Cytospin-A

Overview
NameCytospin-A
Smed IDSMED30033424
Length (bp)1368
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytospin-A (SMED30033424) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytospin-A (SMED30033424) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytospin-A (SMED30033424) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytospin-A (SMED30033424) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033424

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033424SMESG000025457.1 dd_Smed_v4_2554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033424SMESG000025457.1 dd_Smed_v4_2554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033424SMESG000025457.1 dd_Smed_v4_2554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30033424SMESG000025457.1 dd_Smed_v4_2554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033424SMESG000025457.1 dd_Smed_v4_2554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033424SMESG000025457.1 Contig39689uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033424SMESG000025457.1 Contig39689newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynx musculatureSMED30033424SMESG000025457.1 dd_Smed_v6_2554_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30033424SMESG000025457.1 dd_Smed_v6_2554_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 144.436 bits (363), Expect = 5.816e-39
Identity = 58/105 (55.24%), Postives = 81/105 (77.14%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE  AD   LLD +DM+ +++ PDWKCV+ YIQ FY+
Sbjct:  195 NSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLRE-PDWKCVYTYIQEFYR 298          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 149.828 bits (377), Expect = 2.839e-38
Identity = 59/111 (53.15%), Postives = 81/111 (72.97%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE L D  PL++V DM++M  +PD KCVF Y+Q  Y   R  E+
Sbjct:  800 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL 910          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 149.828 bits (377), Expect = 3.431e-38
Identity = 59/111 (53.15%), Postives = 81/111 (72.97%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE L D  PL++V DM++M  +PD KCVF Y+Q  Y   R  E+
Sbjct:  885 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL 995          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTNL2 (smoothelin like 2 [Source:HGNC Symbol;Acc:HGNC:24764])

HSP 1 Score: 140.969 bits (354), Expect = 1.572e-37
Identity = 62/117 (52.99%), Postives = 83/117 (70.94%), Query Frame = 3
Query:  879 GLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            G+A S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R KN  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  202 GVA-SASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 317          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 143.665 bits (361), Expect = 1.674e-37
Identity = 96/307 (31.27%), Postives = 153/307 (49.84%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            E +L +M+ +++D   RK IRA  +ELR          Q++R+  G+ +   KT +  +  +KM  +   ++QA    G+        A  E+ + EK  +L +   + K+  + + +  +E          +LEKE             +  +P  P     +             S +   PN                 +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE  AD   LLD +DM+ +++ PDWKCV+ YIQ FY+
Sbjct:  188 EGVLDKMLDQSTDFEERKLIRAALRELR----------QRKRDGSGSTMMQTKTFSSSSSSKKMGSIFDREDQASPRAGSL-------AALEKRQAEKKKELMKAQSLPKTSASQARKAMIE----------KLEKE------------GAAGSPGGPRAAVQR-------------STSFGVPN----------------ANSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLRE-PDWKCVYTYIQEFYR 425          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5294501:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 150.984 bits (380), Expect = 8.609e-43
Identity = 76/156 (48.72%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  756 SKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            S+P +  P    N+FK+M+K  S TT             A     +P+SIK  LL W   +   YP V + +FS SWA+GMAFCALIH F P +FDF++L P  R  N  LAF+ AE    I PLL+V DM+MM DRPDWKCVF Y+Q FYK+FRD
Sbjct:   81 SEPKMSRP----NMFKQMEKVESNTTTT-----------APPRQLNPNSIKDALLRWIQNRVAGYPNVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAED-NGIFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRD 220          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5294620:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 150.984 bits (380), Expect = 8.609e-43
Identity = 76/156 (48.72%), Postives = 95/156 (60.90%), Query Frame = 3
Query:  756 SKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            S+P +  P    N+FK+M+K  S TT             A     +P+SIK  LL W   +   YP V + +FS SWA+GMAFCALIH F P +FDF++L P  R  N  LAF+ AE    I PLL+V DM+MM DRPDWKCVF Y+Q FYK+FRD
Sbjct:   81 SEPKMSRP----NMFKQMEKVESNTTTT-----------APPRQLNPNSIKDALLRWIQNRVAGYPNVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAED-NGIFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRD 220          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5288180:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 150.984 bits (380), Expect = 1.299e-40
Identity = 73/144 (50.69%), Postives = 90/144 (62.50%), Query Frame = 3
Query:  792 NVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            N+FK+M+K  S TT             A     +P+SIK  LL W   +   YP V + +FS SWA+GMAFCALIH F P +FDF++L P  R  N  LAF+ AE    I PLL+V DM+MM DRPDWKCVF Y+Q FYK+FRD
Sbjct:  299 NMFKQMEKVESNTTTT-----------APPRQLNPNSIKDALLRWIQNRVAGYPNVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAEDNG-IFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRD 430          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 105.916 bits (263), Expect = 5.983e-24
Identity = 48/104 (46.15%), Postives = 64/104 (61.54%), Query Frame = 3
Query:  906 KQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRF 1217
            K  LL WC R+T  YP V I++F+ SW NG+AF ALIH   P+  DFN+L P E   NL  AF+ AEK  +I+ LLD +D+ +   RPD K +  Y+  +Y  F
Sbjct:   91 KDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVT--RPDEKSIITYVSLYYHHF 192          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 105.916 bits (263), Expect = 6.459e-24
Identity = 48/104 (46.15%), Postives = 64/104 (61.54%), Query Frame = 3
Query:  906 KQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRF 1217
            K  LL WC R+T  YP V I++F+ SW NG+AF ALIH   P+  DFN+L P E   NL  AF+ AEK  +I+ LLD +D+ +   RPD K +  Y+  +Y  F
Sbjct:  277 KDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVT--RPDEKSIITYVSLYYHHF 378          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0308093)

HSP 1 Score: 141.354 bits (355), Expect = 2.981e-39
Identity = 58/111 (52.25%), Postives = 81/111 (72.97%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            +++K  LL+WC  +T++Y  V+I +FS SW++G+AFCALIHHF P+AFD+  L    R  N  LAF  A++ A I+PLLDV+DM+ M  RPDWKCVF Y+Q  Y+RFR+ +
Sbjct:  102 ATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMS-RPDWKCVFVYVQSIYRRFRNCQ 211          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0345070)

HSP 1 Score: 148.673 bits (374), Expect = 4.694e-38
Identity = 58/109 (53.21%), Postives = 80/109 (73.39%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            +++K  LL+WC  +T++Y  V+I +FS SW++G+AFCALIHHF P+AFD+  L    R  N  LAF  A++ A I+PLLDV+DM+ M  RPDWKCVF Y+Q  Y+RFR+
Sbjct: 3103 ATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEM-SRPDWKCVFVYVQSIYRRFRN 3210          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0303205)

HSP 1 Score: 148.673 bits (374), Expect = 4.894e-38
Identity = 58/109 (53.21%), Postives = 80/109 (73.39%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            +++K  LL+WC  +T++Y  V+I +FS SW++G+AFCALIHHF P+AFD+  L    R  N  LAF  A++ A I+PLLDV+DM+ M  RPDWKCVF Y+Q  Y+RFR+
Sbjct: 3220 ATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEM-SRPDWKCVFVYVQSIYRRFRN 3327          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0336674)

HSP 1 Score: 148.673 bits (374), Expect = 5.558e-38
Identity = 58/109 (53.21%), Postives = 80/109 (73.39%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            +++K  LL+WC  +T++Y  V+I +FS SW++G+AFCALIHHF P+AFD+  L    R  N  LAF  A++ A I+PLLDV+DM+ M  RPDWKCVF Y+Q  Y+RFR+
Sbjct: 3389 ATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEM-SRPDWKCVFVYVQSIYRRFRN 3496          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0112704)

HSP 1 Score: 148.288 bits (373), Expect = 6.135e-38
Identity = 58/109 (53.21%), Postives = 80/109 (73.39%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            +++K  LL+WC  +T++Y  V+I +FS SW++G+AFCALIHHF P+AFD+  L    R  N  LAF  A++ A I+PLLDV+DM+ M  RPDWKCVF Y+Q  Y+RFR+
Sbjct: 3274 ATVKDQLLQWCKHKTQEYENVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEM-SRPDWKCVFVYVQSIYRRFRN 3381          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 152.525 bits (384), Expect = 6.986e-42
Identity = 64/119 (53.78%), Postives = 88/119 (73.95%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD++ L P  R +N   AF TAE+LAD   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  204 NRVQRSTSFGVPNANSIKQMLLDWCRSKTRSYENVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMRE-PDWKCVYTYLQEFYR 321          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 151.754 bits (382), Expect = 9.783e-42
Identity = 64/119 (53.78%), Postives = 88/119 (73.95%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD++ L P  R +N   AF TAE+LAD   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  195 NRVQRSTSFGVPNANSIKQMLLDWCRSKTRSYENVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMRE-PDWKCVYTYLQEFYR 312          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 153.68 bits (387), Expect = 1.170e-41
Identity = 69/133 (51.88%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  843 NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
            NF+  R  VG  G A    SIKQ +L WC  +T+ Y GV I +FS SW++G+AFCAL+H FFP AFDF+ LK  ER KN TLAF TAE LAD  PLL+V DML+M   PD  CVF Y+Q        +E  ++
Sbjct:  208 NFKVQRTSVGIAGGA----SIKQRILNWCKSKTQKYEGVSIDNFSSSWSDGLAFCALVHRFFPSAFDFSTLKASEREKNFTLAFSTAETLADCCPLLEVSDMLLMGKNPDPLCVFTYVQALCHHLSKIEKERR 336          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 150.984 bits (380), Expect = 4.576e-41
Identity = 64/119 (53.78%), Postives = 88/119 (73.95%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD++ L P  R +N   AF TAE+LAD   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  225 NRVQRSTSFGVPNANSIKQMLLDWCRSKTRSYENVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMRE-PDWKCVYTYLQEFYR 342          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtna (smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245])

HSP 1 Score: 140.969 bits (354), Expect = 4.567e-39
Identity = 61/120 (50.83%), Postives = 86/120 (71.67%), Query Frame = 3
Query:  858 RVQVGADGLARSPSS--IKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            RV++        P++  +KQ+LL+WC  +T+ Y GV I++FS SWA+G+AFCAL+H FFPE F++  L P +R  N   AF+TAE+LAD  PLLDV D++ M++ PDWKCV+ YIQ FY+
Sbjct:   64 RVKMSGGSAVGGPNTKDVKQMLLDWCRVKTEPYEGVNIQNFSSSWADGLAFCALVHRFFPEGFEYCTLNPYDRKSNFEKAFKTAERLADCPPLLDVDDLMRMRE-PDWKCVYTYIQEFYR 182          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 154.836 bits (390), Expect = 6.424e-42
Identity = 113/334 (33.83%), Postives = 174/334 (52.10%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQK-----------ERAELEKAAQLRQYDE----MAKSGGAASYQG----------GLESVNQLE-LKHKQLEKER-LMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            E++L +M+ K +D   RK IRA  ++LR+    Q   R+K+RE     L     +N + + +  +  +    Q++ T   ++ S   K Q+               LE +   R  +       KS  +A+ +           GL   N +  ++ +Q E+++ LMK         ++  P  P  Q  +KAM   ++M+K S  +++ P F        A     + +SIKQ+LL+WC  +T+ Y  V I++FS SW++GMAFCAL+H+FFPEAFD+NQL P  R KN  LAF  AEK AD   LLD +DM+ M++ PDWKCV+ YIQ FY+
Sbjct:   77 EEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQ---REKEREQRLQEL-----KNKERESKLARSTETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTKSSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMK---------AQSLPKTPATQA-RKAM--IEKMEKESGGSSS-PAFAKVATPRSAAFGVPNANSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMRE-PDWKCVYTYIQEFYR 388          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 159.458 bits (402), Expect = 1.459e-41
Identity = 113/356 (31.74%), Postives = 175/356 (49.16%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASS---SDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQG-----------------------------------GLESVNQLE-LKHKQLE-KERLMKQFDDMQKNYSKLAPSKPTVQTPKKAM--NVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            E++L +M+ K +D   RK IRA  ++LR+    Q   R+K+RE                  ++++++K  + ++K+     +S   S+        + + K  +L Q ++ +K+    + +                                    GL   N +  ++ +Q E K+ LMK         ++  P  P  Q  +KAM   + KE   +SSP  AK        +  A G+  + +SIKQ+LL+WC  +T+ Y  V I++FS SW++GMAFCAL+H+FFPEAFD+NQL P  R KN  LAF  AE L D  PL++V+DM++M  RPD KCVF Y+Q  Y   R  EM
Sbjct:  635 EEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQ---REKERE------------------QRLQELKNKERESKLARSTETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTKSSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMK---------AQSLPKTPATQA-RKAMIEKMEKESGGSSSPAFAKVAT----PRSAAFGVPNA-NSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRHEM 954          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 159.458 bits (402), Expect = 1.487e-41
Identity = 113/356 (31.74%), Postives = 175/356 (49.16%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASS---SDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQG-----------------------------------GLESVNQLE-LKHKQLE-KERLMKQFDDMQKNYSKLAPSKPTVQTPKKAM--NVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            E++L +M+ K +D   RK IRA  ++LR+    Q   R+K+RE                  ++++++K  + ++K+     +S   S+        + + K  +L Q ++ +K+    + +                                    GL   N +  ++ +Q E K+ LMK         ++  P  P  Q  +KAM   + KE   +SSP  AK        +  A G+  + +SIKQ+LL+WC  +T+ Y  V I++FS SW++GMAFCAL+H+FFPEAFD+NQL P  R KN  LAF  AE L D  PL++V+DM++M  RPD KCVF Y+Q  Y   R  EM
Sbjct:  678 EEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQ---REKERE------------------QRLQELKNKERESKLARSTETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTKSSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMK---------AQSLPKTPATQA-RKAMIEKMEKESGGSSSPAFAKVAT----PRSAAFGVPNA-NSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRHEM 997          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 159.458 bits (402), Expect = 1.616e-41
Identity = 112/356 (31.46%), Postives = 176/356 (49.44%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASS---SDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQG-----------------------------------GLESVNQLE-LKHKQLEKER-LMKQFDDMQKNYSKLAPSKPTVQTPKKAM--NVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            E++L +M+ K +D   RK IRA  ++LR+    Q   R+K+RE                  ++++++K  + ++K+     +S   S+        + + K  +L Q ++ +K+    + +                                    GL   N +  ++ +Q E+++ LMK         ++  P  P  Q  +KAM   + KE   +SSP  AK        +  A G+  + +SIKQ+LL+WC  +T+ Y  V I++FS SW++GMAFCAL+H+FFPEAFD+NQL P  R KN  LAF  AE L D  PL++V+DM++M  RPD KCVF Y+Q  Y   R  EM
Sbjct:  676 EEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQ---REKERE------------------QRLQELKNKERESKLARSTETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTKSSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMK---------AQSLPKTPATQA-RKAMIEKMEKESGGSSSPAFAKVAT----PRSAAFGVPNA-NSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRHEM 995          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 159.458 bits (402), Expect = 1.800e-41
Identity = 113/356 (31.74%), Postives = 175/356 (49.16%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASS---SDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQG-----------------------------------GLESVNQLE-LKHKQLE-KERLMKQFDDMQKNYSKLAPSKPTVQTPKKAM--NVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            E++L +M+ K +D   RK IRA  ++LR+    Q   R+K+RE                  ++++++K  + ++K+     +S   S+        + + K  +L Q ++ +K+    + +                                    GL   N +  ++ +Q E K+ LMK         ++  P  P  Q  +KAM   + KE   +SSP  AK        +  A G+  + +SIKQ+LL+WC  +T+ Y  V I++FS SW++GMAFCAL+H+FFPEAFD+NQL P  R KN  LAF  AE L D  PL++V+DM++M  RPD KCVF Y+Q  Y   R  EM
Sbjct:  725 EEVLDKMLDKATDFEERKLIRAAMRDLRQRKREQ---REKERE------------------QRLQELKNKERESKLARSTETSIRQSETTNHGSAVSTVTKTQRLVQSNDGSKTSSTTTLEASYMKRSENGDTIVQTKSSFSATSKKVGSIFDREDEGLSRANSMTAMERRQAERKKELMK---------AQSLPKTPATQA-RKAMIEKMEKESGGSSSPAFAKVAT----PRSAAFGVPNA-NSIKQMLLDWCKAKTRGYEHVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRHEM 1044          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 149.828 bits (377), Expect = 1.979e-38
Identity = 59/112 (52.68%), Postives = 83/112 (74.11%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE L D  PL++V+DM++M  +PD KCVF Y+Q  Y   R  E+
Sbjct:  805 NSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAEMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL 916          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtnl2 (smoothelin-like 2 [Source:MGI Symbol;Acc:MGI:2442764])

HSP 1 Score: 143.28 bits (360), Expect = 1.071e-37
Identity = 62/117 (52.99%), Postives = 83/117 (70.94%), Query Frame = 3
Query:  879 GLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            G+A S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R KN  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  307 GVA-SASSIKQILLEWCRSKTVGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 422          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtnl2 (smoothelin-like 2 [Source:MGI Symbol;Acc:MGI:2442764])

HSP 1 Score: 143.665 bits (361), Expect = 1.506e-37
Identity = 62/117 (52.99%), Postives = 83/117 (70.94%), Query Frame = 3
Query:  879 GLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            G+A S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R KN  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  341 GVA-SASSIKQILLEWCRSKTVGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 456          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 143.28 bits (360), Expect = 1.550e-37
Identity = 58/105 (55.24%), Postives = 81/105 (77.14%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE  AD   LLD +DM+ +++ PDWKCV+ YIQ FY+
Sbjct:  320 NSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLRE-PDWKCVYTYIQEFYR 423          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 144.821 bits (364), Expect = 1.003e-36
Identity = 58/104 (55.77%), Postives = 80/104 (76.92%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE  AD   LLD +DM+ +++ PDWKCV+ YIQ FY+
Sbjct:  806 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLRE-PDWKCVYTYIQEFYR 908          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|P53814|SMTN_HUMAN (Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7)

HSP 1 Score: 149.828 bits (377), Expect = 1.363e-37
Identity = 59/111 (53.15%), Postives = 81/111 (72.97%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE L D  PL++V DM++M  +PD KCVF Y+Q  Y   R  E+
Sbjct:  800 SIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL 910          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q921U8|SMTN_MOUSE (Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 SV=2)

HSP 1 Score: 149.828 bits (377), Expect = 1.385e-37
Identity = 59/112 (52.68%), Postives = 83/112 (74.11%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEM 1232
            +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H+FFPEAFD+ QL P  R +N  +AF +AE L D  PL++V+DM++M  +PD KCVF Y+Q  Y   R  E+
Sbjct:  805 NSIKQMLLDWCRAKTRGYEHVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAEMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRHEL 916          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q8CI12|SMTL2_MOUSE (Smoothelin-like protein 2 OS=Mus musculus OX=10090 GN=Smtnl2 PE=1 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.053e-36
Identity = 62/117 (52.99%), Postives = 83/117 (70.94%), Query Frame = 3
Query:  879 GLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            G+A S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R KN  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  341 GVA-SASSIKQILLEWCRSKTVGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 456          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q2TAL5|SMTL2_HUMAN (Smoothelin-like protein 2 OS=Homo sapiens OX=9606 GN=SMTNL2 PE=2 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 2.140e-36
Identity = 62/117 (52.99%), Postives = 83/117 (70.94%), Query Frame = 3
Query:  879 GLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            G+A S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R KN  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  346 GVA-SASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNSLSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 461          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q2KI85|SMTL2_BOVIN (Smoothelin-like protein 2 OS=Bos taurus OX=9913 GN=SMTNL2 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.766e-36
Identity = 59/113 (52.21%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  891 SPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
            S SSIKQ+LLEWC  +T  Y  V++++FS SW++GMAFCAL+H FFP+AFD+N L P +R +N  LAF  AE LA+   L++V+DM++M  +PD  CVF Y+Q  Y   R  E
Sbjct:  346 SASSIKQILLEWCRSKTLGYQHVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRRQNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLRRFE 458          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A267FQN8 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001580g2 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 7.202e-87
Identity = 149/333 (44.74%), Postives = 212/333 (63.66%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYS------------KLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAK--PNF--RGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMS 1235
            E++L++++ +T D + +K IRAR K L E  A    E++K        +D V  R  QA+E K ++MKG+QE AK + GA    D VKA+ E+A+ +K A+LR Y E+AK+ GA + QGG E V ++E +     K R ++QFD M K+              +   S+P    PK AM+ FK MD  ++P  AK  P +   G+R      G+ R+PS IKQ+LLEWC   TK+Y   GV + +FS SW++G+AFCALIH+F P++F+F++LK  ER KN  LAF+TAEK+ADI+PLLDV+DM+ MK+ PDWKCVF Y+Q FY++FR V +S
Sbjct:   17 EEVLSKLLTQTDDFDKKKLIRARLKVLHEEHAKAYEEKKKSH----ATVDPVAMRAKQAEEAKARQMKGFQEMAKQSAGAVHKDDSVKARAEQAQKDKEAELRNYQELAKTPGAGAVQGGSERVRRMETEAAAESKARQLRQFDQMAKHVDSPGTIVANEGRPRAVGSQPGGGRPKSAMSAFKAMDNANNPEAAKAAPAYLQAGSRQPAARGGVTRNPSQIKQMLLEWCQAATKNYKDKGVCVTNFSSSWSDGLAFCALIHNFHPDSFNFDELKASERRKNFQLAFDTAEKVADIAPLLDVEDMMKMKN-PDWKCVFTYVQSFYRKFRSVPLS 344          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A267H2R6 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001580g1 PE=4 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 7.559e-86
Identity = 148/333 (44.44%), Postives = 211/333 (63.36%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYS------------KLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAK--PNF--RGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMS 1235
            E++L++++ +T D + +K IRAR K L E  A    E++K        +D V  R  QA+E K ++MKG+QE AK + GA    D VKA+ E+A+ +K A+LR Y E+AK+ GA + QG  E V ++E +     K R ++QFD M K+              +   S+P    PK AM+ FK MD  ++P  AK  P +   G+R      G+ R+PS IKQ+LLEWC   TK+Y   GV + +FS SW++G+AFCALIH+F P++F+F++LK  ER KN  LAF+TAEK+ADI+PLLDV+DM+ MK+ PDWKCVF Y+Q FY++FR V +S
Sbjct:   17 EEVLSKLLTQTDDFDKKKLIRARLKVLHEEHAKAYEEKKKSH----ATVDPVAMRAKQAEEAKARQMKGFQEMAKQSAGAVHKDDSVKARAEQAQKDKEAELRNYQELAKTPGAGAVQGSSERVRRMETEAAAESKARQLRQFDQMAKHVDSPGTIVANEGRPRAVGSQPGGGRPKSAMSAFKAMDNANNPEAAKAAPAYLQAGSRQPAARGGVTRNPSQIKQMLLEWCQAATKNYKDKGVCVTNFSSSWSDGLAFCALIHNFHPDSFNFDELKASERRKNFQLAFDTAEKVADIAPLLDVEDMMKMKN-PDWKCVFTYVQSFYRKFRSVPLS 344          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A1I8JHI0 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 1.894e-79
Identity = 151/375 (40.27%), Postives = 214/375 (57.07%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKN----------------------------------YSKLAP--------------------SKPTVQTPKKAMNVFKEMDKTSSPTTAK--PNF--RGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMS 1235
            E++L++++ +T D + +K IRAR K L E  A    E++K        +D V  R  QA+E K ++MKG+QE AK + GA    D VKA+ E+A+ +K A+LR Y E+AK+ GA + QG  E V ++E +     K R ++QFD M K+                                  + KLA                     S+P    PK AM+ FK MD  ++P  AK  P +   G+R      G+ R+PS IKQ+LLEWC   TK+Y   GV + +FS SW++G+AFCALIH+F P++F+F++LK  ER KN  LAF+TAEK+ADI+PLLDV+DM+ MK+ PDWKCVF Y+Q FY++FR V +S
Sbjct:   17 EEVLSKLLTQTDDFDKKKLIRARLKVLHEEHAKAYEEKKKSH----ATVDPVAMRAKQAEEAKARQMKGFQEMAKQSAGAVHKDDSVKARAEQAQKDKEAELRNYQELAKTPGAGAVQGSSERVRRMETEAAAESKARQLRQFDQMAKHVDSPGTIVANEVRKYLSTQSLRPHLEELQLHGLPWKKLAEEPQITFCTNPKHPGRPRAVGSQPGGGRPKSAMSAFKAMDNANNPEAAKAAPAYLQAGSRQPAARGGVTRNPSQIKQMLLEWCQAATKNYKDKGVCVTNFSSSWSDGLAFCALIHNFHPDSFNFDELKASERRKNFQLAFDTAEKVADIAPLLDVEDMMKMKN-PDWKCVFTYVQSFYRKFRSVPLS 386          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A1I8G485 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 3.009e-71
Identity = 151/374 (40.37%), Postives = 200/374 (53.48%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKIT-IGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQ---------TPKKAMNVFKEMDKTSSPT-----------TAKPNFRGNRVQV-----------------------------------GADGLAR--SPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSK 1238
            +DLL++M+ KT D +L+K+IRAR KEL E  A    E++K        +D V +R  QA+E K +++K YQE A+ +  GAA S D +K + ER + EK A+L+ Y E+AK  G  + QGG E V QLE +  +  K R +KQF++M K+    AP    +            K AMN FK MD+ +S T           T     R   V V                                   G  GL R  S ++IKQ LL+WC        GVE+ + S SW +G+AFCALIH F PEAFDFN+L    R +N  LAFETAEK A I+PLLDV+DM+ M   PDWKCVF Y+Q FYK+FR+ + SK
Sbjct:   16 QDLLSKMLMKTEDFDLKKKIRARLKELYELEAKGFEEKRKGH----VVVDHVASRARQAEEAKARQLKSYQEMARTSSAGAAGSEDALKLRAERLQKEKEAELKSYAELAKLPGVGALQGGSERVKQLEQEAAEQSKARQLKQFNEMAKHVD--APGTIVLNEASPGGGESASKSAMNKFKAMDRAASKTQQQNDAASAKKTGSSLKRSQSVAVLQSGSAAVKQWQAAAAVATAASGQPGAEPKPVAPSGGRGLKRTQSAATIKQCLLDWC------KAGVEVTNLSSSWGDGLAFCALIHSFHPEAFDFNELSAANRKRNFELAFETAEKYAGIAPLLDVEDMVTMVT-PDWKCVFTYLQMFYKKFRNFDKSK 376          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A267EXF9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025120g1 PE=4 SV=1)

HSP 1 Score: 239.965 bits (611), Expect = 9.640e-66
Identity = 154/376 (40.96%), Postives = 204/376 (54.26%), Query Frame = 3
Query:  291 EDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKIT-IGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQ--TP-------KKAMNVFKEMDKTSSPT-----------TAKPNFRGNRVQV-----------------------------------GADGLAR--SPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSK 1238
            +DLL++M+ KT D +L+K+IRAR KEL E  A    E++K        +D V +R  QA+E K +++K YQE A+ +  GAA S D +K + ER + EK A+L+ Y E+AK  G  + QGG E V QLE +  +  K R +KQF++M K+    AP    +   +P       K AMN FK MD+ +S T           T     R   V V                                   G  GL R  S ++IKQ LL+WC   T  Y   GVE+ + S SW +G+AFCALIH F PEAFDFN+L    R +N  LAFETAEK A I+PLLDV+DM+ M   PDWKCVF Y+Q FYK+FR+ + SK
Sbjct: 1001 QDLLSKMLMKTEDFDLKKKIRARLKELYELEAKGFEEKRKGH----VVVDHVASRARQAEEAKARQLKSYQEMARTSSAGAAGSEDALKLRAERLQKEKEAELKSYAELAKLPGVGALQGGSERVKQLEQEAAEQSKARQLKQFNEMAKHVD--APGTIVLNEASPGGGESASKSAMNKFKAMDRAASKTQQQNDAASAKKTGSSLKRSQSVAVLQSGSAAVKQWQAAAAVATAVSGQPGAEPKPVAPSGGRGLKRTQSAATIKQCLLDWCKAVTAPYRQWGVEVTNLSSSWGDGLAFCALIHSFHPEAFDFNELSAANRKRNFELAFETAEKYAGIAPLLDVEDMVTMV-TPDWKCVFTYLQMFYKKFRNFDKSK 1369          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 157.532 bits (397), Expect = 4.305e-43
Identity = 70/133 (52.63%), Postives = 90/133 (67.67%), Query Frame = 3
Query:  843 NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
            NF+  ++ VG  G A    SIKQ +L+WC  +T+DY GV I++FS SW++G+AFCAL+H FFP AFDF+ LK  ER KN TLAF TAE LAD  PLLDV DML+M  +PD   VF Y+Q   +    +E  +K
Sbjct:  209 NFKVQKMSVGVSGGA----SIKQKILQWCSNKTRDYEGVSIENFSSSWSDGLAFCALVHRFFPTAFDFSTLKASEREKNFTLAFSTAETLADCCPLLDVSDMLLMGKKPDPFSVFTYVQSLCQHLSKIERERK 337          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 158.303 bits (399), Expect = 4.862e-43
Identity = 70/133 (52.63%), Postives = 90/133 (67.67%), Query Frame = 3
Query:  843 NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
            NF+  ++ VG  G A    SIKQ +L+WC  +T+DY GV I++FS SW++G+AFCAL+H FFP AFDF+ LK  ER KN TLAF TAE LAD  PLLDV DML+M  +PD   VF Y+Q   +    +E  +K
Sbjct:  246 NFKVQKMSVGVSGGA----SIKQKILQWCSNKTRDYEGVSIENFSSSWSDGLAFCALVHRFFPTAFDFSTLKASEREKNFTLAFSTAETLADCCPLLDVSDMLLMGKKPDPFSVFTYVQSLCQHLSKIERERK 374          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 158.303 bits (399), Expect = 5.449e-43
Identity = 70/133 (52.63%), Postives = 90/133 (67.67%), Query Frame = 3
Query:  843 NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
            NF+  ++ VG  G A    SIKQ +L+WC  +T+DY GV I++FS SW++G+AFCAL+H FFP AFDF+ LK  ER KN TLAF TAE LAD  PLLDV DML+M  +PD   VF Y+Q   +    +E  +K
Sbjct:  246 NFKVQKMSVGVSGGA----SIKQKILQWCSNKTRDYEGVSIENFSSSWSDGLAFCALVHRFFPTAFDFSTLKASEREKNFTLAFSTAETLADCCPLLDVSDMLLMGKKPDPFSVFTYVQSLCQHLSKIERERK 374          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: ENSAMXT00000056105.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000095.1:180394:186664:-1 gene:ENSAMXG00000031006.1 transcript:ENSAMXT00000056105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 7.725e-40
Identity = 84/202 (41.58%), Postives = 121/202 (59.90%), Query Frame = 3
Query:  606 DEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            D+ ++SGG         ++  LE +  + +KE LM+         ++  P   T Q  +KAM    E D  SSP       + N+VQ        + +SIKQ+LL+WC  +T+DY  V+I++FS SW++GMAFCAL+H+FFPEAFD+  L P  R +N  +AF+TA  LAD   LLDV DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  127 DDTSRSGG---------TMAALERRQAERKKE-LMR---------AQTLPKTSTSQA-RKAMIEKLEKDGGSSPAV-----QINKVQRSTSFGVPNANSIKQMLLDWCRAKTRDYENVDIQNFSSSWSDGMAFCALVHNFFPEAFDYAALSPSNRRQNFEVAFKTA-TLADCPQLLDVDDMVRMRE-PDWKCVYTYLQEFYR 301          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtna (smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245])

HSP 1 Score: 134.806 bits (338), Expect = 4.276e-37
Identity = 62/120 (51.67%), Postives = 84/120 (70.00%), Query Frame = 3
Query:  852 GNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            G RV  G+     +   +KQ+LL+WC  +T+ Y GV I++FS SWA+G+AFCAL+H FFPE FD+  L P +R  N   AF+TA +L D +PLLDV D+L M++ PDWKCV+ YIQ FY+
Sbjct:   45 GVRVPRGSALGGPNTKDVKQMLLDWCRAKTEPYEGVNIQNFSSSWADGLAFCALVHRFFPEGFDYCTLDPYDRRANFEKAFKTA-RLGDCAPLLDVDDLLRMRE-PDWKCVYTYIQEFYR 162          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008014.1 (pep scaffold:Pmarinus_7.0:GL480769:7574:15080:-1 gene:ENSPMAG00000007250.1 transcript:ENSPMAT00000008014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.732 bits (343), Expect = 4.102e-39
Identity = 61/124 (49.19%), Postives = 83/124 (66.94%), Query Frame = 3
Query:  840 PNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            P  +G  +Q  A  +  SP ++ QL LEWC  +T++Y  V +++FS SW +GMAFCAL+H +FPEAFDF +L P     N  LAF  AE+LA   PLLDV+DM++M +RPD KCVF Y+Q  + 
Sbjct:    1 PGGQGTPLQRSASVM--SPGNVMQLTLEWCKTRTENYANVSVRNFSSSWCDGMAFCALVHSYFPEAFDFAELSPQNPRHNFQLAFTCAERLAHCDPLLDVEDMIIMGNRPDSKCVFTYVQSLFN 122          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009649.1 (pep scaffold:Pmarinus_7.0:GL478928:16819:21705:-1 gene:ENSPMAG00000008722.1 transcript:ENSPMAT00000009649.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 2.268e-32
Identity = 52/92 (56.52%), Postives = 63/92 (68.48%), Query Frame = 3
Query:  954 GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVE 1229
             V IK+FS SW +GMAFCAL+H +FPEAFDF +L P     N  LAF  AE+LA   PLLDV DM+MM  +PD KCVF Y+Q  Y + R +E
Sbjct:    2 NVTIKNFSSSWCDGMAFCALVHSYFPEAFDFAKLSPQNPRHNFQLAFTCAEQLAHCDPLLDVDDMIMMGKKPDSKCVFTYVQSLYNKLRRLE 93          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: mical3b (Danio rerio microtubule associated monooxygenase, calponin and LIM domain containing 3b (mical3b), mRNA. [Source:RefSeq mRNA;Acc:NM_001353875])

HSP 1 Score: 98.2117 bits (243), Expect = 5.408e-22
Identity = 61/181 (33.70%), Postives = 97/181 (53.59%), Query Frame = 3
Query:  702 RLMKQF--DDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQ--VGADG-LARSPSSIKQL-LLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDV 1226
            RL+ Q   +++ KN+S+ +   PT + P   +N  +         T +       V+  +GAD  L R  S ++   LL WC RQT+ Y GV + DF+GSW +G+A CA+IH + P+  DF+ L     + N  LAF+ AE+   ISP++  +++  + D PD   +  Y+  FY+ FRD 
Sbjct:  446 RLLPQTTPENINKNFSQYSID-PTTRYPNVNLNFLRASQVRHLYDTGEARETAMDVESALGADSRLTRHDSIMRSSKLLSWCQRQTEGYRGVRVVDFTGSWKSGLALCAIIHRYRPDLIDFDSLDERNVAGNNQLAFDVAEREFGISPIITGQEVAGVAD-PDKLSMVMYLSQFYEMFRDT 624          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 5.931e-21
Identity = 44/107 (41.12%), Postives = 65/107 (60.75%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRF 1217
            +S K+ LL WC R+T  Y  V +++F  SW +G+AF ALIH   P+  D+++L+  +   NL  AFE AEK  DI  +LD +D++    RPD K +  Y+ C+Y  F
Sbjct:  113 TSAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTA-RPDEKAIMTYVSCYYHAF 218          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.3597 bits (233), Expect = 8.047e-21
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 3
Query:  897 SSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRF 1217
            +S K+ LL WC R+T  Y  V +++F  SW +G+AF ALIH   P+  D+ +L+  +   NL  AFE AEK  DI  +LD +D++    RPD K +  Y+ C+Y  F
Sbjct:  109 TSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTA-RPDEKAIMTYVSCYYHAF 214          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO36878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHE7])

HSP 1 Score: 120.168 bits (300), Expect = 6.832e-31
Identity = 54/114 (47.37%), Postives = 80/114 (70.18%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR--DVEMS 1235
            S+  L+L WC   TKDYPGVEIK+FS S+ +G+AFCALIH F P+ FDF++L P +R  N TLA ET E +  IS + D+ +M++ + +P+ + V CY+Q  + ++R  D++MS
Sbjct:  174 SVSSLVLTWCQDVTKDYPGVEIKNFSTSFYDGLAFCALIHKFNPDKFDFSELTPEDRRHNWTLALETGESVG-ISQMFDL-EMMLRQRKPEPRSVQCYVQMIFSKYRPKDLDMS 285          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO36124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJI6])

HSP 1 Score: 94.3597 bits (233), Expect = 1.586e-23
Identity = 44/103 (42.72%), Postives = 69/103 (66.99%), Query Frame = 3
Query:  915 LLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRD 1223
            +LEWC R+T+ + GVEI++F+ SWA+G+A CAL H+F PE   +  L P +R++N TLAFE A     I PLL+++D+L ++  P+ K +  Y+   Y+ F +
Sbjct:    1 MLEWCRRRTRGHEGVEIQNFTTSWADGLAMCALFHNFSPELIPYETLDPKDRTRNWTLAFEAAYA-EGIDPLLELEDVLRVQ-VPEPKSLATYVHTIYQHFHE 101          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO36877 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHE6])

HSP 1 Score: 88.5817 bits (218), Expect = 6.718e-22
Identity = 39/69 (56.52%), Postives = 47/69 (68.12%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAE 1106
            S+  L+L WC   T+ Y GV I +FSGS+ANG+AFCALIH F P+ FDF+ L P  R  N  LAFET E
Sbjct:    3 SVSSLILTWCKDVTEGYKGVNITNFSGSFANGLAFCALIHKFNPDKFDFDSLDPENRHYNFKLAFETGE 71          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 98.2117 bits (243), Expect = 6.880e-22
Identity = 46/114 (40.35%), Postives = 68/114 (59.65%), Query Frame = 3
Query:  876 DGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRF 1217
            D +++   S K+ LL WC R T+ YPGV+I++FS SW NG+AF AL+H   P+  D+  L+P +   NL  AF  A +   I+ LLD +D+     RPD + V  Y+  +Y+ F
Sbjct:  134 DDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDC--PRPDDRSVMTYVAAYYQYF 245          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO38282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDB7])

HSP 1 Score: 97.8265 bits (242), Expect = 7.958e-22
Identity = 45/103 (43.69%), Postives = 64/103 (62.14%), Query Frame = 3
Query:  912 LLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 1220
            +LL+WC +QTK Y  V+I D S SW +G+AFCA+IH F P+  +F+ LKPG+   N  LAFETAE+   I P +   +M +    PD   +  YI  +Y+ F+
Sbjct:  520 MLLKWCQKQTKSYKHVDINDMSSSWKDGLAFCAIIHRFRPDLLNFDSLKPGDTETNCKLAFETAEEQLGIPPQISASEM-VTSGNPDPLMIMSYISQYYESFK 621          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: smtnl1 (smoothelin like 1 [Source:NCBI gene;Acc:101166638])

HSP 1 Score: 155.221 bits (391), Expect = 2.624e-42
Identity = 70/142 (49.30%), Postives = 93/142 (65.49%), Query Frame = 3
Query:  819 SSPTTAKP-NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
             +P T  P NFR  +    + G A + +SIKQ +L+WC  +T++Y  V I++FS SW +G+AFCALIH FFP+AFD+N L P ER KN TLAF+TAE LAD  PLL+V DM+MM   PD  CVF Y+Q        +E  ++
Sbjct:  207 GAPETPIPRNFRIQK----SSGAAATGASIKQKILQWCRSKTRNYKDVNIENFSSSWCDGLAFCALIHRFFPDAFDYNSLTPQEREKNFTLAFQTAESLADCCPLLEVADMIMMGKSPDPMCVFTYVQSLCHSLSKIEQERR 344          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: smtnl1 (smoothelin like 1 [Source:NCBI gene;Acc:101166638])

HSP 1 Score: 155.221 bits (391), Expect = 2.624e-42
Identity = 70/142 (49.30%), Postives = 93/142 (65.49%), Query Frame = 3
Query:  819 SSPTTAKP-NFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
             +P T  P NFR  +    + G A + +SIKQ +L+WC  +T++Y  V I++FS SW +G+AFCALIH FFP+AFD+N L P ER KN TLAF+TAE LAD  PLL+V DM+MM   PD  CVF Y+Q        +E  ++
Sbjct:  207 GAPETPIPRNFRIQK----SSGAAATGASIKQKILQWCRSKTRNYKDVNIENFSSSWCDGLAFCALIHRFFPDAFDYNSLTPQEREKNFTLAFQTAESLADCCPLLEVADMIMMGKSPDPMCVFTYVQSLCHSLSKIEQERR 344          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000044871.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 148.288 bits (373), Expect = 5.608e-38
Identity = 62/119 (52.10%), Postives = 85/119 (71.43%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H FFP+AFD++ L P  R  N  +AF  AEKL D   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  910 NRVQRSTSFGVPNANSIKQMLLDWCRAKTRSYEHVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMRE-PDWKCVYTYLQEFYR 1027          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000032959.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 148.288 bits (373), Expect = 6.059e-38
Identity = 62/119 (52.10%), Postives = 85/119 (71.43%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H FFP+AFD++ L P  R  N  +AF  AEKL D   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  792 NRVQRSTSFGVPNANSIKQMLLDWCRAKTRSYEHVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMRE-PDWKCVYTYLQEFYR 909          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000028335.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 147.517 bits (371), Expect = 1.095e-37
Identity = 62/119 (52.10%), Postives = 85/119 (71.43%), Query Frame = 3
Query:  855 NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYK 1211
            NRVQ        + +SIKQ+LL+WC  +T+ Y  V+I++FS SW++GMAFCAL+H FFP+AFD++ L P  R  N  +AF  AEKL D   LLDV+DM+ M++ PDWKCV+ Y+Q FY+
Sbjct:  817 NRVQRSTSFGVPNANSIKQMLLDWCRAKTRSYEHVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMRE-PDWKCVYTYLQEFYR 934          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000025457.1 (SMESG000025457.1)

HSP 1 Score: 662.529 bits (1708), Expect = 0.000e+0
Identity = 329/329 (100.00%), Postives = 329/329 (100.00%), Query Frame = 3
Query:  255 MSNXXXXXXXXXEDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 1241
            MSNSIDISSIDDEDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK
Sbjct:    1 MSNSIDISSIDDEDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAERQKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVKAQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKERLMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRGNRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFRDVEMSKK 329          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000039310.1 (SMESG000039310.1)

HSP 1 Score: 139.813 bits (351), Expect = 2.172e-36
Identity = 61/113 (53.98%), Postives = 83/113 (73.45%), Query Frame = 3
Query:  888 RSPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 1220
            RS +S K ++L +C   T++Y   GV + + S SW++G+AFCALIHHF PEAFDF++L    R  N  LAF +A+K ADI PLLD+ DM++M ++PDWKC+F Y+QCFYK FR
Sbjct:  335 RSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKLNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFR 446          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 119.783 bits (299), Expect = 5.794e-29
Identity = 51/107 (47.66%), Postives = 74/107 (69.16%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 1220
            ++K LLL W  + T++Y  V+I ++S SWA+G+AFCALIHHF+PE+FD++ L   +  KN TLAFETA+  A I PL++  D+ ++   PD KCV+ YIQ  Y   +
Sbjct:  446 ALKDLLLIWIEKNTQEYQNVKITNYSKSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNIL-GSPDEKCVYTYIQFMYNSLK 551          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 119.783 bits (299), Expect = 7.405e-29
Identity = 51/107 (47.66%), Postives = 74/107 (69.16%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 1220
            ++K LLL W  + T++Y  V+I ++S SWA+G+AFCALIHHF+PE+FD++ L   +  KN TLAFETA+  A I PL++  D+ ++   PD KCV+ YIQ  Y   +
Sbjct:  483 ALKDLLLIWIEKNTQEYQNVKITNYSKSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNIL-GSPDEKCVYTYIQFMYNSLK 588          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 105.531 bits (262), Expect = 4.118e-24
Identity = 50/110 (45.45%), Postives = 71/110 (64.55%), Query Frame = 3
Query:  900 SIKQLLLEWCIRQTKDYPGVE-IKDFSG--SWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 1220
            ++K LLL W  + T++Y  +  I  F    SWA+G+AFCALIHHF+PE+FD++ L   +  KN TLAFETA+  A I PL++  D+ ++   PD KCV+ YIQ  Y   +
Sbjct:  446 ALKDLLLIWIEKNTQEYQLISMILTFKTYLSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNIL-GSPDEKCVYTYIQFMYNSLK 554          
The following BLAST results are available for this feature:
BLAST of Cytospin-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMTN5.816e-3955.24smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN2.839e-3853.15smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN3.431e-3853.15smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTNL21.572e-3752.99smoothelin like 2 [Source:HGNC Symbol;Acc:HGNC:247... [more]
SMTN1.674e-3731.27smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
back to top
BLAST of Cytospin-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T15B12.18.609e-4348.72pep chromosome:WBcel235:III:5294501:5298361:1 gene... [more]
T15B12.18.609e-4348.72pep chromosome:WBcel235:III:5294620:5298361:1 gene... [more]
T15B12.11.299e-4050.69pep chromosome:WBcel235:III:5288180:5298361:1 gene... [more]
sma-15.983e-2446.15SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
sma-16.459e-2446.15SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
back to top
BLAST of Cytospin-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG344172.981e-3952.25gene:FBgn0085446 transcript:FBtr0308093[more]
CG344174.694e-3853.21gene:FBgn0085446 transcript:FBtr0345070[more]
CG344174.894e-3853.21gene:FBgn0085446 transcript:FBtr0303205[more]
CG344175.558e-3853.21gene:FBgn0085446 transcript:FBtr0336674[more]
CG344176.135e-3853.21gene:FBgn0085446 transcript:FBtr0112704[more]
back to top
BLAST of Cytospin-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtnb6.986e-4253.78smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtnb9.783e-4253.78smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtnl11.170e-4151.88smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
smtnb4.576e-4153.78smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtna4.567e-3950.83smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245][more]
back to top
BLAST of Cytospin-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtn6.424e-4233.83ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.459e-4131.74ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.487e-4131.74ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.616e-4131.46ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.800e-4131.74ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smtn1.979e-3852.68smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtnl21.071e-3752.99smoothelin-like 2 [Source:MGI Symbol;Acc:MGI:24427... [more]
Smtnl21.506e-3752.99smoothelin-like 2 [Source:MGI Symbol;Acc:MGI:24427... [more]
Smtn1.550e-3755.24smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtn1.003e-3655.77smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
back to top
BLAST of Cytospin-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53814|SMTN_HUMAN1.363e-3753.15Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV... [more]
sp|Q921U8|SMTN_MOUSE1.385e-3752.68Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 S... [more]
sp|Q8CI12|SMTL2_MOUSE1.053e-3652.99Smoothelin-like protein 2 OS=Mus musculus OX=10090... [more]
sp|Q2TAL5|SMTL2_HUMAN2.140e-3652.99Smoothelin-like protein 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q2KI85|SMTL2_BOVIN3.766e-3652.21Smoothelin-like protein 2 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Cytospin-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FQN87.202e-8744.74Calponin-homology (CH) domain-containing protein O... [more]
A0A267H2R67.559e-8644.44Calponin-homology (CH) domain-containing protein O... [more]
A0A1I8JHI01.894e-7940.27Calponin-homology (CH) domain-containing protein O... [more]
A0A1I8G4853.009e-7140.37Calponin-homology (CH) domain-containing protein O... [more]
A0A267EXF99.640e-6640.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtnl14.305e-4352.63smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
smtnl14.862e-4352.63smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
smtnl15.449e-4352.63smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
ENSAMXT00000056105.17.725e-4041.58pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
smtna4.276e-3751.67smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245][more]
back to top
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008014.14.102e-3949.19pep scaffold:Pmarinus_7.0:GL480769:7574:15080:-1 g... [more]
ENSPMAT00000009649.12.268e-3256.52pep scaffold:Pmarinus_7.0:GL478928:16819:21705:-1 ... [more]
mical3b5.408e-2233.70Danio rerio microtubule associated monooxygenase, ... [more]
ENSPMAT00000000684.15.931e-2141.12pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.18.047e-2141.12pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytospin-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368786.832e-3147.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361241.586e-2342.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368776.718e-2256.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495766.880e-2240.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382827.958e-2243.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtnl12.624e-4249.30smoothelin like 1 [Source:NCBI gene;Acc:101166638][more]
smtnl12.624e-4249.30smoothelin like 1 [Source:NCBI gene;Acc:101166638][more]
ENSORLT00000044871.15.608e-3852.10smoothelin [Source:NCBI gene;Acc:101173151][more]
ENSORLT00000032959.16.059e-3852.10smoothelin [Source:NCBI gene;Acc:101173151][more]
ENSORLT00000028335.11.095e-3752.10smoothelin [Source:NCBI gene;Acc:101173151][more]
back to top
BLAST of Cytospin-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025457.10.000e+0100.00SMESG000025457.1[more]
SMESG000039310.12.172e-3653.98SMESG000039310.1[more]
SMESG000002849.15.794e-2947.66SMESG000002849.1[more]
SMESG000002849.17.405e-2947.66SMESG000002849.1[more]
SMESG000002849.14.118e-2445.45SMESG000002849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033424 ID=SMED30033424|Name=Cytospin-A|organism=Schmidtea mediterranea sexual|type=transcript|length=1368bp
GTAAATTACTGTAAATCGAATTTGTTGTTGTAAAATTTATGCACATAGGA
AAATTTACCTTGAATAAGGCAACATCATTGATAAAGTACACGTGAAGCAT
GTATTGCATGTTATGAGGAAACATGTCTACCGATCGATGATCGAATCAGT
TATGAATGTGTGCATCAACTGTATCATTAGCAGCGATCAACGGAATTCAT
ATAAATATCTGGAAACCAAATGGAATCTCATAAGAAACGAAATTTCCTTT
TAAAATGTCGAATTCAATTGATATCTCTTCTATTGATGATGAGGATTTGT
TGGCTGAAATGATAGCTAAAACCAGTGATATTAATTTACGAAAAGAAATC
CGTGCCAGACAAAAAGAATTGAGAGAAAATGCTGCTGCCCAAGTTGCTGA
GCGTCAGAAACAACGAGAAAATCTCGGTACCAATCTTGATAGTGTTAAAA
CTCGAAATATGCAAGCCGATGAAGAGAAAATGAAAAAAATGAAAGGCTAT
CAAGAACAGGCGAAAATCACCATCGGAGCTGCGAGTTCGTCTGATCCTGT
TAAGGCTCAAAAAGAAAGAGCCGAACTAGAAAAAGCTGCCCAATTACGAC
AATACGATGAAATGGCGAAATCCGGAGGAGCGGCATCCTACCAAGGGGGA
TTAGAGTCGGTTAACCAGCTCGAATTAAAACACAAACAACTGGAAAAAGA
AAGATTAATGAAACAATTCGATGATATGCAGAAAAATTATTCAAAACTCG
CGCCGTCAAAACCAACTGTCCAAACTCCGAAAAAAGCCATGAATGTTTTC
AAAGAAATGGACAAAACGTCAAGTCCGACAACTGCCAAACCAAATTTCCG
GGGGAATCGAGTCCAAGTCGGTGCTGATGGTCTAGCTAGATCGCCGAGTT
CAATTAAACAGTTGCTGCTTGAATGGTGCATCCGACAAACAAAAGATTAT
CCAGGAGTAGAAATAAAGGATTTCTCCGGAAGTTGGGCAAATGGAATGGC
ATTTTGTGCTTTGATCCATCATTTCTTTCCTGAGGCGTTTGATTTCAATC
AATTGAAACCCGGAGAAAGAAGTAAAAATTTGACATTGGCTTTTGAAACT
GCTGAAAAATTGGCGGATATTTCCCCTTTACTCGATGTAAAAGACATGCT
GATGATGAAAGACCGACCAGATTGGAAATGCGTATTCTGCTACATTCAAT
GTTTCTACAAACGATTCCGCGATGTAGAAATGTCCAAAAAATGATAAAAC
TCAAGAAACACGATTTTTTTTTATATTTCATATTCTATATCGCCATGTTT
ATGAAATACGGTTTTGCCTTACATGTAATTATTTTAAGAGTTCAAATAAA
AATACTTTTAGAGAAAAA
back to top

protein sequence of SMED30033424-orf-1

>SMED30033424-orf-1 ID=SMED30033424-orf-1|Name=SMED30033424-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=330bp
MSNSIDISSIDDEDLLAEMIAKTSDINLRKEIRARQKELRENAAAQVAER
QKQRENLGTNLDSVKTRNMQADEEKMKKMKGYQEQAKITIGAASSSDPVK
AQKERAELEKAAQLRQYDEMAKSGGAASYQGGLESVNQLELKHKQLEKER
LMKQFDDMQKNYSKLAPSKPTVQTPKKAMNVFKEMDKTSSPTTAKPNFRG
NRVQVGADGLARSPSSIKQLLLEWCIRQTKDYPGVEIKDFSGSWANGMAF
CALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLM
MKDRPDWKCVFCYIQCFYKRFRDVEMSKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005921gap junction
GO:0030054cell junction
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0051301cell division
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR022189SMTN
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 129..161
NoneNo IPR availableCOILSCoilCoilcoord: 103..123
NoneNo IPR availableCOILSCoilCoilcoord: 29..56
NoneNo IPR availablePANTHERPTHR23167FAMILY NOT NAMEDcoord: 216..325
NoneNo IPR availablePANTHERPTHR23167:SF52SMOOTHELINcoord: 216..325
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 217..317
e-value: 2.0E-16
score: 70.5
IPR001715Calponin homology domainPFAMPF00307CHcoord: 218..322
e-value: 5.1E-19
score: 68.5
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 215..322
score: 22.984
IPR001715Calponin homology domainCDDcd00014CHcoord: 218..322
e-value: 7.0818E-21
score: 83.8995
IPR022189SmoothelinPFAMPF12510Smoothelincoord: 4..41
e-value: 1.3E-5
score: 25.1
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 213..328
e-value: 2.4E-37
score: 129.2
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 172..323