLTYEISDGNEEHLFEIDPVTGEV--RTAHSFWEDVSPVVELIIRVSDHGKPTL 653          

HSP 2 Score: 137.502 bits (345), Expect = 2.630e-32
Identity = 166/622 (26.69%), Postives = 274/622 (44.05%), Query Frame = 1
Query: 1288 AEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLS-------GEIRVQQKLDYEYLQSPEIRLH---VIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEV----NCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP-IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSID-SNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQ-YFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFG-------IDPISGKI-ILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNN--EVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKK--SHWTAIISLVVATAILISFLFGILCLLKRKYSLQESNYRKGQTK-PDFSH 3063
            A D D G NG   Y+    R++      N F L   S        E+ +Q+ LD E       R H   +++  +G E   S +  + + VID NDN P     S     + +I EN    + +  ++  DPD G  G++    +     +  +L S+D   ++   +     ID E      I ++  D G   +     + + V D NDN+P I   ++ Q  I E    G  I  V  TDKD   NG +   +  N    +  +  N  ++   +  DRE  D+Y+ T++A+DNG   L+S+    + ILD ND+ P+F    Y   I E++ PG+ +G V A D D+G+N  + Y +       G       ++  +G I  +RS N   E+I  ++ KV+A D G P  +    V I+++DVNDN PV   P  +N+  E++V  N    +++  +RA D+D  ++   R+TY +      N  H          LF+ID   G++   + F     S  +++ IR  DHG P L++   LI+K         +   P   P  K   +W   + L+V  +I+   L   +  +  K   +    R    +  ++SH
Sbjct:  152 AHDPDAGENGLKTYQI--TRDD-----YNLFSLEVKSRGDGTKFPELVIQRPLDREE------RSHHTLILSATDGGEYPRSGTMQINVKVIDSNDNSPVFDPPSY----VVEIPENSTPGKVLIDLNATDPDEGNNGQIVYSFSGYAPERIRELFSID---SRTGVIKIQGEIDYEESPVIEIDVQAKDLGPNPIPGHCKVTVKVLDRNDNWPSIGFVSVRQGAISEAAPPGTVIALVRVTDKDSGRNGQLQCRVLGNVPFKLEENYDNFYTVVTERPLDREMQDEYNVTIVAKDNGIPPLNSTKSFTVKILDENDNVPRFTKSVYILQISENNIPGEYLGSVLAHDPDLGQNGTVYYSIVNSNVSGGDVNTYVNVNAANGAIYAVRSFNY--EQIKYFDFKVLAKDAGSPHLESNATVRISVQDVNDNIPVIVLPLLQNDTAEIHVPRNVGVGYIVTTVRAVDNDYGES--GRLTYEI---SDGNEEH----------LFEIDPVTGEVRTAHSFWE-DVSPVVELIIRVSDHGKPTLTAAARLIIKA-------SNGRPPDGLPHIKDNQNWDTSLPLIVTLSIISLMLLAAMVTIAIKCKRENKEIRTYNCRIAEYSH 728          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 255.758 bits (652), Expect = 2.377e-69
Identity = 237/716 (33.10%), Postives = 360/716 (50.28%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEIKTLV-KLDRESLCIDPEVKNCCDPKSPTPDL-CILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV---SDADSKLFSTKSIE-VDG-SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            I+EEL    L+  I   + IS +   T  S  + + L+  + DS        + EI T   ++DRE LC          P S   D  C  + ++     N+   +I++ I ++D NDN+P F +    I + EN  +    RF +   +D D+   S    E ++G S  G +       +   +L + ++LDRE  D + + I   DGGS   + T I+ + +TD+NDN+P +      V I E+ PI   +++L A D D+G N +++Y F    +    RL   F LNS SG I VQ+ LD E  ++   +L V+A D       +    V I V D+NDNPPNI     IS     +F  +++  N + +A I+V+D DT   G+V C I+    F L ++ DN     Y L T   +D E    Y   I  +D G PSL  T ++ + +EDENDN PIF   + +  + ENN    ++  ++ATD+D  +N  ++Y L  NA +   +D  TG LTAS+ FDRE  D++ FTV ARDNG   L + + V +T+LD ND+ PKF   +F F + E+     TVG +   D D GENA I+  +      F +DP SG +I  + + DRE+ S Y   V A D G P       V IN+ DVNDN P+  +P S  +   V  + +P  ++A++ A DSD     + + T +
Sbjct:   30 IREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLC----------PGSSFEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL---FALNSTSGLITVQRPLDRE--ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTK-IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN----QYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSG-VIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIV 717          

HSP 2 Score: 130.954 bits (328), Expect = 3.591e-30
Identity = 133/477 (27.88%), Postives = 210/477 (44.03%), Query Frame = 1
Query: 1522 ITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN--FQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIY----SLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-------IPEDSNPGKTVGQVEAIDLDIGENAK--------ITYHLQARF-SQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIR------AVDHGSPQLSSQTYLIVKVISD 2865
            I V D NDN P   +  ++      I EN     + A  S  DPDTG       E+ N    F L  ++ P  + +  L    ++DRE   +Y++ IK  D G P  +ST +L + V D NDN P+F     +  IPEN+ +G  +  + ATD DI  N  + Y     +S   + + +++S +G +T  +  DRE +  +  +V+A D   S   + + V + + DVND+ P  +L+Y  S       + E       +  +   D D   N K        + +HL+A + +Q+        ++  SA +D E    Y  K++ASD G PS     +V + +ED NDNPP+F  P     E+ V  N   +  +  + A D D     +  I Y L P  S                FD+D   G L       T S  ++ +   R      A D+G+P L +Q  +IV V+ +
Sbjct:  129 IIVKDTNDNAPMFPSPVIN----ISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQY--------LLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDED--SGKNAEIVYQLGPNAS---------------FFDLDRKTGVL-------TASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDE 564          

HSP 3 Score: 103.99 bits (258), Expect = 6.361e-22
Identity = 150/580 (25.86%), Postives = 247/580 (42.59%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN----CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP------IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD--------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            P + +   ++SI E+  IN       A D D G N    YE  N ++          ++ +  GE    + VQQ LD E   +  +++ V   ++G     S + ++ +TV D+NDN P  +   +       I EN      V  +   D D G   E++     ++     +L +L++  T G  +T    +DRE    + + +  +D       +T ++N  V D NDN P      I         + E + +   I  +  +DKD + NG VI  +  +    + ++  N   L  S   D E + +Y+F ++A D+G   L+ ++LV + + D ND+ P F       ++ E++     +  + A D D G+NA+I Y L    S F +D  +G ++  S   DRE   R+   V A D G P  Q +  V + + D NDN P F   +  + +  VS N      +  I   DSD        LS   DN   +IL PF  V          I  N+ FD +               SY++++    RA+D G P  SS   + + VI D++D
Sbjct:  139 PMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSA-----FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV---EDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIE----VHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNS--TSGL-ITVQRPLDREETAIHKLSVLASDGSSSPARATVIIN--VTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTG-VLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKF---THNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNE-NFILDPFSGV----------IKSNVSFDREQQ------------SSYTFDV----RAIDSGRPPCSSAAKVTINVI-DVND 669          

HSP 4 Score: 69.3218 bits (168), Expect = 2.180e-11
Identity = 97/338 (28.70%), Postives = 146/338 (43.20%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLI---KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP-NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVL 1851
            V + LED NDN P F      + V EN K    +     +D DS     K+ E+    V +   NA  +    K  ++   +  DRE  D F   +TA D G+ P      V + + D NDN PK+   +F   + E++P    +  +   D D G N  +     +I N+ E+     F+L+  SG I+     D E  Q       V A D+G     S + V  I VID+NDN P  I   S +  KL  +     +V  VA +   D DTG   E+   I + N + L   +P+T   +L    +     IG + +++  +D G+P    T VL
Sbjct:  454 VRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSG----KNAEI----VYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISL---SILNDNEN-----FILDPFSGVIKSNVSFDRE--QQSSYTFDVRAIDSGRPPCSSAAKVT-INVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSV--VAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPA--PTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 255.373 bits (651), Expect = 4.455e-69
Identity = 237/716 (33.10%), Postives = 360/716 (50.28%), Query Frame = 1
Query:  541 IKEELPSGSLVLQIASPVEIS-SFMKTHKSKVVEFSLLD-SMDSKYFFCNKQSSEIKTLV-KLDRESLCIDPEVKNCCDPKSPTPDL-CILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQV---SDADSKLFSTKSIE-VDG-SHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQA---ISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK-NFQLLSL-DNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYI 2643
            I+EEL    L+  I   + IS +   T  S  + + L+  + DS        + EI T   ++DRE LC          P S   D  C  + ++     N+   +I++ I ++D NDN+P F +    I + EN  +    RF +   +D D+   S    E ++G S  G +       +   +L + ++LDRE  D + + I   DGGS   + T I+ + +TD+NDN+P +      V I E+ PI   +++L A D D+G N +++Y F    +    RL   F LNS SG I VQ+ LD E  ++   +L V+A D       +    V I V D+NDNPPNI     IS     +F  +++  N + +A I+V+D DT   G+V C I+    F L ++ DN     Y L T   +D E    Y   I  +D G PSL  T ++ + +EDENDN PIF   + +  + ENN    ++  ++ATD+D  +N  ++Y L  NA +   +D  TG LTAS+ FDRE  D++ FTV ARDNG   L + + V +T+LD ND+ PKF   +F F + E+     TVG +   D D GENA I+  +      F +DP SG +I  + + DRE+ S Y   V A D G P       V IN+ DVNDN P+  +P S  +   V  + +P  ++A++ A DSD     + + T +
Sbjct:   30 IREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLC----------PGSSFEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLIN--SRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRL---FALNSTSGLITVQRPLDRE--ETAIHKLSVLASDGSSSPARA---TVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTK-IALITVSDKDTDINGKVICFIEKDVPFHLKAVYDN----QYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNA-SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSG-VIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIV 717          

HSP 2 Score: 130.568 bits (327), Expect = 4.366e-30
Identity = 133/477 (27.88%), Postives = 210/477 (44.03%), Query Frame = 1
Query: 1522 ITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKN--FQLLSLDNPLTKGY-SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIY----SLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFS-------IPEDSNPGKTVGQVEAIDLDIGENAK--------ITYHLQARF-SQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIR------AVDHGSPQLSSQTYLIVKVISD 2865
            I V D NDN P   +  ++      I EN     + A  S  DPDTG       E+ N    F L  ++ P  + +  L    ++DRE   +Y++ IK  D G P  +ST +L + V D NDN P+F     +  IPEN+ +G  +  + ATD DI  N  + Y     +S   + + +++S +G +T  +  DRE +  +  +V+A D   S   + + V + + DVND+ P  +L+Y  S       + E       +  +   D D   N K        + +HL+A + +Q+        ++  SA +D E    Y  K++ASD G PS     +V + +ED NDNPP+F  P     E+ V  N   +  +  + A D D     +  I Y L P  S                FD+D   G L       T S  ++ +   R      A D+G+P L +Q  +IV V+ +
Sbjct:  129 IIVKDTNDNAPMFPSPVIN----ISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSS--PARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQY--------LLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVI---ELAVMENNKRDLFLTTLSATDED--SGKNAEIVYQLGPNAS---------------FFDLDRKTGVL-------TASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDE 564          

HSP 3 Score: 103.605 bits (257), Expect = 8.202e-22
Identity = 150/580 (25.86%), Postives = 247/580 (42.59%), Query Frame = 1
Query: 1210 PKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGE----IRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVN----CEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYP------IFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAE-AIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYF-FSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSD--------LSQATDNRITYILLPFPSVNYPHPQSRLSIYQNL-FDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISD 2874
            P + +   ++SI E+  IN       A D D G N    YE  N ++          ++ +  GE    + VQQ LD E   +  +++ V   ++G     S + ++ +TV D+NDN P  +   +       I EN      V  +   D D G   E++     ++     +L +L++  T G  +T    +DRE    + + +  +D       +T ++N  V D NDN P      I         + E + +   I  +  +DKD + NG VI  +  +    + ++  N   L  S   D E + +Y+F ++A D+G   L+ ++LV + + D ND+ P F       ++ E++     +  + A D D G+NA+I Y L    S F +D  +G ++  S   DRE   R+   V A D G P  Q +  V + + D NDN P F   +  + +  VS N      +  I   DSD        LS   DN   +IL PF  V          I  N+ FD +               SY++++    RA+D G P  SS   + + VI D++D
Sbjct:  139 PMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYELINGQSA-----FGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKV---EDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIE----VHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNS--TSGL-ITVQRPLDREETAIHKLSVLASDGSSSPARATVIIN--VTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTG-VLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKF---THNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNE-NFILDPFSGV----------IKSNVSFDREQQ------------SSYTFDV----RAIDSGRPPCSSAAKVTINVI-DVND 669          

HSP 4 Score: 69.3218 bits (168), Expect = 2.476e-11
Identity = 97/338 (28.70%), Postives = 146/338 (43.20%), Query Frame = 1
Query:  853 VLIELEDVNDNSPSFLNSQDTIYVKENVKLGE-IQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLI---KHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPP-NIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVL 1851
            V + LED NDN P F      + V EN K    +     +D DS     K+ E+    V +   NA  +    K  ++   +  DRE  D F   +TA D G+ P      V + + D NDN PK+   +F   + E++P    +  +   D D G N  +     +I N+ E+     F+L+  SG I+     D E  Q       V A D+G     S + V  I VID+NDN P  I   S +  KL  +     +V  VA +   D DTG   E+   I + N + L   +P+T   +L    +     IG + +++  +D G+P    T VL
Sbjct:  454 VRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSG----KNAEI----VYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISL---SILNDNEN-----FILDPFSGVIKSNVSFDRE--QQSSYTFDVRAIDSGRPPCSSAAKVT-INVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSV--VAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPA--PTDIGLHRLVVNISDLGYPKSLHTLVL 768          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000072628.1 (SMESG000072628.1)

HSP 1 Score: 2013.42 bits (5215), Expect = 0.000e+0
Identity = 1029/1029 (100.00%), Postives = 1029/1029 (100.00%), Query Frame = 1
Query:  442 MDFRVRTXXXXXXXXXXXXXXXTIQLKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCLLKRKYSLQESNYRKGQTKPDFSHVIERQGASDPGKLTSDDEEQITNPDYRNLGTYVGFPSNHYTVGSLNQKLNNNLDVSGRIAMQHYPQKYPTQIDKNNLYQTLTMQRNVPSKFFSVQKNNTLSSSQLEKNSNDIVPTNATQTFHSCSQSTPSHEELDDASETIANPMVSTYCSVSFV 3528
            MDFRVRTKLLFILLSFQILFKSTIQLKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLIVNINITDINDNQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETIVNINIEDVNDNPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCLLKRKYSLQESNYRKGQTKPDFSHVIERQGASDPGKLTSDDEEQITNPDYRNLGTYVGFPSNHYTVGSLNQKLNNNLDVSGRIAMQHYPQKYPTQIDKNNLYQTLTMQRNVPSKFFSVQKNNTLSSSQLEKNSNDIVPTNATQTFHSCSQSTPSHEELDDASETIANPMVSTYCSVSFV
Sbjct:    1 MDFRVRTKLLFILLSFQILFKSTIQLKLLFRQTIKEELPSGSLVLQIASPVEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLIVNINITDINDNQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETIVNINIEDVNDNPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILCLLKRKYSLQESNYRKGQTKPDFSHVIERQGASDPGKLTSDDEEQITNPDYRNLGTYVGFPSNHYTVGSLNQKLNNNLDVSGRIAMQHYPQKYPTQIDKNNLYQTLTMQRNVPSKFFSVQKNNTLSSSQLEKNSNDIVPTNATQTFHSCSQSTPSHEELDDASETIANPMVSTYCSVSFV 1029          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000042589.1 (SMESG000042589.1)

HSP 1 Score: 259.225 bits (661), Expect = 7.573e-71
Identity = 267/866 (30.83%), Postives = 415/866 (47.92%), Query Frame = 1
Query:  670 YFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKA-DNNNVEIIQ----VLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV-----KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFS-VSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFE--NIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQS-PEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK--IKENVQNVQQVASISVNDPDTGKGGEVNCEIDN--KNFQLLSLDNPLTKG---YSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKD--IEENGHVIYSLSSNAEAIVSID--SNTGSLTASK-------EFDRETSDKYSFTVIARDNGPS-------HLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSH-GGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKK------SHWT----------------AIISLVVATAILISFLFGILCLLK------RKYSLQESNYRKGQT 3045
            +   N+ +  I     +DR+S+C   ++K CC     + + CI+Q +   +  DN+   + Q    VLIE+ D+ND+SP+F + +  I + E   +       ++ D DS  FS         H    +F     QD       +L +   LDRE +   +L + A D G  P TG++ V I I D NDN P  I E  S +SIKED  ++H II++ A+DKD G N  + +  +  N++N+      N F ++ +SG I + +++DY+ +QS P+I L +  +D+G+    S +  + I V+D+ND  P I  I L   +  +  I EN+Q+ Q VA ++V+D D G  G+V C++     +F L +++    K    Y + T   +D E    Y +II+C+D G P  T+ + L + V D NDN P F  +  +  + EN   G  +  +N TD D   +ENG   Y++S +   +  ++     G L ++K        FDRE      F +   D            LSSSS V + I D ND+ P F + QY F+I E+      VG ++A D D G+N KI+Y +    S     F +D  +G +  +S  IDREKIS +E KV A D GHP       V + + D+NDN P F +P+ +N+ V+ S     N LI ++ A D D  +A  N+ITY      S+    P         LF IDS+ GG  F     PT + SY + + +   DH  P  S+Q  + VKV      ++ + NP +   K+      S W+                 I  ++++ A+    L  I+CL +      RK  L ES  RK  T
Sbjct:   54 FIVINQSTGRITLRRPIDRDSMC--EKMKLCCVELHQSSE-CIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECIQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQND-----MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSK-IDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYD--EAGKNQITY------SIEGGDPYG-------LFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDH--PSRSAQITIHVKV---EESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMT 885          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000076665.1 (SMESG000076665.1)

HSP 1 Score: 259.996 bits (663), Expect = 8.546e-71
Identity = 251/873 (28.75%), Postives = 407/873 (46.62%), Query Frame = 1
Query:  640 FSLLDSMDSKYFFCNKQS----SEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQ--------------VLIELEDVNDNSPSFLNSQDTIYVKENVKLG-EIQRFQVSDADSKLFSTKSIEVDGSHVG-----KEYFNARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASIS-VNDPDTGKGGEVNCEID-NKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFE-----LQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISD------ISDKKHHTNPIWTPEKKSHWTAI---------ISLVVATAILISFLFGILCLLKRKYSLQE---SNYRKGQTKPDFSHVIERQGASDPGKLTSD 3111
            F ++++ D KY   +K       +I+    +DRESLC D  +  CCD +      C  + ++  +  + N +I                + I++ D+NDNSP F     TI + E++++G +I      D DSK F+  S  ++           E+ N     +Q+ L L++ +DRE V  + L + A D G    +G L + I I D NDNQP +    + V++KE     HLI+ L A DKD G NG V Y F +   +  S +R  F ++S +G + + + LDYE ++      +VIA+D+G +   S +TV  ++V+D NDNPP I    ++      + E    + +  SI  V+DPD+G GG V C++  ++ F L+  +N     + +    S+D E       II C+D G P LTS+    I++ D NDN PIF    Y   + ENN  G  +  V ATD+D + NG + YS+ S + +  SID  TG++ +   FDRE    Y  +V ARD G    S S+ V +TI D ND+TP F+       Y F I E+      +G + A D D G N ++ Y   +   +F I P  G II  +  +DRE  + +E  V   D G    +    V +++ D NDN P F  P++ +  V +S       L+A+I A D D  +  ++ + Y ++           SR      +F +D   G +FL            I + +   D G+P   S    ++K+ +       +++ K++ N   T   +S   ++         I+L+    +++  L   LC  + +  L E    N  +G+T  +         + +P K  SD
Sbjct:   79 FEIINNDDLKYSLNSKNDHLRIGDIRVKKPIDRESLCGD--IGKCCDSEP----FCFFELKVLVRVPSINSKISYSSSEKISSTMTIETIRIKIIDINDNSPHFSQPVKTIEISESIQIGAKIPLPLAVDEDSKNFNIISYRLENHEHALFTLIPEWSNFDSTINQIFLKLLQPIDRENVSMYNLNLIATDKGKPSLSGKLKIEIKILDANDNQPIFENSTYIVNVKESEISGHLILLLKATDKDSGENGLVMYYFSS---DVTSEVRKKFHIDSSTGWLSISETLDYEKVKY--YTFNVIARDSGTDAAFSKATVK-VSVVDCNDNPPKIYLEYVTDSGKRTLIEGPTTINKEYSIVIVSDPDSGNGGLVQCDLKGSQKFILVPPNNREGSTWKINLVESLDYEERNVERFIIVCHDRGEPQLTSSHEEEIIIRDINDNSPIFEHPSYHQTVEENNQAGIVVLKVVATDRDSDLNGKINYSIDSLSVSYFSIDPVTGTIRSKISFDREKRASYQLSVFARDLGEPAQSGSANVLITITDQNDNTPYFQGLNGGGSYIFEIKENGPSNAIIGTIHAEDPDEGINGQVLYTFLSPVEKFTIHPDQG-IIRTNQQLDRENKAVHEFSVRVIDKGILRQENSVSVTVSVIDENDNEPRFVIPTNDSTSVKISYLDTAGTLVARIEAIDKD--EGPNSHLDYQII--------SGNSRDQTQDKIFFMDQKNGDIFLQRALTRQDMGVYI-LKMMVSDQGNPPRKSYANYVIKIDNSAQRSQTLNNMKYNQNQHATYSDRSRDDSLSTSVILIVSIALICIIVLVLLTLAVFLCGKRGQEELNEILFKNSDRGETSANLHFCFCLSKSRNPRKPRSD 927          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000042589.1 (SMESG000042589.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.105e-70
Identity = 266/866 (30.72%), Postives = 416/866 (48.04%), Query Frame = 1
Query:  670 YFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKA-DNNNVEIIQ----VLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSHVGKEYFNARLYQDQV-----KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFS-VSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFE--NIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQS-PEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFK--IKENVQNVQQVASISVNDPDTGKGGEVNCEI----DNKNFQLLSLDNPLTK-GYSLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKD--IEENGHVIYSLSSNAEAIVSID--SNTGSLTASK-------EFDRETSDKYSFTVIARDNGPS-------HLSSSSLVYLTILDVNDHTPKF-ELQYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQARFS----QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRLSIYQNLFDIDSH-GGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKVISDISDKKHHTNPIWTPEKK------SHWT----------------AIISLVVATAILISFLFGILCLLK------RKYSLQESNYRKGQT 3045
            +   N+ +  I     +DR+S+C   ++K CC     + + CI+Q +   +  DN+   + Q    VLIE+ D+ND+SP+F + +  I + E   +       ++ D DS  FS         H    +F     QD       +L +   LDRE +   +L + A D G  P TG++ V I I D NDN P  I E  S +SIKED  ++H II++ A+DKD G N  + +  +  N++N+      N F ++ +SG I + +++DY+ +QS P+I L +  +D+G+    S +  + I V+D+ND  P I  I L   +  +  I EN+Q+ Q VA ++V+D D G  G+V C++    D+ + + +  +N   +  Y + T   +D E    Y +II+C+D G P  T+ + L + V D NDN P F  +  +  + EN   G  +  +N TD D   +ENG   Y++S +   +  ++     G L ++K        FDRE      F +   D            LSSSS V + I D ND+ P F + QY F+I E+      VG ++A D D G+N KI+Y +    S     F +D  +G +  +S  IDREKIS +E KV A D GHP       V + + D+NDN P F +P+ +N+ V+ S     N LI ++ A D D  +A  N+ITY      S+    P         LF IDS+ GG  F     PT + SY + + +   DH  P  S+Q  + VKV      ++ + NP +   K+      S W+                 I  ++++ A+    L  I+CL +      RK  L ES  RK  T
Sbjct:   78 FIVINQSTGRITLRRPIDRDSMC--EKMKLCCVELHQSSE-CIIQLKAVVQLLDNHKTPLTQKDCNVLIEITDINDHSPTFFSDKVVINISEAETIDSPHPLPMAHDPDSSKFSINRYYF---HEASRFFRIECIQDNTGKIIPQLRVKSRLDREEISEHQLTVIASDAGVPPKTGSINVIIRILDENDNAP--IIEQLSPISIKEDTLVDHHIIRIEAKDKDTGENELISFFLKEPNVQND-----MNHFRIDQMSGVITLARQIDYDSIQSLPQIELIITVQDHGKPKQLSSTATLTIIVLDVNDEVPVISIIDLFSRQPARPEILENLQSNQLVAYVNVHDADHGLNGQVKCDLIGYEDDFSLENIEYNNVKDQFEYKIVTKVKLDCEKESLYRLIIRCSDSGHPKQTAQQELIVKVIDVNDNSPTFGRSRIELELSENEPPGTLLTTINVTDLDETDKENGRFDYTISESGRKLFRLEPVEGRGKLESAKLRIYSLTSFDREKISTIEFELTVSDTNRKSISGTWRSLSSSSTVIVHIKDRNDNAPIFSKTQYEFTITEEKPQNLFVGLLQATDEDQGDNGKISYKIDDFSSDVQNSFTLDFNTGTLTTKSK-IDREKISIFEFKVKARDQGHPGRYSIANVVVKVSDINDNDPKFIYPTIENHTVSASIQSSENTLIMKVNALDYD--EAGKNQITY------SIEGGDPYG-------LFQIDSNVGGISFAKKPKPTDARSYFLLIKVTDNDH--PSRSAQITIHVKV---EESRQQYYNPDYKTGKENGQIEDSSWSEYSNNSKMVLNRNILLIICLIIISAALAGVLLMLIMCLKRRPSQTVRKSDLPESVSRKQMT 909          
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Match: SMESG000066775.1 (SMESG000066775.1)

HSP 1 Score: 251.906 bits (642), Expect = 1.571e-68
Identity = 219/703 (31.15%), Postives = 350/703 (49.79%), Query Frame = 1
Query:  670 YFFCNKQSSEIKTLVKLDRESLCIDPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSPSFLNSQDTIYVKENVKLGEIQRFQVS-DADSKLFSTKSIEVDGSH----------VGK--EYF---NARLYQDQV--KLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLXXXXXXXXXXXXQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGN--NGKVYYEFENIRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGEVNCEIDNK---NFQLLSLDNPLTKGYSLTTH--NSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDIEENGHVIYS-LSSNAEAIVSIDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPE---DSNPGKTVGQVEAIDLDIGENAKITYH--------------LQARFSQFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVFQFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILL 2649
            YF  N+ S ++     LDRE++C              T + C ++  +     + +   IQ++IE+ D+NDN P F  +Q  I ++EN+ +G      V+ D DS  +  K+  +              +G   ++F   N +  Q+++   L +IK++DRE   +F  ++ A D G+   TG+  V + +TD+NDN P+W  +N+ V+I+E       I++L+A D+D  N  NG V Y+  + R E+   +   F +N    ++ +        +    IR+++ A D    +     T V I + D ND+PP    IS++ ++  K+ EN +    + ++ V D D G+ G   C +++    N + +  D+     Y + T+   S DRE I  Y + IKC D G P+++S +  +I + D NDN P F + +  F + ENN +G  +G V A D D   NGH++YS L+SN    +SI    G + +  +FDRE +D Y F V ARDNG   L+ S +V + I D+ND TP FE  YFF I E   +S   + + Q++A D D+G+N  + Y               L+A           G I +   N+DRE+IS  +L V A D G+PS    T + I + D+NDN PVF FPS+  N VNVS        I  ++    DL Q  +  IT+ L+
Sbjct:   62 YFSLNRTSGDLIVKSFLDRETIC------------ENTKETCSMKLYL-----DQDTHAIQIVIEINDINDNVPVFQTTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFGNQ--TGSCTVTVLVTDVNDNAPEWTKDNYKVNIQE-CQSEGDILELIANDRDDPNTKNGLVSYQLSD-RTEDRKIVSQIFYING--NKLHLTNNRISGLINRNNIRIYITATDGNGRMNE---TSVDIAIEDCNDHPP---VISIA-NRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAI-YKIETYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGSTVGQVRAMDLDSSNNGHIVYSILNSNDNFAISI---YGEIQSKIKFDREKTDSYEFVVTARDNGEPQLNDSMVVKVKIQDINDCTPVFEKDYFFRITESYGESIKNERLEQIKATDKDLGQNGTVKYRLIDVKPIGIPGNSKLKAELRNLIKVSFDGAISIY-GNLDREEISSIQLLVQAFDDGYPSLSTTTTIIIEVLDLNDNAPVFLFPSNNMNFVNVSVEWEIGKTICTVKT--KDLDQGINGTITHSLI 727          

HSP 2 Score: 86.2705 bits (212), Expect = 1.042e-16
Identity = 167/610 (27.38%), Postives = 250/610 (40.98%), Query Frame = 1
Query: 1219 ITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFENIRNEEESRLR------NFFLLNSLSGEIRVQQKLDYEYL-----QSPEIRLHVIAKDNGEEIIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASISVNDPDTGKGGE-----VNCE-IDNKN--------FQLLSLDNPLTKGY----SLTTHNSIDRETIGSYIIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLGQYIGHVNATDKDI--EENGHVIYSLSSNAE--AIVS----IDSNTGSLTASKEFDRETSDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFEL-QYFFSIPEDSNPGKTVGQVEAIDLDIGENAKITYHLQ---------ARFS-QFGIDPISGKIILRSANIDREKISRYELKVIASDGGHPSFQGETXXXXXXXXXXXXPPVF-----QFPSSKNNEVNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLP----FPSVNYPHPQSRLSIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTYLIVKV-ISDISD 2874
            IT N   S+ E+  I H++             G VY +   + N   S L       ++F LN  SG++ V+  LD E +     ++  ++L++      ++  H+I  V+ I   DINDN P  Q    +  K+  I+EN+            D D+ K G        C+ ID +N        FQ   + NP +K      SL    +IDRE   S++ I+   DFG  + T +  + ++V D NDN P +    Y+  I E    G  +  + A D+D    +NG V Y LS   E   IVS    I+ N   LT ++       +     + A D G   ++ +S V + I D NDH P   +   F  + E+      +  V+  D D G N      L           RF   F I  I         + DREKIS Y +++   D G+P+       +INI DVNDN P F      F   +NN +  +        + Q+RA   DL  + +  I Y +L     F    Y   QS++   +   D                   SYE  V  R  D+G PQL+    ++VKV I DI+D
Sbjct:   17 ITLNVEFSVDENCRIGHVV-------------GNVYSKLNQLPNSSRSSLMKANEKDSYFSLNRTSGDLIVKSFLDRETICENTKETCSMKLYL------DQDTHAIQIVIEIN--DINDNVPVFQ----TTQKVINIQENIPIGTTYPLPVAQDKDSYKYGVKTYYIARCQGIDQENQVKTIGNNFQFFQIKNPKSKQEEIYPSLEIIKNIDREEFVSFVFILIAADFG--NQTGSCTVTVLVTDVNDNAPEWTKDNYKVNIQECQSEGDILELI-ANDRDDPNTKNGLVSYQLSDRTEDRKIVSQIFYINGNKLHLTNNRISGLINRNNIRIYITATD-GNGRMNETS-VDIAIEDCNDHPPVISIANRFGKVLENQKQKIILTTVQVKDEDKGRNGMFECSLNDSGKLNLKNIRFDDNFAIYKIE---TYPDTSFDREKISVYTVEIKCVDQGNPAMSSMQKFSINIIDVNDNAPRFVNKIKMFHVVENNPIGST--------VGQVRA--MDLDSSNNGHIVYSILNSNDNFAISIYGEIQSKIKFDREKTD-------------------SYEFVVTAR--DNGEPQLNDS--MVVKVKIQDIND 560          
The following BLAST results are available for this feature:
BLAST of Protocadherin-11 X-linked vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH16.053e-7329.53protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH12.351e-7230.99protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDHB24.826e-7233.28protocadherin beta 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
PCDHGB51.391e-7032.43protocadherin gamma subfamily B, 5 [Source:HGNC Sy... [more]
PCDHGB53.065e-7032.43protocadherin gamma subfamily B, 5 [Source:HGNC Sy... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-18.607e-4531.04FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-13.958e-3729.60FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-17.457e-3327.85CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-44.001e-3028.00Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-11.428e-2526.18Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds1.972e-5830.96gene:FBgn0284247 transcript:FBtr0078045[more]
ds1.972e-5830.96gene:FBgn0284247 transcript:FBtr0343249[more]
ft2.158e-4829.30gene:FBgn0001075 transcript:FBtr0077478[more]
stan2.038e-4628.10gene:FBgn0024836 transcript:FBtr0303223[more]
stan2.038e-4628.10gene:FBgn0024836 transcript:FBtr0088214[more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.325e-7329.91protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a3.820e-7329.91protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh2aa153.533e-7133.43protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2aa154.101e-7133.63protocadherin 2 alpha a 15 [Source:ZFIN;Acc:ZDB-GE... [more]
pcdh2ab91.935e-7030.63protocadherin 2 alpha b 9 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajb131.857e-7332.09DnaJ heat shock protein family (Hsp40) member B13 ... [more]
ENSXETT00000039468.11.053e-7232.14protocadherin gamma-B5-like [Source:NCBI gene;Acc:... [more]
dnajb131.413e-7231.92DnaJ heat shock protein family (Hsp40) member B13 ... [more]
ENSXETT00000039464.15.965e-7030.71protocadherin gamma-B5-like [Source:NCBI gene;Acc:... [more]
vapa6.620e-7032.12VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdhgb53.977e-7533.03protocadherin gamma subfamily B, 5 [Source:MGI Sym... [more]
Pcdh11.927e-7329.32protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh11.927e-7329.32protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdhb211.433e-6930.28protocadherin beta 21 [Source:MGI Symbol;Acc:MGI:2... [more]
Pcdh11x3.596e-6930.96protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5DRC3|PCDBH_PANTR2.388e-7232.98Protocadherin beta-17 OS=Pan troglodytes OX=9598 G... [more]
sp|Q08174|PCDH1_HUMAN2.907e-7229.53Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9Y5E7|PCDB2_HUMAN2.318e-7133.28Protocadherin beta-2 OS=Homo sapiens OX=9606 GN=PC... [more]
sp|Q5DRD2|PCDB2_PANTR9.157e-7132.95Protocadherin beta-2 OS=Pan troglodytes OX=9598 GN... [more]
sp|Q9Y5G0|PCDGH_HUMAN1.472e-6932.43Protocadherin gamma-B5 OS=Homo sapiens OX=9606 GN=... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183ABS04.540e-10230.96Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4V6RGX95.771e-9130.36Uncharacterized protein OS=Opisthorchis felineus O... [more]
K1R0471.534e-8931.46Protocadherin-11 X-linked OS=Crassostrea gigas OX=... [more]
A0A5J4NUF52.353e-8930.25Protocadherin delta 1 OS=Paragonimus westermani OX... [more]
A0A4E0RFC92.558e-8730.65Protocadherin-11 Y-linked OS=Fasciola hepatica OX=... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh2ac2.342e-7432.39protocadherin alpha-C2 [Source:NCBI gene;Acc:10303... [more]
pcdh92.460e-7232.45protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh93.430e-7232.45protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1a8.448e-7031.08protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.859e-6931.16protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.882e-7131.20protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
si:ch211-199f5.19.890e-6027.07protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000010725.18.192e-5328.15pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000008517.14.948e-4528.85pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006212.11.770e-4432.54pep scaffold:Pmarinus_7.0:GL476841:227071:229326:-... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO482377.131e-6031.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461891.405e-5730.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404702.667e-5732.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.501e-5029.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354139.490e-4631.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-11 X-linked vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH171.020e-7131.32protocadherin-17 [Source:NCBI gene;Acc:101168002][more]
pcdh95.771e-7033.10protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh171.928e-6930.27protocadherin 17 [Source:NCBI gene;Acc:101155999][more]
pcdh92.377e-6933.10protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh94.455e-6933.10protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin-11 X-linked vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072628.10.000e+0100.00SMESG000072628.1[more]
SMESG000042589.17.573e-7130.83SMESG000042589.1[more]
SMESG000076665.18.546e-7128.75SMESG000076665.1[more]
SMESG000042589.11.105e-7030.72SMESG000042589.1[more]
SMESG000066775.11.571e-6831.15SMESG000066775.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033431 ID=SMED30033431|Name=Protocadherin-11 X-linked|organism=Schmidtea mediterranea sexual|type=transcript|length=3720bp
AATTATCTATTTGAGATTTGTTTTATTCACAACATTGGTGAGATATTTTT
GTTATATTTTATGAACTTATTTCCCATGTGCTCCCCTCGCGAAAACTGGC
CGGGAACTTGAAGCGGCTGTTTGCCAGATAGAGCAACATTAGTTTTGCGG
AAATATTAATATTTTCAGTCAACTAAATATGTAAGCAAACAATATTTACA
CAGAAAACATACAATTGTTTCTTGTTGATTATTCAACCGTGACCTCAATC
AAGCAAATCTCCGTAGCTTGGTGCTGTAAGCCGTTTGGGTTGAGTTTCCG
CCGACGGAAACATTTTCCTTCAGCTTTCAATAAGAAATAAGAAAATTTAT
AAACAAACTAATATTTCTCTGGATTTTTCAACTGCAATTTTCCATTTTGT
TTCCATCGTTATCCATCTGATAAAATATTTCCAAATTCCCAATGGACTTC
AGAGTTCGGACAAAACTCCTCTTCATTCTTCTCTCTTTCCAGATCCTTTT
CAAGTCGACTATACAACTGAAACTGTTGTTTAGACAAACAATCAAAGAGG
AATTACCTTCTGGATCCTTGGTGTTGCAAATCGCGTCTCCGGTAGAAATC
TCGAGTTTCATGAAAACTCACAAGTCGAAAGTTGTAGAGTTTTCTCTGCT
CGATTCGATGGACAGCAAATACTTCTTCTGCAACAAGCAAAGCTCCGAGA
TCAAAACCCTTGTAAAGCTTGACCGAGAAAGCCTGTGCATTGACCCAGAA
GTCAAAAACTGTTGCGATCCGAAATCACCGACCCCAGATTTATGCATTTT
ACAATTTCAAATGACCGCCAAAGCTGACAACAACAATGTGGAAATAATTC
AGGTTCTCATTGAACTCGAAGACGTCAATGACAATTCTCCTTCGTTTCTG
AACTCTCAAGATACGATCTATGTTAAAGAGAATGTCAAATTGGGCGAGAT
CCAAAGATTTCAAGTCTCAGATGCAGATTCGAAATTGTTCTCCACGAAAT
CAATTGAAGTAGATGGAAGTCATGTGGGTAAAGAATATTTCAATGCCCGA
CTGTACCAAGACCAAGTAAAGTTGTACCTTATAAAGCACTTAGATCGGGA
GCTCGTTGATAATTTTAAGCTTGTAATAACAGCAATTGACGGAGGGAGCA
ATCCGAATACTGGGACGCTCATTGTCAACATAAATATTACGGATATTAAT
GACAACCAACCGAAATGGATAACCGAGAACTTTTCAGTATCCATTAAGGA
GGACGTCCCAATAAACCATTTGATTATCAAGCTTCTGGCCGAAGATAAAG
ACGTAGGAAACAATGGGAAGGTTTATTATGAATTCGAAAACATTCGAAAC
GAGGAAGAATCAAGGCTAAGGAATTTCTTTTTGCTGAATAGTTTAAGCGG
TGAAATCAGAGTTCAACAGAAATTGGATTATGAATACTTACAGTCACCGG
AAATCCGATTGCACGTAATCGCAAAGGACAACGGAGAGGAGATCATTCAT
TCCATCAGTACGGTTGTGTTCATAACCGTCATTGACATCAATGACAACCC
GCCAAATATCCAAGCGATTTCTTTGAGCAAAGACAAGCTTTTTAAAATCA
AAGAAAACGTTCAAAACGTCCAACAAGTCGCAAGCATTTCCGTCAATGAT
CCCGATACTGGAAAGGGGGGCGAGGTGAATTGTGAAATTGATAATAAAAA
CTTCCAACTTCTCTCATTAGACAACCCTTTAACAAAAGGCTACTCATTGA
CAACCCATAATTCCATTGACAGGGAGACGATTGGCTCATATATTATTATT
ATAAAATGCAATGACTTTGGGTTTCCTTCGTTGACCTCGACAAGAGTTCT
TAATATTATGGTTGAAGACGAAAACGACAACTACCCGATCTTTCATTCGA
CATTGTATCAATTTCGAATACCTGAAAATAATGTCTTGGGTCAGTATATA
GGGCATGTGAATGCAACCGACAAAGATATAGAGGAAAACGGCCATGTGAT
ATACTCTCTCAGTAGCAATGCAGAAGCGATAGTTTCAATTGACTCTAACA
CGGGCTCCTTAACAGCGAGCAAAGAGTTCGACCGAGAAACCTCTGACAAA
TATTCCTTCACCGTAATCGCTAGAGATAACGGACCTTCGCATCTTAGCTC
ATCCTCTCTAGTTTACTTGACAATTCTTGATGTCAACGACCACACTCCCA
AGTTTGAATTGCAATACTTTTTCAGTATTCCCGAAGACTCAAATCCTGGA
AAAACTGTCGGTCAAGTCGAAGCCATAGATCTCGATATAGGCGAGAATGC
CAAAATCACATATCATTTACAAGCAAGGTTTTCACAATTTGGAATAGATC
CAATATCTGGGAAAATAATTCTACGGTCTGCAAATATAGATAGAGAGAAA
ATATCCCGCTACGAATTAAAGGTAATTGCCAGTGATGGAGGCCATCCAAG
CTTTCAAGGAGAAACCATTGTGAATATAAACATTGAAGATGTCAACGATA
ATCCGCCAGTGTTTCAATTTCCATCAAGCAAAAATAATGAAGTGAATGTT
TCATGTAACCAAATGCCAAATCATTTAATCGCCCAAATCCGAGCAAATGA
TTCCGATTTAAGCCAAGCTACAGATAATCGTATCACTTATATTCTTCTTC
CTTTTCCATCAGTTAATTATCCTCATCCCCAGTCAAGACTTTCAATTTAT
CAAAATCTTTTCGATATCGACAGTCATGGAGGTCAACTCTTTCTTATCAA
CAAATTTCCAACCTGTTCCTATTCATATGAAATTAAAGTCCACATCAGAG
CCGTTGATCATGGATCGCCTCAATTGTCATCACAAACCTATTTGATTGTC
AAGGTAATCAGTGACATTTCCGACAAGAAGCATCATACAAATCCGATTTG
GACTCCAGAAAAGAAGTCACATTGGACTGCAATAATTAGCCTAGTCGTGG
CCACAGCAATTCTCATCTCTTTCCTATTCGGAATACTATGCTTACTGAAA
AGGAAATACTCGCTACAGGAATCCAATTATCGCAAGGGTCAAACGAAACC
GGATTTCAGTCACGTGATTGAACGGCAGGGCGCCTCGGATCCAGGAAAAT
TGACATCTGACGACGAGGAACAGATAACGAATCCAGACTATAGGAATTTA
GGAACTTATGTCGGATTTCCTTCCAATCACTATACCGTTGGATCTCTTAA
TCAGAAATTGAATAATAATTTGGATGTCAGTGGACGGATAGCCATGCAGC
ATTACCCCCAAAAGTACCCCACTCAAATAGACAAGAACAACCTGTATCAA
ACATTGACAATGCAAAGAAATGTCCCATCGAAATTCTTTTCAGTTCAAAA
GAACAACACACTCAGTTCAAGTCAGTTGGAAAAAAATTCAAACGATATTG
TTCCAACGAATGCGACTCAAACCTTTCATTCCTGCTCACAATCAACTCCA
AGTCACGAAGAGCTGGACGACGCCAGCGAAACGATTGCCAATCCGATGGT
GTCGACTTACTGTTCTGTAAGTTTCGTGTGAGATAGATTAAAGTGGAGGC
TCTCAACAGATCTCCGTCAAAGAAAGAGCACAATTATGAATTGAAATTAC
TGATAACATTTGTAAATAAATTTTCGTGTCAATTATTATATGTTATCCCA
CCGTTGTCCCATTAATCCAATGGAATCCTAATGGATATATGTGAGCTCTG
ATAACACTCCTGACGCCTGC
back to top

protein sequence of SMED30033431-orf-1

>SMED30033431-orf-1 ID=SMED30033431-orf-1|Name=SMED30033431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1030bp
MDFRVRTKLLFILLSFQILFKSTIQLKLLFRQTIKEELPSGSLVLQIASP
VEISSFMKTHKSKVVEFSLLDSMDSKYFFCNKQSSEIKTLVKLDRESLCI
DPEVKNCCDPKSPTPDLCILQFQMTAKADNNNVEIIQVLIELEDVNDNSP
SFLNSQDTIYVKENVKLGEIQRFQVSDADSKLFSTKSIEVDGSHVGKEYF
NARLYQDQVKLYLIKHLDRELVDNFKLVITAIDGGSNPNTGTLIVNINIT
DINDNQPKWITENFSVSIKEDVPINHLIIKLLAEDKDVGNNGKVYYEFEN
IRNEEESRLRNFFLLNSLSGEIRVQQKLDYEYLQSPEIRLHVIAKDNGEE
IIHSISTVVFITVIDINDNPPNIQAISLSKDKLFKIKENVQNVQQVASIS
VNDPDTGKGGEVNCEIDNKNFQLLSLDNPLTKGYSLTTHNSIDRETIGSY
IIIIKCNDFGFPSLTSTRVLNIMVEDENDNYPIFHSTLYQFRIPENNVLG
QYIGHVNATDKDIEENGHVIYSLSSNAEAIVSIDSNTGSLTASKEFDRET
SDKYSFTVIARDNGPSHLSSSSLVYLTILDVNDHTPKFELQYFFSIPEDS
NPGKTVGQVEAIDLDIGENAKITYHLQARFSQFGIDPISGKIILRSANID
REKISRYELKVIASDGGHPSFQGETIVNINIEDVNDNPPVFQFPSSKNNE
VNVSCNQMPNHLIAQIRANDSDLSQATDNRITYILLPFPSVNYPHPQSRL
SIYQNLFDIDSHGGQLFLINKFPTCSYSYEIKVHIRAVDHGSPQLSSQTY
LIVKVISDISDKKHHTNPIWTPEKKSHWTAIISLVVATAILISFLFGILC
LLKRKYSLQESNYRKGQTKPDFSHVIERQGASDPGKLTSDDEEQITNPDY
RNLGTYVGFPSNHYTVGSLNQKLNNNLDVSGRIAMQHYPQKYPTQIDKNN
LYQTLTMQRNVPSKFFSVQKNNTLSSSQLEKNSNDIVPTNATQTFHSCSQ
STPSHEELDDASETIANPMVSTYCSVSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000140anterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 482..495
score: 35.75
coord: 536..562
score: 33.04
coord: 570..587
score: 36.37
coord: 259..288
score: 23.37
coord: 76..95
score: 25.1
coord: 463..482
score: 41.15
coord: 449..461
score: 27.62
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 281..371
e-value: 4.6E-17
score: 72.7
coord: 399..482
e-value: 4.4E-11
score: 52.8
coord: 609..689
e-value: 7.0E-29
score: 111.9
coord: 56..150
e-value: 0.46
score: 7.3
coord: 716..814
e-value: 0.084
score: 14.8
coord: 173..257
e-value: 8.6E-13
score: 58.5
coord: 506..586
e-value: 1.1E-26
score: 104.7
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 489..578
e-value: 6.5E-18
score: 65.0
coord: 592..682
e-value: 3.1E-18
score: 66.0
coord: 384..474
e-value: 3.1E-8
score: 34.0
coord: 264..356
e-value: 5.3E-10
score: 39.6
coord: 158..250
e-value: 4.1E-8
score: 33.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 30..145
e-value: 1.1E-11
score: 46.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 371..479
e-value: 1.2E-19
score: 72.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 255..370
e-value: 5.4E-25
score: 90.1
coord: 586..686
e-value: 3.0E-29
score: 103.8
coord: 687..817
e-value: 4.9E-15
score: 57.9
coord: 146..254
e-value: 1.3E-18
score: 69.5
coord: 480..585
e-value: 4.0E-31
score: 109.9
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 541..976
coord: 13..564
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 485..588
score: 27.233
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 153..259
score: 16.184
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 695..820
score: 11.646
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 260..373
score: 22.322
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 26..152
score: 11.449
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 378..484
score: 17.762
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 588..691
score: 25.983
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 700..811
e-value: 1.09173E-9
score: 54.2418
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 384..480
e-value: 1.15355E-15
score: 71.5757
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 264..369
e-value: 2.34515E-22
score: 90.4505
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 158..255
e-value: 7.47626E-15
score: 69.2645
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 489..584
e-value: 1.92466E-31
score: 116.259
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 33..148
e-value: 4.766E-6
score: 44.2266
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 591..687
e-value: 3.22038E-31
score: 115.874
NoneNo IPR availableTMHMMTMhelixcoord: 830..852
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 679..689
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 472..482
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 247..257
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 247..374
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 472..592
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 679..807
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 366..476
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 145..251
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 577..695