SMED30033426

Overview
NameSMED30033426
Smed IDSMED30033426
Length (bp)444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30033426 (SMED30033426) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30033426 (SMED30033426) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30033426 (SMED30033426) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30033426 (SMED30033426) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033426

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033426h1SMcG0000706 dd_Smed_v4_7872_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30033426 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.006690:806..1298 -2203
Homology
BLAST of SMED30033426 vs. Ensembl Human
Match: HEATR5B (HEAT repeat containing 5B [Source:HGNC Symbol;Acc:HGNC:29273])

HSP 1 Score: 181.03 bits (458), Expect = 6.562e-53
Identity = 79/146 (54.11%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDT+++   ++ CND +++KDD+ +YLPT+LAA+A +G  Y K+GRM+G ++ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAALYSIGDTFTVFQTLDKCNDIIRNKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 170.629 bits (431), Expect = 2.856e-49
Identity = 75/146 (51.37%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   ++ND++EKQ+ +++ LL+ L  SPGP TR L+A+NL  L+S+GDT+S+H AI+ CND ++SKDDSPSYLPT+LAA+  LG +Y KLGR++G ++ +TV  ++K++K
Sbjct:    1 MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQLLSLLNSSPGPPTRKLLAKNLAILYSIGDTFSVHEAIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILGNTFTDTVGNILKAMK 146          
BLAST of SMED30033426 vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 135.961 bits (341), Expect = 1.314e-41
Identity = 61/113 (53.98%), Postives = 89/113 (78.76%), Query Frame = -1
Query:  106 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRL 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   ++ND++EKQ+ +++ LL+ L  SPGP TR L+A+NL  L+S+GDT+S+H AI+ CND ++SKDDSPSYLPT+L
Sbjct:    1 MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQLLSLLNSSPGPPTRKLLAKNLAILYSIGDTFSVHEAIDKCNDLIRSKDDSPSYLPTKL 113          
BLAST of SMED30033426 vs. Ensembl Human
Match: HEATR5A (HEAT repeat containing 5A [Source:HGNC Symbol;Acc:HGNC:20276])

HSP 1 Score: 94.3597 bits (233), Expect = 1.166e-25
Identity = 43/87 (49.43%), Postives = 66/87 (75.86%), Query Frame = -1
Query:  184 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYS 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   ++ND++EKQ+ +++ LL+ L  SPGP TR L+A+NL  L+S+GDT+S
Sbjct:    1 MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQLLSLLNSSPGPPTRKLLAKNLAILYSIGDTFS 87          
BLAST of SMED30033426 vs. Ensembl Celegans
Match: soap-1 (Sorting Of Apical Proteins [Source:UniProtKB/TrEMBL;Acc:O01485])

HSP 1 Score: 133.265 bits (334), Expect = 1.143e-36
Identity = 62/142 (43.66%), Postives = 97/142 (68.31%), Query Frame = -1
Query:   22 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSV-GDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVL 444
            M+   +L+LNE AL      KRPVFIYEWLR+LD++L +  + D+K  Q+ + + L ++L    GP TR LIAR +G ++++ GD  SL+  +N+CND +K KD+SP  + ++LAA+A L  +Y  +GRM GRS E+T++++
Sbjct:    1 MDETHSLLLNEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRLHTVVGPPTRKLIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACLSAVYDSMGRMAGRSIEDTLAIV 142          
BLAST of SMED30033426 vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0081817)

HSP 1 Score: 176.022 bits (445), Expect = 1.804e-51
Identity = 82/146 (56.16%), Postives = 109/146 (74.66%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA  LILNE AL +L   KRPVF  EWLR+L+K L + +K +IK  Q+ +++ L  +++ +PGP  R LIA  L TLFSVGDT+ L   +N CND +K+KDDSPSYLPT+LAAI  LG +Y KLGRM+GR+YE+TV +LI++L+
Sbjct:    1 MELAHTLILNEDALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLR 146          
BLAST of SMED30033426 vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335229)

HSP 1 Score: 176.022 bits (445), Expect = 1.823e-51
Identity = 82/146 (56.16%), Postives = 109/146 (74.66%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA  LILNE AL +L   KRPVF  EWLR+L+K L + +K +IK  Q+ +++ L  +++ +PGP  R LIA  L TLFSVGDT+ L   +N CND +K+KDDSPSYLPT+LAAI  LG +Y KLGRM+GR+YE+TV +LI++L+
Sbjct:   49 MELAHTLILNEDALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLR 194          
BLAST of SMED30033426 vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0300916)

HSP 1 Score: 176.022 bits (445), Expect = 1.859e-51
Identity = 82/146 (56.16%), Postives = 109/146 (74.66%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA  LILNE AL +L   KRPVF  EWLR+L+K L + +K +IK  Q+ +++ L  +++ +PGP  R LIA  L TLFSVGDT+ L   +N CND +K+KDDSPSYLPT+LAAI  LG +Y KLGRM+GR+YE+TV +LI++L+
Sbjct:   49 MELAHTLILNEDALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLR 194          
BLAST of SMED30033426 vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0081818)

HSP 1 Score: 176.022 bits (445), Expect = 1.877e-51
Identity = 82/146 (56.16%), Postives = 109/146 (74.66%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA  LILNE AL +L   KRPVF  EWLR+L+K L + +K +IK  Q+ +++ L  +++ +PGP  R LIA  L TLFSVGDT+ L   +N CND +K+KDDSPSYLPT+LAAI  LG +Y KLGRM+GR+YE+TV +LI++L+
Sbjct:   49 MELAHTLILNEDALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLR 194          
BLAST of SMED30033426 vs. Ensembl Fly
Match: CG2747 (gene:FBgn0037541 transcript:FBtr0335230)

HSP 1 Score: 176.022 bits (445), Expect = 1.914e-51
Identity = 82/146 (56.16%), Postives = 109/146 (74.66%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA  LILNE AL +L   KRPVF  EWLR+L+K L + +K +IK  Q+ +++ L  +++ +PGP  R LIA  L TLFSVGDT+ L   +N CND +K+KDDSPSYLPT+LAAI  LG +Y KLGRM+GR+YE+TV +LI++L+
Sbjct:   49 MELAHTLILNEDALKQLPEHKRPVFELEWLRYLEKALPLVSKAEIKASQKKLVQQLSERIQGAPGPPIRKLIASALATLFSVGDTFMLFDTVNACNDILKNKDDSPSYLPTKLAAICVLGSMYEKLGRMMGRTYEDTVQILIRTLR 194          
BLAST of SMED30033426 vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 171.785 bits (434), Expect = 5.634e-50
Identity = 77/146 (52.74%), Postives = 112/146 (76.71%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL  ++  KR VFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDT+++   ++ CND +KSKDD+ +YLP++LAA+A +G  Y ++GRM+G S+ ET++ L+K+LK
Sbjct:    1 MELAHSLLLNEEALSHITEAKRAVFIFEWLRFLDKVLIAANKVDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAVLYSIGDTFTVFQTLDKCNDIIKSKDDTAAYLPSKLAAVACVGAFYERMGRMLGSSFPETINNLLKALK 146          
BLAST of SMED30033426 vs. Ensembl Zebrafish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 171.014 bits (432), Expect = 1.175e-49
Identity = 77/146 (52.74%), Postives = 112/146 (76.71%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL  ++  KR VFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDT+++   ++ CND +KSKDD+ +YLP++LAA+A +G  Y ++GRM+G S+ ET++ L+K+LK
Sbjct:    1 MELAHSLLLNEEALSHITEAKRAVFIFEWLRFLDKVLIAANKVDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAVLYSIGDTFTVFQTLDKCNDIIKSKDDTAAYLPSKLAAVACVGAFYERMGRMLGSSFPETINNLLKALK 146          
BLAST of SMED30033426 vs. Ensembl Zebrafish
Match: BX465838.3 (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 147.902 bits (372), Expect = 1.488e-41
Identity = 67/146 (45.89%), Postives = 105/146 (71.92%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            ME A +L+LNE A  +L   +R  F++EWLRFL K+L   ++ D+K+KQ+ +++ L   L  SPGP TR L+A+ L  ++ VGD+ +  L ++ CND ++SKDDSPS+LPTRLAA+A LG +Y +LGR++  S++ET + L+K+++
Sbjct:    1 MEQAHSLLLNEEACSQLPEHQRAEFVFEWLRFLKKLLPATDRADVKQKQKRLVEQLTTVLTSSPGPPTRLLLAQCLALVYRVGDSLTSSLTVDRCNDIIRSKDDSPSFLPTRLAAVACLGALYEQLGRLLINSFKETTTNLLKAMR 146          
BLAST of SMED30033426 vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 147.902 bits (372), Expect = 1.562e-41
Identity = 67/146 (45.89%), Postives = 105/146 (71.92%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            ME A +L+LNE A  +L   +R  F++EWLRFL K+L   ++ D+K+KQ+ +++ L   L  SPGP TR L+A+ L  ++ VGD+ +  L ++ CND ++SKDDSPS+LPTRLAA+A LG +Y +LGR++  S++ET + L+K+++
Sbjct:    1 MEQAHSLLLNEEACSQLPEHQRAEFVFEWLRFLKKLLPATDRADVKQKQKRLVEQLTTVLTSSPGPPTRLLLAQCLALVYRVGDSLTSSLTVDRCNDIIRSKDDSPSFLPTRLAAVACLGALYEQLGRLLINSFKETTTNLLKAMR 146          
BLAST of SMED30033426 vs. Ensembl Zebrafish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 147.902 bits (372), Expect = 1.576e-41
Identity = 67/146 (45.89%), Postives = 105/146 (71.92%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            ME A +L+LNE A  +L   +R  F++EWLRFL K+L   ++ D+K+KQ+ +++ L   L  SPGP TR L+A+ L  ++ VGD+ +  L ++ CND ++SKDDSPS+LPTRLAA+A LG +Y +LGR++  S++ET + L+K+++
Sbjct:    1 MEQAHSLLLNEEACSQLPEHQRAEFVFEWLRFLKKLLPATDRADVKQKQKRLVEQLTTVLTSSPGPPTRLLLAQCLALVYRVGDSLTSSLTVDRCNDIIRSKDDSPSFLPTRLAAVACLGALYEQLGRLLINSFKETTTNLLKAMR 146          
BLAST of SMED30033426 vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 177.563 bits (449), Expect = 9.573e-52
Identity = 79/146 (54.11%), Postives = 113/146 (77.40%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL  ANK DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKTDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 177.178 bits (448), Expect = 1.107e-51
Identity = 79/146 (54.11%), Postives = 113/146 (77.40%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL  ANK DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKTDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 177.178 bits (448), Expect = 1.186e-51
Identity = 79/146 (54.11%), Postives = 113/146 (77.40%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL  ANK DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKTDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 168.703 bits (426), Expect = 1.149e-48
Identity = 79/157 (50.32%), Postives = 113/157 (71.97%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANK-----------NDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL  ANK            DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKVYFNLLKFKSQTDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 157          
BLAST of SMED30033426 vs. Ensembl Xenopus
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:100036680])

HSP 1 Score: 166.392 bits (420), Expect = 7.750e-48
Identity = 76/146 (52.05%), Postives = 110/146 (75.34%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL      DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIA---TDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 143          
BLAST of SMED30033426 vs. Ensembl Mouse
Match: Heatr5b (HEAT repeat containing 5B [Source:MGI Symbol;Acc:MGI:2444098])

HSP 1 Score: 183.726 bits (465), Expect = 4.997e-54
Identity = 81/146 (55.48%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDTY++   ++ CND ++SKDD+ +YLPT+LAA+A +G  Y K+GRM+G ++ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAALYSIGDTYTVFQTLDKCNDIIRSKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. Ensembl Mouse
Match: Heatr5a (HEAT repeat containing 5A [Source:MGI Symbol;Acc:MGI:2444133])

HSP 1 Score: 157.532 bits (397), Expect = 6.406e-45
Identity = 72/146 (49.32%), Postives = 108/146 (73.97%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   N+ D++EKQ+ ++  LL+ L  SPGP TR L+A++L  L+SVGDT S++  I+ CND ++SKDDSPSYLPT+LAA+  LG +Y KLGR++   + +TV  ++K++K
Sbjct:    1 MELAHSLLLNEEASNQLGAVQKAEFIFEWLRYLEKLLLATNREDVREKQKTLVGQLLSLLNSSPGPPTRKLLAQDLAILYSVGDTVSVYETIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILANGFTDTVVNILKAMK 146          
BLAST of SMED30033426 vs. UniProt/SwissProt
Match: sp|Q8C547|HTR5B_MOUSE (HEAT repeat-containing protein 5B OS=Mus musculus OX=10090 GN=Heatr5b PE=1 SV=3)

HSP 1 Score: 183.726 bits (465), Expect = 3.495e-53
Identity = 81/146 (55.48%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDTY++   ++ CND ++SKDD+ +YLPT+LAA+A +G  Y K+GRM+G ++ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAALYSIGDTYTVFQTLDKCNDIIRSKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. UniProt/SwissProt
Match: sp|Q9P2D3|HTR5B_HUMAN (HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 3.151e-52
Identity = 79/146 (54.11%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  SPGP TR L+A+NL  L+S+GDT+++   ++ CND +++KDD+ +YLPT+LAA+A +G  Y K+GRM+G ++ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLNEEALAQITEAKRPVFIFEWLRFLDKVLVAANKTDVKEKQKKLVEQLTGLISSSPGPPTRKLLAKNLAALYSIGDTFTVFQTLDKCNDIIRNKDDTAAYLPTKLAAVACVGAFYEKMGRMLGSAFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. UniProt/SwissProt
Match: sp|A1A5F2|HTR5B_XENTR (HEAT repeat-containing protein 5B OS=Xenopus tropicalis OX=8364 GN=heatr5b PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.284e-51
Identity = 79/146 (54.11%), Postives = 113/146 (77.40%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+L E AL +++  K+ VFI+EWLRFLDKVL  ANK DIKE Q+ +++ L   +  SPGP TR L+A+NL TL+S+GDT+++   ++ CN+ +K+KDD+P+YLPT+LAA+A +G  Y K+GRM+G S+ ETV+ L+KSLK
Sbjct:    1 MELAHSLLLKEDALAQITEAKKSVFIFEWLRFLDKVLIAANKTDIKENQKKLVEQLTGLISSSPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEMIKNKDDTPAYLPTKLAAVACVGAFYEKMGRMLGSSFPETVNNLLKSLK 146          
BLAST of SMED30033426 vs. UniProt/SwissProt
Match: sp|Q86XA9|HTR5A_HUMAN (HEAT repeat-containing protein 5A OS=Homo sapiens OX=9606 GN=HEATR5A PE=1 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 1.440e-48
Identity = 75/146 (51.37%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   ++ND++EKQ+ +++ LL+ L  SPGP TR L+A+NL  L+S+GDT+S+H AI+ CND ++SKDDSPSYLPT+LAA+  LG +Y KLGR++G ++ +TV  ++K++K
Sbjct:    1 MELAHSLLLNEEAYNQLGEVQKAEFIFEWLRYLEKLLLATSRNDVREKQKTLVEQLLSLLNSSPGPPTRKLLAKNLAILYSIGDTFSVHEAIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILGNTFTDTVGNILKAMK 146          
BLAST of SMED30033426 vs. UniProt/SwissProt
Match: sp|Q5PRF0|HTR5A_MOUSE (HEAT repeat-containing protein 5A OS=Mus musculus OX=10090 GN=Heatr5a PE=1 SV=2)

HSP 1 Score: 157.532 bits (397), Expect = 4.481e-44
Identity = 72/146 (49.32%), Postives = 108/146 (73.97%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE A  +L   ++  FI+EWLR+L+K+L   N+ D++EKQ+ ++  LL+ L  SPGP TR L+A++L  L+SVGDT S++  I+ CND ++SKDDSPSYLPT+LAA+  LG +Y KLGR++   + +TV  ++K++K
Sbjct:    1 MELAHSLLLNEEASNQLGAVQKAEFIFEWLRYLEKLLLATNREDVREKQKTLVGQLLSLLNSSPGPPTRKLLAQDLAILYSVGDTVSVYETIDKCNDLIRSKDDSPSYLPTKLAAVVCLGSLYKKLGRILANGFTDTVVNILKAMK 146          
BLAST of SMED30033426 vs. TrEMBL
Match: A0A0L8FI91 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22019109mg PE=4 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 3.771e-65
Identity = 94/146 (64.38%), Postives = 117/146 (80.14%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE A  K+   KRPVF++EWLRFLDKVL  A K+DIKE Q+ +++ L NQ+ +SPGP TR LIAR L TLFSVGDT+ L   IN CND +K+KDDSPSYLPTRL+A+A +G +Y KLGRMVGRSYE+T+ +LIKSL+
Sbjct:    7 MELAHSLLLNEEAFKKIQESKRPVFVFEWLRFLDKVLGAAQKSDIKESQKKLVEQLTNQISESPGPPTRKLIARCLATLFSVGDTFDLFETINKCNDIIKNKDDSPSYLPTRLSAVACIGAMYEKLGRMVGRSYEDTIQILIKSLR 152          
BLAST of SMED30033426 vs. TrEMBL
Match: V5I7R8 (HEAT repeat-containing protein 5B (Fragment) OS=Anoplophora glabripennis OX=217634 GN=HTR5B PE=4 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 5.529e-62
Identity = 90/146 (61.64%), Postives = 117/146 (80.14%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MEL+ +L LNE AL ++   KRPVFI+EWLR++DKVL  A KNDIK  Q+ +++ L+N++++SPGP TR LIAR L TLFSVGDT+ L   +N CND +K+KDDSPS+LPTRLAAI  +G +Y KLGRM+GRSYEETV +LI+SL+
Sbjct:    1 MELSHSLTLNEEALSQIGEAKRPVFIFEWLRYVDKVLVAAQKNDIKGCQKQLVQQLMNRIQESPGPPTRKLIARCLATLFSVGDTFLLFDTVNKCNDILKNKDDSPSFLPTRLAAICCVGTMYEKLGRMMGRSYEETVHILIRSLR 146          
BLAST of SMED30033426 vs. TrEMBL
Match: A0A0T6B9F0 (HEAT domain-containing protein (Fragment) OS=Oryctes borbonicus OX=1629725 GN=AMK59_1537 PE=4 SV=1)

HSP 1 Score: 200.29 bits (508), Expect = 9.743e-62
Identity = 93/146 (63.70%), Postives = 116/146 (79.45%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MEL+ +L LNE AL ++   KRPVFI+EWLRFLDKVL  A KNDIK  Q+ +++ L+N +++SPGP TR LIAR L TLFSVGDT+ L   +N CND +K+KDDSPS+LPTRLAAI  +G +Y KLGRM+GRSYEETV +LI+SLK
Sbjct:   16 MELSHSLTLNEEALAQIPPPKRPVFIFEWLRFLDKVLVAAQKNDIKGCQKKLVEQLMNHIQESPGPPTRKLIARCLATLFSVGDTFLLFDTVNKCNDILKNKDDSPSFLPTRLAAICCVGTMYEKLGRMMGRSYEETVQILIRSLK 161          
BLAST of SMED30033426 vs. TrEMBL
Match: A0A210PI49 (HEAT repeat-containing protein 5B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10005 PE=4 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.665e-60
Identity = 98/146 (67.12%), Postives = 119/146 (81.51%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL K+  +KRPVF++EWLRFLDKVL  A K+DIKEKQ+ +++ L NQ+ +SPGP +R L+ARNL  LFSVGDT+ L   IN CND +K+KDDSPSYLPTRLAAIA LG +Y KLGRM GRSYE+TV +LIKSLK
Sbjct:   12 MELAHSLLLNEEALKKIPENKRPVFVFEWLRFLDKVLIAAQKSDIKEKQKKLVEQLTNQISESPGPPSRKLLARNLAILFSVGDTFELFNTINKCNDIIKNKDDSPSYLPTRLAAIACLGAMYEKLGRMTGRSYEDTVQILIKSLK 157          
BLAST of SMED30033426 vs. TrEMBL
Match: K1PBL7 (HEAT repeat-containing protein 5B OS=Crassostrea gigas OX=29159 GN=CGI_10010720 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 8.403e-60
Identity = 96/146 (65.75%), Postives = 120/146 (82.19%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL K+ ++K+PVF++EWLRFLDKVL  A K+DIKEKQ+ ++  L +Q+ +SPGP TR L+ARNL T+FSVGDT+ L   +N CND +K++DDSPSYLPTRLAAIA LG +Y KLGRM GRSYEETV +LIKSLK
Sbjct:    1 MELAHSLLLNEEALSKIPDNKKPVFVFEWLRFLDKVLVAAQKSDIKEKQKQLVAQLTSQISESPGPPTRKLLARNLATIFSVGDTFDLFETLNKCNDIIKNRDDSPSYLPTRLAAIACLGAMYEKLGRMTGRSYEETVQILIKSLK 146          
BLAST of SMED30033426 vs. Ensembl Cavefish
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 181.03 bits (458), Expect = 3.338e-53
Identity = 78/146 (53.42%), Postives = 116/146 (79.45%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFL+KVL  ANK D+KEKQ+ +++ L   +  +PGP TR L+A+NL TL+S+GDT+++   ++ CND +K+KDD+P+YLPT+LAA+A +G  Y ++GRM+G S+ ET++ L+K+LK
Sbjct:    1 MELAHSLLLNEDALAQITEAKRPVFIFEWLRFLNKVLVAANKVDVKEKQKKLVEQLTGLISSNPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNDIIKNKDDTPAYLPTKLAAVACVGAFYERMGRMLGSSFPETINNLLKALK 146          
BLAST of SMED30033426 vs. Ensembl Cavefish
Match: heatr5a (HEAT repeat containing 5a [Source:NCBI gene;Acc:368728])

HSP 1 Score: 154.066 bits (388), Expect = 7.720e-44
Identity = 73/146 (50.00%), Postives = 107/146 (73.29%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            ME A +L+LNE A  +L   +R  FI+EWLRFL K+L  A++ D+++ Q+ + + L   L  SPGPSTR L+A+ L  L+ VGDT++  L ++ CND ++SKDDSPS+LPTRLAA+A LG +Y +LGR++  S++ETV+ L+K+LK
Sbjct:    1 MEQAHSLLLNEDACGRLGEHQRAEFIFEWLRFLKKLLPAADRADVRKNQKQLAEQLTAILTGSPGPSTRWLLAQCLALLYRVGDTFTSSLTVDRCNDIIRSKDDSPSFLPTRLAAVACLGAMYEQLGRLLISSFKETVANLLKALK 146          
BLAST of SMED30033426 vs. Ensembl Sea Lamprey
Match: heatr5b (HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GENE-130530-676])

HSP 1 Score: 174.866 bits (442), Expect = 8.929e-52
Identity = 75/146 (51.37%), Postives = 114/146 (78.08%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL ++++ K+P+F++EWLRFLD  L  ANK D ++ Q  +++ L N + ++PGP TR LIA++L TL+S+GDT+S+   I+ CN+ ++SKDDSPSYLPT+L+A+A +G +Y KLGRM+G S+ +T+  LIK++K
Sbjct:    1 MELAHSLLLNEEALAQVTDAKKPIFVFEWLRFLDIYLATANKIDTRQNQNRLVEQLTNLMSEAPGPPTRRLIAKSLSTLYSIGDTFSVFQTIDKCNEIIRSKDDSPSYLPTKLSAVACIGALYEKLGRMLGSSFPDTIGNLIKAVK 146          
BLAST of SMED30033426 vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 183.726 bits (465), Expect = 3.610e-54
Identity = 80/146 (54.79%), Postives = 116/146 (79.45%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  +PGP TR L+A+NL TL+S+GDT+++   ++ CN+ +KSKDD+P+YLPT+LAA+A LG  Y K+GRM+G S+ +T++ L+K+LK
Sbjct:    1 MELAHSLLLNEDALAQITEAKRPVFIFEWLRFLDKVLVAANKVDVKEKQKKLVEQLTGLISSAPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEIIKSKDDTPTYLPTKLAAVACLGAFYEKMGRMLGSSFPDTINNLLKALK 146          
BLAST of SMED30033426 vs. Ensembl Medaka
Match: heatr5b (HEAT repeat containing 5B [Source:NCBI gene;Acc:101168395])

HSP 1 Score: 183.341 bits (464), Expect = 4.427e-54
Identity = 80/146 (54.79%), Postives = 116/146 (79.45%), Query Frame = -1
Query:    7 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLK 444
            MELA +L+LNE AL +++  KRPVFI+EWLRFLDKVL  ANK D+KEKQ+ +++ L   +  +PGP TR L+A+NL TL+S+GDT+++   ++ CN+ +KSKDD+P+YLPT+LAA+A LG  Y K+GRM+G S+ +T++ L+K+LK
Sbjct:   64 MELAHSLLLNEDALAQITEAKRPVFIFEWLRFLDKVLVAANKVDVKEKQKKLVEQLTGLISSAPGPPTRKLLAKNLATLYSIGDTFTVFQTLDKCNEIIKSKDDTPTYLPTKLAAVACLGAFYEKMGRMLGSSFPDTINNLLKALK 209          
BLAST of SMED30033426 vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 303.523 bits (776), Expect = 3.329e-96
Identity = 147/147 (100.00%), Postives = 147/147 (100.00%), Query Frame = -1
Query:    4 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ 444
            MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ
Sbjct:    1 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ 147          
BLAST of SMED30033426 vs. Planmine SMEST
Match: SMESG000028228.1 (SMESG000028228.1)

HSP 1 Score: 303.523 bits (776), Expect = 3.330e-96
Identity = 147/147 (100.00%), Postives = 147/147 (100.00%), Query Frame = -1
Query:    4 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ 444
            MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ
Sbjct:    1 MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQEHILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVKSKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQ 147          
The following BLAST results are available for this feature:
BLAST of SMED30033426 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
HEATR5B6.562e-5354.11HEAT repeat containing 5B [Source:HGNC Symbol;Acc:... [more]
HEATR5A2.856e-4951.37HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A1.314e-4153.98HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
HEATR5A1.166e-2549.43HEAT repeat containing 5A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
soap-11.143e-3643.66Sorting Of Apical Proteins [Source:UniProtKB/TrEM... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG27471.804e-5156.16gene:FBgn0037541 transcript:FBtr0081817[more]
CG27471.823e-5156.16gene:FBgn0037541 transcript:FBtr0335229[more]
CG27471.859e-5156.16gene:FBgn0037541 transcript:FBtr0300916[more]
CG27471.877e-5156.16gene:FBgn0037541 transcript:FBtr0081818[more]
CG27471.914e-5156.16gene:FBgn0037541 transcript:FBtr0335230[more]
back to top
BLAST of SMED30033426 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b5.634e-5052.74HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5b1.175e-4952.74HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
BX465838.31.488e-4145.89HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
heatr5a1.562e-4145.89HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
heatr5a1.576e-4145.89HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
heatr5b9.573e-5254.11HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.107e-5154.11HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.186e-5154.11HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b1.149e-4850.32HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b7.750e-4852.05HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Heatr5b4.997e-5455.48HEAT repeat containing 5B [Source:MGI Symbol;Acc:M... [more]
Heatr5a6.406e-4549.32HEAT repeat containing 5A [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of SMED30033426 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8C547|HTR5B_MOUSE3.495e-5355.48HEAT repeat-containing protein 5B OS=Mus musculus ... [more]
sp|Q9P2D3|HTR5B_HUMAN3.151e-5254.11HEAT repeat-containing protein 5B OS=Homo sapiens ... [more]
sp|A1A5F2|HTR5B_XENTR6.284e-5154.11HEAT repeat-containing protein 5B OS=Xenopus tropi... [more]
sp|Q86XA9|HTR5A_HUMAN1.440e-4851.37HEAT repeat-containing protein 5A OS=Homo sapiens ... [more]
sp|Q5PRF0|HTR5A_MOUSE4.481e-4449.32HEAT repeat-containing protein 5A OS=Mus musculus ... [more]
back to top
BLAST of SMED30033426 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8FI913.771e-6564.38Uncharacterized protein OS=Octopus bimaculoides OX... [more]
V5I7R85.529e-6261.64HEAT repeat-containing protein 5B (Fragment) OS=An... [more]
A0A0T6B9F09.743e-6263.70HEAT domain-containing protein (Fragment) OS=Oryct... [more]
A0A210PI496.665e-6067.12HEAT repeat-containing protein 5B OS=Mizuhopecten ... [more]
K1PBL78.403e-6065.75HEAT repeat-containing protein 5B OS=Crassostrea g... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b3.338e-5353.42HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
heatr5a7.720e-4450.00HEAT repeat containing 5a [Source:NCBI gene;Acc:36... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
heatr5b8.929e-5251.37HEAT repeat containing 5B [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of SMED30033426 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033426 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30033426 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
heatr5b3.610e-5454.79HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
heatr5b4.427e-5454.79HEAT repeat containing 5B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30033426 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028228.13.329e-96100.00SMESG000028228.1[more]
SMESG000028228.13.330e-96100.00SMESG000028228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033426 ID=SMED30033426|Name=SMED30033426|organism=Schmidtea mediterranea sexual|type=transcript|length=444bp
AACCTGTTTAAGTGACTTAATTAATACAGAAACAGTTTCTTCATATGACC
GGCCAACCATTCGTCCTAACTTGTGATAGATTTCTCCTAAAGCTGCTATT
GCAGCTAGCCTTGTTGGTAAATAACTTGGACTATCATCTTTAGATTTAAC
ATAATCATTACAAGTATTTATGGCCAAATGTAGTGAATAAGTATCTCCAA
CGCTGAAAAGAGTTCCAAGGTTTCGAGCTATTAATGTTCTTGTGCTTGGA
CCTGGAGACTTTTCAAGTTGATTTAGTAATATTTTTAAAATGTGTTCCTG
TTTTTCTTTAATGTCATTTTTGTTGGCTACATGTAGAACTTTATCGAGAA
ATCGTAGCCATTCATAAATGAAAACTGGGCGCTTATCATTTGAAAGTTTT
AATAATGCACTTTCATTCAATATCAAGTTTTGCGCTAATTCCAT
back to top

protein sequence of SMED30033426-orf-1

>SMED30033426-orf-1 ID=SMED30033426-orf-1|Name=SMED30033426-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MELAQNLILNESALLKLSNDKRPVFIYEWLRFLDKVLHVANKNDIKEKQE
HILKILLNQLEKSPGPSTRTLIARNLGTLFSVGDTYSLHLAINTCNDYVK
SKDDSPSYLPTRLAAIAALGEIYHKLGRMVGRSYEETVSVLIKSLKQV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR040108Laa1/Sip1/HEATR5
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR21663:SF1HEAT REPEAT-CONTAINING PROTEIN 5Acoord: 1..147
IPR040108Laa1/Sip1/HEATR5PANTHERPTHR21663HYPOTHETICAL HEAT DOMAIN-CONTAININGcoord: 1..147
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 14..145