CLIP-associating protein 1

Overview
NameCLIP-associating protein 1
Smed IDSMED30033412
Length (bp)4314
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CLIP-associating protein 1 (SMED30033412) t-SNE clustered cells

Violin plots show distribution of expression levels for CLIP-associating protein 1 (SMED30033412) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CLIP-associating protein 1 (SMED30033412) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CLIP-associating protein 1 (SMED30033412) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033412

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30033412SMESG000072426.1 dd_Smed_v4_5069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033412SMESG000072426.1 dd_Smed_v4_5069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033412SMESG000072426.1 dd_Smed_v4_5069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033412SMESG000072426.1 dd_Smed_v4_5069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033412SMESG000072426.1 dd_Smed_v4_5069_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 280.796 bits (717), Expect = 3.882e-76
Identity = 231/771 (29.96%), Postives = 371/771 (48.12%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL--------------------------LSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNF---------------TGRTRVNSAKSENPSANSSTEYLYSKQQSNF-GWRAAKPKT-------ATARIDTSDPRG--RIQKVSQSQPSTRDPSP------------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L                          LS K     S       ++    +T  S+    S+                +G T  +SA +  P + +S E  + ++   + G  + + +T       AT    T D RG  R + VSQSQP +R  SP                        S K   I  S G S     N          Q    P + +++R        E  VA+ L           + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLESRHMREDMEYIGLDSGRIRTRRQSSGSATNVASTPDNRGRSRAKVVSQSQPGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALLLGDSRSKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1059          

HSP 2 Score: 167.548 bits (423), Expect = 5.750e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1220 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1460          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 278.485 bits (711), Expect = 2.101e-75
Identity = 230/772 (29.79%), Postives = 367/772 (47.54%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL--------------------------LSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNF---------------TGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQK--VSQSQPS---------TRDPSP------------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L                          LS K     S       ++    +T  S+    S+                +G T  +SA +  P + +S +   +K +     R     +AT    T D RGR +   VSQSQ S         +R  SP                        S K   I  S G S     N          Q    P + +++R        E  VA+ L            + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  + V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLDGTTTKAEGRIRTRRQSSGSATNVASTPDNRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALLLGDSRSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1060          

HSP 2 Score: 167.933 bits (424), Expect = 4.731e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1221 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1461          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 273.863 bits (699), Expect = 5.734e-74
Identity = 230/773 (29.75%), Postives = 367/773 (47.48%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL--------------------------LSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNF---------------TGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQK--VSQSQPS---------TRDPSP------------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L                          LS K     S       ++    +T  S+    S+                +G T  +SA +  P + +S +   +K +     R     +AT    T D RGR +   VSQSQ S         +R  SP                        S K   I  S G S     N          Q    P + +++R        E  VA+ L            + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLDGTTTKAEGRIRTRRQSSGSATNVASTPDNRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALLLGDSRSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1061          

HSP 2 Score: 167.548 bits (423), Expect = 4.940e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1222 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1462          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 271.166 bits (692), Expect = 3.525e-73
Identity = 230/773 (29.75%), Postives = 369/773 (47.74%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL--------------------------LSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNF---------------TGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRG--RIQKVSQSQPS---------TRDPSP------------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L                          LS K     S       ++    +T  S+    S+                +G T  +SA +  P + +S   + +++QS+         +AT    T D RG  R + VSQSQ S         +R  SP                        S K   I  S G S     N          Q    P + +++R        E  VA+ L            + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLGRIRTRRQSS--------GSATNVASTPDNRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALLLGDSRSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1053          

HSP 2 Score: 167.933 bits (424), Expect = 4.550e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1214 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1454          
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 264.233 bits (674), Expect = 2.861e-71
Identity = 233/796 (29.27%), Postives = 370/796 (46.48%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL--------------------------LSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNF---------------TGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQK--VSQSQPS---------TRDPSP------------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL---------KKSRR--NSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQ------------------------TVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L                          LS K     S       ++    +T  S+    S+                +G T  +SA +  P + +S   + +++QS+         +AT    T D RGR +   VSQSQ S         +R  SP                        S K   I  S G S     N          Q    P + +++R        E  VA+ L         K  RR    +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +                          T V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:   72 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLGRIRTRRQSS--------GSATNVASTPDNRGRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQPGRIPGSVNAMRVLSTSTDLEAAVADALLLGDSRSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKIADSEAECEDKEGNLFPSEVSCTRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 857          

HSP 2 Score: 167.933 bits (424), Expect = 3.628e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1018 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1258          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058849:1 gene:WBGene00000549.1 transcript:R107.6b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 160.614 bits (405), Expect = 1.734e-39
Identity = 170/696 (24.43%), Postives = 303/696 (43.53%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLD--LEIKNC----VSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS---ADVFKVPITNAVKTTVKSVTSKPSNFTGR-----------TRVNSAKSENPSANSSTEYLYSK-QQSNFGWRAAKPKT-ATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVA-----EGLKKSRRNSHDHY------QSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDL-RKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPT 2186
            +EISS  + +E L      L    +DW  R++ L+ +R ++       +D +   + L   + + +C    V DLRSQ++REA IT  FL K     +    E+ + S    V+   K+M+T G V   +IV    + +I     +  ++      RQ C+ LL+++ E+WN K        I E IK  I DAD +TR   R+AF   +       +KL  S+D +KQK L+    +     I+S      F+  ++      +++  +  S F  +           TR+ ++ S  P+    T    SK   S  G + A+P   A     +S+ R R   V  SQP +R+ SP  +    T +  A   +  +N     S +  SSL  ++A + Q A     E L++  RN  D +           T + S++ + ++    EV+   +S + N+++ G+      ++E +L   E K+L  + N +  E+   ++   L  + +FV  +H  L DWL   + KL   +  E   +SK +I   ++ ++ ++   +     C+ V D  +  + K R+ LLEY+  +L          N  ++   +  +  W A+ ++  L       ++  LF LN + FS L       ++D A  +L ++    Q V   +  S+    R T+  T
Sbjct:   31 MEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHG----EDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCA-LLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKMLRASDAASSSTSINSERGTAPFRSKLSAGSIGGIRNAPNISSKFLAQRSASAIDTKQVTRMATSVSRTPNIRPMTTRTLSKIDTSPGGSKFARPTVGALGSRTSSNLRAR-GSVPTSQPGSRNGSPP-RRPSATEAFPAEMQRVKSNL---GSNSFVSSLSAEEATKLQKAMNTAKESLRQPSRNDDDEFLLPKRPTPQKATPQKSALDTSRV---EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQIV---LESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYLNELLGKYMERGSSFNTKEMKATILKMFSWMADQRNEQLITPHGEKVLCSLFALNNADFSALFNDFNPDYRDWAYKVLQSH-GHDQHVPQQDAVSEEACVRATISTT 709          

HSP 2 Score: 63.5438 bits (153), Expect = 1.094e-9
Identity = 53/225 (23.56%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 2922 NDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKA-AEECSRVLTSTMP--RKVCLKMLI--DVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS--LLKLNNSQARLLEVYIKKGGS 3575
             D   ++   L  +  M  E + T W+++F  LL  + + +  +E D     A        LRVL ++  SQA R  + T++ I KVL+A  + +   +   A++C + L + +P  + V +  LI  + + +  +       LKM+ +L +    + +   V++L   +    +   S VRK +V C+V +   +G       L  L++ +  L++VY+ +  S
Sbjct:  800 GDMGAQQYEGLLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVA--------LRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEYLQEKAQEPKASLVLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLGMKTMEPHLQNLSSGKLNLVQVYVNRAMS 1016          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058882:1 gene:WBGene00000549.1 transcript:R107.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 160.614 bits (405), Expect = 1.734e-39
Identity = 170/696 (24.43%), Postives = 303/696 (43.53%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLD--LEIKNC----VSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS---ADVFKVPITNAVKTTVKSVTSKPSNFTGR-----------TRVNSAKSENPSANSSTEYLYSK-QQSNFGWRAAKPKT-ATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVA-----EGLKKSRRNSHDHY------QSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDL-RKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPT 2186
            +EISS  + +E L      L    +DW  R++ L+ +R ++       +D +   + L   + + +C    V DLRSQ++REA IT  FL K     +    E+ + S    V+   K+M+T G V   +IV    + +I     +  ++      RQ C+ LL+++ E+WN K        I E IK  I DAD +TR   R+AF   +       +KL  S+D +KQK L+    +     I+S      F+  ++      +++  +  S F  +           TR+ ++ S  P+    T    SK   S  G + A+P   A     +S+ R R   V  SQP +R+ SP  +    T +  A   +  +N     S +  SSL  ++A + Q A     E L++  RN  D +           T + S++ + ++    EV+   +S + N+++ G+      ++E +L   E K+L  + N +  E+   ++   L  + +FV  +H  L DWL   + KL   +  E   +SK +I   ++ ++ ++   +     C+ V D  +  + K R+ LLEY+  +L          N  ++   +  +  W A+ ++  L       ++  LF LN + FS L       ++D A  +L ++    Q V   +  S+    R T+  T
Sbjct:   31 MEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHG----EDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCA-LLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKMLRASDAASSSTSINSERGTAPFRSKLSAGSIGGIRNAPNISSKFLAQRSASAIDTKQVTRMATSVSRTPNIRPMTTRTLSKIDTSPGGSKFARPTVGALGSRTSSNLRAR-GSVPTSQPGSRNGSPP-RRPSATEAFPAEMQRVKSNL---GSNSFVSSLSAEEATKLQKAMNTAKESLRQPSRNDDDEFLLPKRPTPQKATPQKSALDTSRV---EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQIV---LESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYLNELLGKYMERGSSFNTKEMKATILKMFSWMADQRNEQLITPHGEKVLCSLFALNNADFSALFNDFNPDYRDWAYKVLQSH-GHDQHVPQQDAVSEEACVRATISTT 709          

HSP 2 Score: 63.5438 bits (153), Expect = 1.094e-9
Identity = 53/225 (23.56%), Postives = 104/225 (46.22%), Query Frame = 3
Query: 2922 NDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKA-AEECSRVLTSTMP--RKVCLKMLI--DVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS--LLKLNNSQARLLEVYIKKGGS 3575
             D   ++   L  +  M  E + T W+++F  LL  + + +  +E D     A        LRVL ++  SQA R  + T++ I KVL+A  + +   +   A++C + L + +P  + V +  LI  + + +  +       LKM+ +L +    + +   V++L   +    +   S VRK +V C+V +   +G       L  L++ +  L++VY+ +  S
Sbjct:  800 GDMGAQQYEGLLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVA--------LRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEYLQEKAQEPKASLVLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLGMKTMEPHLQNLSSGKLNLVQVYVNRAMS 1016          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058843:1 gene:WBGene00000549.1 transcript:R107.6a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 160.229 bits (404), Expect = 2.063e-39
Identity = 170/696 (24.43%), Postives = 303/696 (43.53%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLD--LEIKNC----VSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS---ADVFKVPITNAVKTTVKSVTSKPSNFTGR-----------TRVNSAKSENPSANSSTEYLYSK-QQSNFGWRAAKPKT-ATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVA-----EGLKKSRRNSHDHY------QSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDL-RKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPT 2186
            +EISS  + +E L      L    +DW  R++ L+ +R ++       +D +   + L   + + +C    V DLRSQ++REA IT  FL K     +    E+ + S    V+   K+M+T G V   +IV    + +I     +  ++      RQ C+ LL+++ E+WN K        I E IK  I DAD +TR   R+AF   +       +KL  S+D +KQK L+    +     I+S      F+  ++      +++  +  S F  +           TR+ ++ S  P+    T    SK   S  G + A+P   A     +S+ R R   V  SQP +R+ SP  +    T +  A   +  +N     S +  SSL  ++A + Q A     E L++  RN  D +           T + S++ + ++    EV+   +S + N+++ G+      ++E +L   E K+L  + N +  E+   ++   L  + +FV  +H  L DWL   + KL   +  E   +SK +I   ++ ++ ++   +     C+ V D  +  + K R+ LLEY+  +L          N  ++   +  +  W A+ ++  L       ++  LF LN + FS L       ++D A  +L ++    Q V   +  S+    R T+  T
Sbjct:   31 MEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHG----EDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCA-LLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKMLRASDAASSSTSINSERGTAPFRSKLSAGSIGGIRNAPNISSKFLAQRSASAIDTKQVTRMATSVSRTPNIRPMTTRTLSKIDTSPGGSKFARPTVGALGSRTSSNLRAR-GSVPTSQPGSRNGSPP-RRPSATEAFPAEMQRVKSNL---GSNSFVSSLSAEEATKLQKAMNTAKESLRQPSRNDDDEFLLPKRPTPQKATPQKSALDTSRV---EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQIV---LESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYLNELLGKYMERGSSFNTKEMKATILKMFSWMADQRNEQLITPHGEKVLCSLFALNNADFSALFNDFNPDYRDWAYKVLQSH-GHDQHVPQQDAVSEEACVRATISTT 709          

HSP 2 Score: 64.3142 bits (155), Expect = 7.530e-10
Identity = 55/223 (24.66%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 2922 NDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKA-AEECSRVLTSTMP--RKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS--LLKLNNSQARLLEVYIKKGGS 3575
             D   ++   L  +  M  E + T W+++F  LL  + + +  +E D     A        LRVL ++  SQA R  + T++ I KVL+A  + +   +   A++C + L + +P  + V +  LI       E +  L  LKM+ +L +    + +   V++L   +    +   S VRK +V C+V +   +G       L  L++ +  L++VY+ +  S
Sbjct:  800 GDMGAQQYEGLLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVA--------LRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEEKAQEPKASL-VLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLGMKTMEPHLQNLSSGKLNLVQVYVNRAMS 1013          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-2 (pep chromosome:WBcel235:III:9055052:9058882:1 gene:WBGene00000549.1 transcript:R107.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-2)

HSP 1 Score: 160.229 bits (404), Expect = 2.063e-39
Identity = 170/696 (24.43%), Postives = 303/696 (43.53%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLD--LEIKNC----VSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS---ADVFKVPITNAVKTTVKSVTSKPSNFTGR-----------TRVNSAKSENPSANSSTEYLYSK-QQSNFGWRAAKPKT-ATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVA-----EGLKKSRRNSHDHY------QSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDL-RKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPT 2186
            +EISS  + +E L      L    +DW  R++ L+ +R ++       +D +   + L   + + +C    V DLRSQ++REA IT  FL K     +    E+ + S    V+   K+M+T G V   +IV    + +I     +  ++      RQ C+ LL+++ E+WN K        I E IK  I DAD +TR   R+AF   +       +KL  S+D +KQK L+    +     I+S      F+  ++      +++  +  S F  +           TR+ ++ S  P+    T    SK   S  G + A+P   A     +S+ R R   V  SQP +R+ SP  +    T +  A   +  +N     S +  SSL  ++A + Q A     E L++  RN  D +           T + S++ + ++    EV+   +S + N+++ G+      ++E +L   E K+L  + N +  E+   ++   L  + +FV  +H  L DWL   + KL   +  E   +SK +I   ++ ++ ++   +     C+ V D  +  + K R+ LLEY+  +L          N  ++   +  +  W A+ ++  L       ++  LF LN + FS L       ++D A  +L ++    Q V   +  S+    R T+  T
Sbjct:   31 MEISSPSDFKEKLDQTIETLSKGQEDWNKRMNKLKQIRSMVVHG----EDVIGREQLLSQLVRLTDCLDLSVKDLRSQILREAAITCGFLFKRFGTDVRQIAERCLPSAFAQVAVSTKVMATCGAVLTLFIVEFIQTKQIFTCIASYSTSKDKNQRRQLCA-LLEIVLEHWNEKIKRTVLPQIGELIKAAICDADPETRVAGRKAFSKLDALHSTEADKLFASVDSSKQKMLRASDAASSSTSINSERGTAPFRSKLSAGSIGGIRNAPNISSKFLAQRSASAIDTKQVTRMATSVSRTPNIRPMTTRTLSKIDTSPGGSKFARPTVGALGSRTSSNLRAR-GSVPTSQPGSRNGSPP-RRPSATEAFPAEMQRVKSNL---GSNSFVSSLSAEEATKLQKAMNTAKESLRQPSRNDDDEFLLPKRPTPQKATPQKSALDTSRV---EEVIRACSSTSANEKREGIKMLAGIVSEPNLSNAEIKSLGAVLNRLLGESTNQIV---LESISSFVKTHHPRLSDWLKLGLGKLFAKKGAEMTLNSKKQISTTISCILSSFDPTLQLKSTCELVCDPIHLMSPKSRVVLLEYLNELLGKYMERGSSFNTKEMKATILKMFSWMADQRNEQLITPHGEKVLCSLFALNNADFSALFNDFNPDYRDWAYKVLQSH-GHDQHVPQQDAVSEEACVRATISTT 709          

HSP 2 Score: 64.3142 bits (155), Expect = 7.530e-10
Identity = 55/223 (24.66%), Postives = 103/223 (46.19%), Query Frame = 3
Query: 2922 NDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKA-AEECSRVLTSTMP--RKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS--LLKLNNSQARLLEVYIKKGGS 3575
             D   ++   L  +  M  E + T W+++F  LL  + + +  +E D     A        LRVL ++  SQA R  + T++ I KVL+A  + +   +   A++C + L + +P  + V +  LI       E +  L  LKM+ +L +    + +   V++L   +    +   S VRK +V C+V +   +G       L  L++ +  L++VY+ +  S
Sbjct:  800 GDMGAQQYEGLLSIQTMLCEGSFTLWEQNFAKLLIAVFDVLSKSESDANKKVA--------LRVLTKMCTSQASRLFDSTEMAICKVLDAAVNSQDGTMNVTADDCLKTLATHLPLAKVVNISQLILNEEKAQEPKASL-VLKMMTRLFEGLQADELSPVVDDLAPCVIKSYDSPSSAVRKTAVYCLVAMVNKLGMKTMEPHLQNLSSGKLNLVQVYVNRAMS 1013          
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Match: cls-3 (pep chromosome:WBcel235:III:9186556:9191127:-1 gene:WBGene00013847.1 transcript:ZC84.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cls-3)

HSP 1 Score: 131.724 bits (330), Expect = 1.357e-30
Identity = 144/627 (22.97%), Postives = 265/627 (42.26%), Query Frame = 3
Query:  270 ADDWQHRVDNLRILRGII----KANRFPT--DDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----ADVFKVPITNAVKTTVKS----------------VTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSD-PRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNN--FQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCIL-QLSQPSLLDTNNPDLGPMLGNILVWTAETK-STDLRKISSNIVIKLFDLNASQFSRLL 2054
            ++DW  R   L+ +R ++    K    PT     +Q +   +L +K    DLRSQV+REA IT +F+  +   +     E I+   M+ V+   KIM+TS     ++IV    + ++     +  ++   +  RQ  + LL+++   W+ +  ++    I E IK  I+DAD +TRA  R AF   +    +  + L   LD +KQK L+       GD   S     ++   +PI + +    K+                +  K + F G +R+    S    A   T     K  SNF     K    +A+I   + P  R +  S +   +RD SP+ ++  +      +  KY N   F K   P+T     +      ++   LK     +HD                      ++V+    S + +++K G+ K    + + SL P+E K + +  N +  +    ++   L +   FV  +   L +WL   + KL   +A E + ++K +I   LN++++ +      +  C+ + D  +    K R+ LLEY+  +L + ++P     N  +L   +  +L W ++ + S  L       +  +F +N + FS L+
Sbjct:   52 SEDWNKRQTQLKTVRSLVIHGEKVVDRPTMIAHLVQLLGCFELAVK----DLRSQVLREAAITCSFIVSKYGIETHSIGEDILVPAMSQVAVSTKIMATSASTLTEFIVEYVQTRQVFTILSSFSTSKDKSQRRQLAA-LLEIVISKWSDRIKKQIMRQICELIKSAINDADSETRAAGRRAFAKLDEMHSEEADALYLELDHSKQKMLRG------GDAASSWASVNSEKGSIPIRSKLSAGSKAHMNISAKFLAQRSASAIDPKATKFAGPSRLVRPTSTKTMARQDTSPAGCKY-SNFISMFFKTLLLSAKIPYPNRPGSRTRTSSITSTDSRDTSPTRRNSPLPPETQKARVKYGNGSFFAKLGMPDTTDDDEF--LLPIRIRSPLKTPTIEAHDK--------------------VSQVLKECCSSSVSEKKEGIKKLLPIVADTSLNPIEIKNIGNCLNRLLSDASNTMV---LEIYSIFVRTHSSRLSEWLRLALAKLFARKAAETLPNTKKQIGHTLNVILECFNAHHQLVTVCELMCDPIHLMVPKARVVLLEYLTSLLDEYTEPG-ASINAKELKTAIRKMLTWASDPRLSILLTPHVEKAICSMFCVNVADFSALI 640          

HSP 2 Score: 56.225 bits (134), Expect = 1.831e-7
Identity = 51/244 (20.90%), Postives = 117/244 (47.95%), Query Frame = 3
Query: 2871 LPPEDM-----MSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDP-EKSVIKAAEECSRVLTSTMPRKVCLKMLIDVIS-DGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS--LLKLNNSQARLLEVYIKKGGS 3575
            LPP+ +     + ++L+++ + ++  +E+++ +  +  M  +     W++ +  LL  L E +  +    ENN      +   LR+L ++  +QA +  + T++ + KVL+A  +  + +   A E+C R L + +P    + +   +++ +  +++     LKM+ +L +    E +   V+++   +        S VRK  V C+V +   +GE   +    KL  +   L++VY+ +  S
Sbjct:  743 LPPDTLEKIQNVQDLLQKMRS-SENADEQESAISSIYMMICDGGFGVWEQCYAKLLLNLFEILSKSRS--ENN------KKMCLRILGKMCTAQAAKLFDSTEMAVCKVLDAAVNTNDATTALAVEDCLRTLATHLPLSNIINIAKVILNQEPIDDERASLVLKMVTRLFEELPAEELNNIVDDITPTIIKAYQSTSSTVRKTVVYCLVAMVNRVGEQRMTPHFTKLPKAMTNLIQVYVNRAIS 977          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089460)

HSP 1 Score: 158.303 bits (399), Expect = 1.665e-38
Identity = 122/400 (30.50%), Postives = 191/400 (47.75%), Query Frame = 3
Query:  276 DWQHRVDNLRILRGIIKANRFPTDDFLQ-NIKFLDLEIKNCV-SDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRT-------RVNSAKSENPSANSSTEY-LYSKQQSNFGW-------------------------RAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCK-----SGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK 1355
            DW+ RVD L+ +R ++  +      F+   +K L L   + +  +LRSQV+REACIT+A++SK ++NKLD F   I+E L+NL+ N  K+++++  +ALKYI+  T++ ++L  +  T++ SKS  +R    EL+ L+ E W  K LE++++ + + +KK I DAD   R  SR A+  F   FP+L +++  +LD   Q+AL++E    +                  + TV  +   P      T        V++A ++   A    +Y LYS+Q+   G                              P T    + T  PRGR   VSQSQP +R  SPS K      G   Y  GA     T    KKAS    S+   ++   T+   GL K
Sbjct:  333 DWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE----REGGGGGGTGTGTGTAPETRRTVSRIGRTPGTLQKPTPSMRSISAVDTAAAQR--AKVRAQYTLYSRQRKPLGPNNSNQASMTGAAASGSLPRPRLNSNSGGTPATTPGSV-TPRPRGR-AGVSQSQPGSRSTSPSTKLRDQYGGIGNYYRGA-----TGAIPKKASGIPRSTASSRETSPTRSGGGLMK 719          

HSP 2 Score: 89.7373 bits (221), Expect = 1.816e-17
Identity = 101/445 (22.70%), Postives = 187/445 (42.02%), Query Frame = 3
Query:  960 TTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYIT----YSNGASDYKYTNNFQKKASPNTYSSL--RYKDAFET---------------QVAEGLKKSRRNSHDHYQSDDNTSETSSVISD----------------------------QLPSFNEVVVLLN---SKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPD-----LGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQ 2120
            TT  SVT +P    GR  V+ ++  + S + ST     K +  +G      + AT  I    P+ +   + +S  S+R+ SP+   G +     YS GA   + T        P+  + L  + ++A  T                +  G  +  R      +SDD  SE SSV S+                            Q   F+++  ++    S  W++RK GL    +Y+ +   L   + K ++D+F  MF++  T V   FL  +   +  + + LH+WL+ L+ +L      + + S   +I K L ++ + + T +      + ++D T  PT K R+ +L ++     L+      ++ P          +  +    A+ KS +LR  + + ++ L++LN  Q + LL  LP  +QD A S +++++  Q
Sbjct:  642 TTPGSVTPRPR---GRAGVSQSQPGSRSTSPST-----KLRDQYGGIGNYYRGATGAI----PK-KASGIPRSTASSRETSPTRSGGGLMKRSMYSTGAGSRR-TPERNNPVRPSAAARLLAQSREAEHTLGVGDDGQPDYVSGDYMRSGGMRMGRKLMGRDESDDIDSEASSVCSERSFDSSYTRGNKSNYSLSGSHTRLDWSTQRAPFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLT---DLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKVYQDSARSCIHSHMRRQ 1069          

HSP 3 Score: 61.2326 bits (147), Expect = 7.386e-9
Identity = 50/194 (25.77%), Postives = 108/194 (55.67%), Query Frame = 3
Query: 3000 DEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPR--FLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGT-ENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW--SLLKLNNSQARLLEVYIKK 3566
            ++HF++++ +LL     N ++ E+    +++    L VL ++ +S   R  ++ + +L +LK+++ ++  ++++        R+  S +P  + + ++  VI+ G     LC  A+K+L+++ ++   E  +A ++ +   L+   +  +S VRK +V C+V+L+ V+GE      L  LN S+ RLL VYI+K
Sbjct: 1289 NKHFRSIMRMLL-----NILEAEH----TDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHSKEALRDIDSMIPRIAPS-LPLDLSINIVNPVIATGEFPTNLC--AIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGEEKVKPKLSVLNPSKVRLLNVYIEK 1470          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089461)

HSP 1 Score: 158.303 bits (399), Expect = 1.665e-38
Identity = 122/400 (30.50%), Postives = 191/400 (47.75%), Query Frame = 3
Query:  276 DWQHRVDNLRILRGIIKANRFPTDDFLQ-NIKFLDLEIKNCV-SDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRT-------RVNSAKSENPSANSSTEY-LYSKQQSNFGW-------------------------RAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCK-----SGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK 1355
            DW+ RVD L+ +R ++  +      F+   +K L L   + +  +LRSQV+REACIT+A++SK ++NKLD F   I+E L+NL+ N  K+++++  +ALKYI+  T++ ++L  +  T++ SKS  +R    EL+ L+ E W  K LE++++ + + +KK I DAD   R  SR A+  F   FP+L +++  +LD   Q+AL++E    +                  + TV  +   P      T        V++A ++   A    +Y LYS+Q+   G                              P T    + T  PRGR   VSQSQP +R  SPS K      G   Y  GA     T    KKAS    S+   ++   T+   GL K
Sbjct:  333 DWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE----REGGGGGGTGTGTGTAPETRRTVSRIGRTPGTLQKPTPSMRSISAVDTAAAQR--AKVRAQYTLYSRQRKPLGPNNSNQASMTGAAASGSLPRPRLNSNSGGTPATTPGSV-TPRPRGR-AGVSQSQPGSRSTSPSTKLRDQYGGIGNYYRGA-----TGAIPKKASGIPRSTASSRETSPTRSGGGLMK 719          

HSP 2 Score: 89.7373 bits (221), Expect = 1.816e-17
Identity = 101/445 (22.70%), Postives = 187/445 (42.02%), Query Frame = 3
Query:  960 TTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYIT----YSNGASDYKYTNNFQKKASPNTYSSL--RYKDAFET---------------QVAEGLKKSRRNSHDHYQSDDNTSETSSVISD----------------------------QLPSFNEVVVLLN---SKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPD-----LGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQ 2120
            TT  SVT +P    GR  V+ ++  + S + ST     K +  +G      + AT  I    P+ +   + +S  S+R+ SP+   G +     YS GA   + T        P+  + L  + ++A  T                +  G  +  R      +SDD  SE SSV S+                            Q   F+++  ++    S  W++RK GL    +Y+ +   L   + K ++D+F  MF++  T V   FL  +   +  + + LH+WL+ L+ +L      + + S   +I K L ++ + + T +      + ++D T  PT K R+ +L ++     L+      ++ P          +  +    A+ KS +LR  + + ++ L++LN  Q + LL  LP  +QD A S +++++  Q
Sbjct:  642 TTPGSVTPRPR---GRAGVSQSQPGSRSTSPST-----KLRDQYGGIGNYYRGATGAI----PK-KASGIPRSTASSRETSPTRSGGGLMKRSMYSTGAGSRR-TPERNNPVRPSAAARLLAQSREAEHTLGVGDDGQPDYVSGDYMRSGGMRMGRKLMGRDESDDIDSEASSVCSERSFDSSYTRGNKSNYSLSGSHTRLDWSTQRAPFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLT---DLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKVYQDSARSCIHSHMRRQ 1069          

HSP 3 Score: 61.2326 bits (147), Expect = 7.386e-9
Identity = 50/194 (25.77%), Postives = 108/194 (55.67%), Query Frame = 3
Query: 3000 DEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPR--FLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGT-ENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW--SLLKLNNSQARLLEVYIKK 3566
            ++HF++++ +LL     N ++ E+    +++    L VL ++ +S   R  ++ + +L +LK+++ ++  ++++        R+  S +P  + + ++  VI+ G     LC  A+K+L+++ ++   E  +A ++ +   L+   +  +S VRK +V C+V+L+ V+GE      L  LN S+ RLL VYI+K
Sbjct: 1289 NKHFRSIMRMLL-----NILEAEH----TDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHSKEALRDIDSMIPRIAPS-LPLDLSINIVNPVIATGEFPTNLC--AIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGEEKVKPKLSVLNPSKVRLLNVYIEK 1470          
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Match: chb (gene:FBgn0021760 transcript:FBtr0089462)

HSP 1 Score: 158.303 bits (399), Expect = 1.665e-38
Identity = 122/400 (30.50%), Postives = 191/400 (47.75%), Query Frame = 3
Query:  276 DWQHRVDNLRILRGIIKANRFPTDDFLQ-NIKFLDLEIKNCV-SDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRT-------RVNSAKSENPSANSSTEY-LYSKQQSNFGW-------------------------RAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCK-----SGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK 1355
            DW+ RVD L+ +R ++  +      F+   +K L L   + +  +LRSQV+REACIT+A++SK ++NKLD F   I+E L+NL+ N  K+++++  +ALKYI+  T++ ++L  +  T++ SKS  +R    EL+ L+ E W  K LE++++ + + +KK I DAD   R  SR A+  F   FP+L +++  +LD   Q+AL++E    +                  + TV  +   P      T        V++A ++   A    +Y LYS+Q+   G                              P T    + T  PRGR   VSQSQP +R  SPS K      G   Y  GA     T    KKAS    S+   ++   T+   GL K
Sbjct:  333 DWEKRVDALKKIRALLILSYHTQPQFVAVQLKELSLSFVDILKEELRSQVIREACITIAYMSKTLRNKLDAFCWSILEHLINLIQNSAKVIASASTIALKYIIKYTHAPKLLKIYTDTLNQSKSKDIRSTLCELMVLLFEEWQTKALERNATVLRDTLKKSIGDADCDARRHSRYAYWAFRRHFPELADQIYGTLDIAAQRALERE----REGGGGGGTGTGTGTAPETRRTVSRIGRTPGTLQKPTPSMRSISAVDTAAAQR--AKVRAQYTLYSRQRKPLGPNNSNQASMTGAAASGSLPRPRLNSNSGGTPATTPGSV-TPRPRGR-AGVSQSQPGSRSTSPSTKLRDQYGGIGNYYRGA-----TGAIPKKASGIPRSTASSRETSPTRSGGGLMK 719          

HSP 2 Score: 89.7373 bits (221), Expect = 1.816e-17
Identity = 101/445 (22.70%), Postives = 187/445 (42.02%), Query Frame = 3
Query:  960 TTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYIT----YSNGASDYKYTNNFQKKASPNTYSSL--RYKDAFET---------------QVAEGLKKSRRNSHDHYQSDDNTSETSSVISD----------------------------QLPSFNEVVVLLN---SKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPD-----LGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQ 2120
            TT  SVT +P    GR  V+ ++  + S + ST     K +  +G      + AT  I    P+ +   + +S  S+R+ SP+   G +     YS GA   + T        P+  + L  + ++A  T                +  G  +  R      +SDD  SE SSV S+                            Q   F+++  ++    S  W++RK GL    +Y+ +   L   + K ++D+F  MF++  T V   FL  +   +  + + LH+WL+ L+ +L      + + S   +I K L ++ + + T +      + ++D T  PT K R+ +L ++     L+      ++ P          +  +    A+ KS +LR  + + ++ L++LN  Q + LL  LP  +QD A S +++++  Q
Sbjct:  642 TTPGSVTPRPR---GRAGVSQSQPGSRSTSPST-----KLRDQYGGIGNYYRGATGAI----PK-KASGIPRSTASSRETSPTRSGGGLMKRSMYSTGAGSRR-TPERNNPVRPSAAARLLAQSREAEHTLGVGDDGQPDYVSGDYMRSGGMRMGRKLMGRDESDDIDSEASSVCSERSFDSSYTRGNKSNYSLSGSHTRLDWSTQRAPFDDIETIIQFCASTHWSERKDGLISLTQYLADGKELTQQQLKCVLDMFRKMFMDTHTKVYSLFLDTVTELILVHANELHEWLFILLTRLFNKLGTDLLNSMHSKIWKTLQVVHEYFPTQLQLKELFRIISDSTQTPTTKTRIAILRFLT---DLANTYCKSSDFPSDQSQACERTVLKLAQLAADQKSMELRSQARSCLVALYNLNTPQMTLLLADLPKVYQDSARSCIHSHMRRQ 1069          

HSP 3 Score: 61.2326 bits (147), Expect = 7.386e-9
Identity = 50/194 (25.77%), Postives = 108/194 (55.67%), Query Frame = 3
Query: 3000 DEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPR--FLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGT-ENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW--SLLKLNNSQARLLEVYIKK 3566
            ++HF++++ +LL     N ++ E+    +++    L VL ++ +S   R  ++ + +L +LK+++ ++  ++++        R+  S +P  + + ++  VI+ G     LC  A+K+L+++ ++   E  +A ++ +   L+   +  +S VRK +V C+V+L+ V+GE      L  LN S+ RLL VYI+K
Sbjct: 1289 NKHFRSIMRMLL-----NILEAEH----TDVVIAGLHVLSKIMRSNKMRHNWMHFLELILLKIIQCYQHSKEALRDIDSMIPRIAPS-LPLDLSINIVNPVIATGEFPTNLC--AIKILLEVTEHHGSEITDAHLDIVFPNLARSADDTQSMVRKAAVFCIVKLYFVLGEEKVKPKLSVLNPSKVRLLNVYIEK 1470          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp1a (cytoplasmic linker associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-081104-520])

HSP 1 Score: 174.096 bits (440), Expect = 3.282e-43
Identity = 126/385 (32.73%), Postives = 196/385 (50.91%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKT----------TVKSVTSKP----------------------------SNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFG----WRAAKPKTATARIDTSDPRG--RIQKVSQSQPSTRDPSPSCKSGY 1223
            ++I S KEL +SL  I   L  D  DW+HRV  L+ +R ++ A     + F+Q ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  K+M+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKGI DAD + R+ +R+ +  F+G F +  E L Q+L+ T QKALQ  L S       S  +  +P ++   +          +VK+V   P                            +  + ++R+++A S  PS  S+   L     ++ G     R +     +A    +D RG  R + VSQSQP +R  SP    G+
Sbjct:  309 VQIYSSKELEDSLNKIREILSDDKQDWEHRVTALKKMRSLLMAGATEHEGFIQQLRLLEGAFKMSAKDLRSQVVREACITLGHLSSLLGNKFDHGAESIMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIP-IITSNCTSKSVAVRRRCYEFLDLLLQEWQTHTLERHVAVLTETIKKGIHDADSEARSVARKCYWGFHGHFSREAEHLFQALESTYQKALQSHLKS-------SDSIVSLPQSDRSSSSSQESLNRPLSVKTVIGGPVTRSKVIGSRVSSSSGSLQRSRSDIDVNAASSAKSRMSTATS--PSPFSAAAALPPGSYASLGRVRTRRQSSGSAVSANSTVTDSRGRSRAKVVSQSQPGSRSSSPGKLLGH 683          

HSP 2 Score: 168.318 bits (425), Expect = 1.903e-41
Identity = 95/230 (41.30%), Postives = 147/230 (63.91%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            D+++++LKELSNHN+R EERK  L  L+K+ RE++   WDEHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  ++    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1256 DLVADLLKELSNHNERVEERKGALIELLKITREDSLAVWDEHFKTILLLLLETLGDKD---------HTIRALALRVLKEILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTA-DYPINLAAIKMQTKVVERITKESLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPHLAQLTGSKMKLLNLYIKRA 1475          

HSP 3 Score: 141.354 bits (355), Expect = 3.386e-33
Identity = 97/329 (29.48%), Postives = 169/329 (51.37%), Query Frame = 3
Query: 1176 SQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNT-SETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            S+ S+RD SP+   G+         +   +  +  AS N    L      E  VA+ L+K  R     Y+SDD+  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +  + V   FL  L  FV  + + L DWL+ L+ +LL     + + S + ++QK L++  +++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P     N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  744 SRESSRDTSPA--RGFTPLDR----FGLIHQARISASVNAMRVLNTGTEVEAAVADALRKPLRR---RYESDDDANSDASSACSERSYSSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVTVHREDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPGDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1062          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 171.785 bits (434), Expect = 1.313e-42
Identity = 133/408 (32.60%), Postives = 204/408 (50.00%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKP----SNFTGRTRVNSAKSENPS------------ANSSTEYLYSKQQSNFG----------------WRAAKPKTATARIDTS--DPRGRIQK--VSQSQPSTRDPSPS---CKSGYITYSNGA 1244
            K+  GAV EEDF + F   P ++I S ++L ++L  I   L  D  DW HR + L+ +R ++ A     D F Q+++ LD   K    DLRSQVVREACITVA+LS  + NK D+  E I+  L NL+ N  K+M+TSG  A++ I+ +T+  R++P  + +  TSKS ++R+ C E L L+ + W    LE+ ++ + E+IKKGI DAD + R ++R+A+      FP   E L  SL+ + Q+ LQ  L S       S  V  +P ++   ++ +   ++P    S   GR    S  S +P+            A +  +  +S Q    G                 R  +  +  + + +S  D RGR +    SQSQP +R  SP      +   T S GA
Sbjct:   53 KEGAGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIP-LIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESLYNSLESSYQRTLQSCLKS-------SGSVASLPQSDRSSSSSQESLNRPLSKWSAAPGRVPAGSKSSGSPASLQRSRSDVDVNAAAGAKARHSGQAGGAGRVTTGLTPGSYASLGRLRTKQTLSTASSVGSSQVDSRGRTRSKMASQSQPGSRSGSPGRVLASTALSTLSTGA 452          

HSP 2 Score: 166.007 bits (419), Expect = 9.256e-41
Identity = 97/230 (42.17%), Postives = 144/230 (62.61%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            ++++E+LKELSNH++R EERKA L  L+++ RE     WDEHFKT+L LLLET+GD E           IRA +LRVL+E+   Q  RF  Y +LTI+K LEAHKDP K V++AAEE + +L +++    C+K+L  +I    +  + L A+KML K+I    +E +   +  +   L    ++ ES VRK  V C+V ++ VIGE +   L +L+ S+ +LL +YIK+ 
Sbjct: 1013 EVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGE---------HVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSA-DYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDLKPHLSQLSGSKLKLLNLYIKRA 1232          

HSP 3 Score: 145.976 bits (367), Expect = 1.428e-34
Identity = 122/456 (26.75%), Postives = 203/456 (44.52%), Query Frame = 3
Query:  960 TTVKSVTSKPSNFTGRTRVNSAKSENPSANSST--EYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPS----CKSGYI---TYSNGAS---------DYKYTNNFQKKASPN---TYSSLRYKDAF-------------------------------ETQVAEGLKKSRRNSHD---HYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            +T  SV S   +  GRTR   A    P + S +    L S   S          T   R+  +    R  ++ +SQ  +RD SP+     +   I   + S G S         D     +F   AS +   +  +L   DAF                               E  +A+ LKK  R  +D    Y  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +    +L  +E K L +IF  MF +  + V   FL  L  F+  + + L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P +K+++ +L+Y++ + LQ+     ++T    L   +  I+ WT E KS+D+RK + +++I LF LN  +F+ LL  LP TFQD AT +L  +L
Sbjct:  403 STASSVGSSQVDSRGRTRSKMASQSQPGSRSGSPGRVLASTALSTL-------STGAQRVSAAPGSHRRSRIPRSQGCSRDSSPTRLSVARGSRIPRPSVSQGCSREASRESSRDTSPVRSFTPLASRHYSRSTGALHAPDAFGAAGSGLGMSQSSRLSSSVSAMRVLNTGSDVEEALADALKKPARRRYDTYGMYSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRLA--VSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALPKTFQDGATKLLQNHL 849          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 171.4 bits (433), Expect = 2.546e-42
Identity = 133/408 (32.60%), Postives = 204/408 (50.00%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKP----SNFTGRTRVNSAKSENPS------------ANSSTEYLYSKQQSNFG----------------WRAAKPKTATARIDTS--DPRGRIQK--VSQSQPSTRDPSPS---CKSGYITYSNGA 1244
            K+  GAV EEDF + F   P ++I S ++L ++L  I   L  D  DW HR + L+ +R ++ A     D F Q+++ LD   K    DLRSQVVREACITVA+LS  + NK D+  E I+  L NL+ N  K+M+TSG  A++ I+ +T+  R++P  + +  TSKS ++R+ C E L L+ + W    LE+ ++ + E+IKKGI DAD + R ++R+A+      FP   E L  SL+ + Q+ LQ  L S       S  V  +P ++   ++ +   ++P    S   GR    S  S +P+            A +  +  +S Q    G                 R  +  +  + + +S  D RGR +    SQSQP +R  SP      +   T S GA
Sbjct:  292 KEGAGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIP-LIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESLYNSLESSYQRTLQSCLKS-------SGSVASLPQSDRSSSSSQESLNRPLSKWSAAPGRVPAGSKSSGSPASLQRSRSDVDVNAAAGAKARHSGQAGGAGRVTTGLTPGSYASLGRLRTKQTLSTASSVGSSQVDSRGRTRSKMASQSQPGSRSGSPGRVLASTALSTLSTGA 691          

HSP 2 Score: 165.236 bits (417), Expect = 1.648e-40
Identity = 97/230 (42.17%), Postives = 144/230 (62.61%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            ++++E+LKELSNH++R EERKA L  L+++ RE     WDEHFKT+L LLLET+GD E           IRA +LRVL+E+   Q  RF  Y +LTI+K LEAHKDP K V++AAEE + +L +++    C+K+L  +I    +  + L A+KML K+I    +E +   +  +   L    ++ ES VRK  V C+V ++ VIGE +   L +L+ S+ +LL +YIK+ 
Sbjct: 1239 EVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGE---------HVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSA-DYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDLKPHLSQLSGSKLKLLNLYIKRA 1458          

HSP 3 Score: 140.198 bits (352), Expect = 9.539e-33
Identity = 81/270 (30.00%), Postives = 146/270 (54.07%), Query Frame = 3
Query: 1353 KSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            + R +++  Y  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +    +L  +E K L +IF  MF +  + V   FL  L  F+  + + L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P +K+++ +L+Y++ + LQ+     ++T    L   +  I+ WT E KS+D+RK + +++I LF LN  +F+ LL  LP TFQD AT +L  +L
Sbjct:  808 RRRYDTYGMYSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRLA--VSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALPKTFQDGATKLLQNHL 1075          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp1a (cytoplasmic linker associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-081104-520])

HSP 1 Score: 171.014 bits (432), Expect = 2.863e-42
Identity = 96/232 (41.38%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLS 896
            ++I S KEL +SL  I   L  D  DW+HRV  L+ +R ++ A     + F+Q ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  K+M+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKGI DAD + R+ +R+ +  F+G F +  E L Q+L+ T QKALQ  L S
Sbjct:  311 VQIYSSKELEDSLNKIREILSDDKQDWEHRVTALKKMRSLLMAGATEHEGFIQQLRLLEGAFKMSAKDLRSQVVREACITLGHLSSLLGNKFDHGAESIMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIP-IITSNCTSKSVAVRRRCYEFLDLLLQEWQTHTLERHVAVLTETIKKGIHDADSEARSVARKCYWGFHGHFSREAEHLFQALESTYQKALQSHLKS 541          

HSP 2 Score: 168.318 bits (425), Expect = 2.321e-41
Identity = 95/230 (41.30%), Postives = 147/230 (63.91%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            D+++++LKELSNHN+R EERK  L  L+K+ RE++   WDEHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  ++    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1299 DLVADLLKELSNHNERVEERKGALIELLKITREDSLAVWDEHFKTILLLLLETLGDKD---------HTIRALALRVLKEILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTA-DYPINLAAIKMQTKVVERITKESLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPHLAQLTGSKMKLLNLYIKRA 1518          

HSP 3 Score: 136.732 bits (343), Expect = 1.147e-31
Identity = 97/330 (29.39%), Postives = 169/330 (51.21%), Query Frame = 3
Query: 1176 SQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNT-SETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            S+ S+RD SP+   G+         +   +  +  AS N    L      E  VA+ L+K  R     Y+SDD+  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +  +  V   FL  L  FV  + + L DWL+ L+ +LL     + + S + ++QK L++  +++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P     N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  752 SRESSRDTSPA--RGFTPLDR----FGLIHQARISASVNAMRVLNTGTEVEAAVADALRKPLRR---RYESDDDANSDASSACSERSYSSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFVTVHREDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPGDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1071          
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:404604])

HSP 1 Score: 167.548 bits (423), Expect = 3.239e-41
Identity = 111/307 (36.16%), Postives = 172/307 (56.03%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKP----SNFTGRTRVNSAKSENPSA 1046
            K+  GAV EEDF + F   P ++I S ++L ++L  I   L  D  DW HR + L+ +R ++ A     D F Q+++ LD   K    DLRSQVVREACITVA+LS  + NK D+  E I+  L NL+ N  K+M+TSG  A++ I+ +T+  R++P  + +  TSKS ++R+ C E L L+ + W    LE+ ++ + E+IKKGI DAD + R ++R+A+      FP   E L  SL+ + Q+ LQ  L S       S  V  +P ++   ++ +   ++P    S   GR    S  S +P++
Sbjct:   60 KEGAGAVDEEDFIKAFTDVPTVQIYSTRDLEDNLNKIREVLSDDKHDWDHRANALKKIRSLLVAGATDYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAYLSTLLGNKFDHGAEGIVPVLFNLIPNCAKVMATSGTAAIRIIIRHTHVPRLIP-LIASNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHAAVLVESIKKGIRDADAEARVEARKAYWGLRAHFPGEAESLYNSLESSYQRTLQSCLKS-------SGSVASLPQSDRSSSSSQESLNRPLSKWSAAPGRVPAGSKSSGSPAS 358          

HSP 2 Score: 166.007 bits (419), Expect = 8.352e-41
Identity = 97/230 (42.17%), Postives = 144/230 (62.61%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            ++++E+LKELSNH++R EERKA L  L+++ RE     WDEHFKT+L LLLET+GD E           IRA +LRVL+E+   Q  RF  Y +LTI+K LEAHKDP K V++AAEE + +L +++    C+K+L  +I    +  + L A+KML K+I    +E +   +  +   L    ++ ES VRK  V C+V ++ VIGE +   L +L+ S+ +LL +YIK+ 
Sbjct: 1051 EVVAELLKELSNHSERVEERKAALCELMRLIRETQLHVWDEHFKTILLLLLETLGDGE---------HVIRALALRVLKEILNRQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEEAASMLATSISPDQCIKVLCPIIQSA-DYPINLAAIKMLTKVIDRLPKEGLIQMLPEIVPGLIQGYDNSESSVRKACVFCLVAIYAVIGEDLKPHLSQLSGSKLKLLNLYIKRA 1270          

HSP 3 Score: 133.265 bits (334), Expect = 9.780e-31
Identity = 87/302 (28.81%), Postives = 151/302 (50.00%), Query Frame = 3
Query: 1326 ETQVAEGLKKSRRNSHD---HYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT--------------------VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            E  +A+ LKK  R  +D    Y  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +    +L  +E K L +IF  MF +  +                     V   FL  L  F+  + + L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P +K+++ +L+Y++ + LQ+     ++T    L   +  I+ WT E KS+D+RK + +++I LF LN  +F+ LL  LP TFQD AT +L  +L
Sbjct:  588 EEALADALKKPARRRYDTYGMYSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASANWSERKEGLMGLQALLKNHRTLSRVELKRLCEIFTRMFADPHSKRDPRGFGTVESGISSASFKRVFSMFLETLVDFIAVHKEDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEPQDFVNTGETRLA--VSRIITWTTEPKSSDVRKAAQSVLISLFQLNTPEFTMLLGALPKTFQDGATKLLQNHL 887          
BLAST of CLIP-associating protein 1 vs. Ensembl Xenopus
Match: TOGARAM2 (TOG array regulator of axonemal microtubules 2 [Source:NCBI gene;Acc:100495375])

HSP 1 Score: 55.0694 bits (131), Expect = 1.139e-6
Identity = 45/221 (20.36%), Postives = 98/221 (44.34%), Query Frame = 3
Query:  213 ISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGI----SDADEQTRAQSREAFCWFNG--KFPKLGEKLLQSLD 857
            I  +    + ++    +L++ DW+H+   L  +R +   +    D     +  +   +    ++LRS+V R A  T+  L K +K  +D  +E+I   L++ + +  + +      +L  +V N +  + LP  ++   + +++S+R+  ++ L  + E    + L   +    + + + +     D  + TR   R  FC   G  KF    E+L+ S D
Sbjct:  480 IGPMSHPEQGMIEALRQLNSKDWEHKEKGLGSVRCLSACH---PDVLYSRLHDVSTAVTREANNLRSKVSRHAIRTLGDLFKHLKRAMDPEVEEISRVLLHKIGDTNEFIREESDKSLGSMVENASPSKALPALISGGISHRNSSVRKCTAKYLLSVIEQLGAERLLSGTRESTDVLLRTVVRLNQDGQQDTRFYGRRMFCLLMGNPKFESQMERLIPSHD 697          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 280.026 bits (715), Expect = 4.485e-76
Identity = 233/755 (30.86%), Postives = 376/755 (49.80%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPI------TNAVKTTVKSVTSKPSNFTG---RTR----VNSAKSEN-------------------PSANSSTEYLYSKQQSNFGWR--AAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSP---------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGLKKSRRNSHD---HYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L +   D I S            +    P+      T +  +   +V++K  + TG   R+R    VN+A S                     P + +S   + +++QS+      A+ P  +  R        R + VSQSQP +R  SP                     S K   I  S G S     N          Q    P + +++R        E  VA+ LKK  R  ++    Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTASRGSTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGSPAFSSAAALPPGSYASLGRIRTRRQSSGSTTNVASTPSDSRGR-------SRAKVVSQSQPGSRSSSPGKLLGSGLAGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQSGRIPGSVNAMRVLSTSTDLEAAVADALKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1034          

HSP 2 Score: 167.548 bits (423), Expect = 3.910e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1195 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1435          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 279.256 bits (713), Expect = 7.504e-76
Identity = 232/760 (30.53%), Postives = 375/760 (49.34%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPI------TNAVKTTVKSVTSKPSNFTG---RTR----VNSAKSEN-------------------PSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSP---------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L +   D I S            +    P+      T +  +   +V++K  + TG   R+R    VN+A S                     P + +S   + +++QS+     +    A+   D S  R R + VSQSQP +R  SP                     S K   I  S G S     N          Q    P + +++R        E  VA+ L            + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  + V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTASRGSTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGSPAFSSAAALPPGSYASLGRIRTRRQSS----GSTTNVASTPSD-SRGRSRAKVVSQSQPGSRSSSPGKLLGSGLAGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQSGRIPGSVNAMRVLSTSTDLEAAVADALLLGDARSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1041          

HSP 2 Score: 167.548 bits (423), Expect = 3.549e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1202 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1442          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp1 (CLIP associating protein 1 [Source:MGI Symbol;Acc:MGI:1923957])

HSP 1 Score: 274.633 bits (701), Expect = 2.288e-74
Identity = 232/761 (30.49%), Postives = 375/761 (49.28%), Query Frame = 3
Query:  144 KQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPI------TNAVKTTVKSVTSKPSNFTG---RTR----VNSAKSEN-------------------PSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSP---------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDA---FETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            K+  GAV EEDF + F+  P ++I S ++L ES+  I   L  D  DW+ RV+ L+ +R ++ A     D+F Q+++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NL+ N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R ++R+ +  F+  F +  E L  +L+ + QKALQ  L +   D I S            +    P+      T +  +   +V++K  + TG   R+R    VN+A S                     P + +S   + +++QS+     +    A+   D S  R R + VSQSQP +R  SP                     S K   I  S G S     N          Q    P + +++R        E  VA+ L            + R   +  Y  DD  S+ SSV S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  291 KEGAGAVDEEDFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYDNFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPNSAKIMATSGVVAVRLIIRHTHIPRLIP-VITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSLERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTASRGSTVSTKSVSTTGSLQRSRSDIDVNAAASAKSKVSSSSGSPAFSSAAALPPGSYASLGRIRTRRQSS----GSTTNVASTPSD-SRGRSRAKVVSQSQPGSRSSSPGKLLGSGLAGGSSRGPPVTPSSEKRSKIPRSQGCSRETSPNRIGLDRFGLGQSGRIPGSVNAMRVLSTSTDLEAAVADALLLGDARSKKKPVRRRYEPYGMYSDDDANSDASSVCSERSYGSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1042          

HSP 2 Score: 167.548 bits (423), Expect = 3.612e-41
Identity = 99/251 (39.44%), Postives = 158/251 (62.95%), Query Frame = 3
Query: 2826 LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW-SLLKLNNSQARLLEVYIKKG 3569
            LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  +I    +  + L A+KM  K+++   +ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1203 LKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEERKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKD---------HSIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVVERITKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKPHLAQLTGSKMKLLNLYIKRA 1443          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp2 (CLIP associating protein 2 [Source:MGI Symbol;Acc:MGI:1923749])

HSP 1 Score: 171.4 bits (433), Expect = 2.044e-42
Identity = 151/492 (30.69%), Postives = 224/492 (45.53%), Query Frame = 3
Query:  138 NKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKT----------TVKSVTSKPSNFTGRTRVNSAKSENPSANS------------------STEYLYSKQQSNFGWRAAKPKTATARIDTSD-------------------------------PRGRIQKVSQSQPSTRDPSPS---CKSGYITYSNGA-------------SDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK--SRRNSHD 1376
            +K+   GAV E+DF + F   P ++I S +EL E+L  I   L  D  DW  R + L+ +R ++ A     D F Q+++ LD  +K    DLRSQVVREACITVA LS  + NK D+  E I+ +L NLV N  K+M+TSG  A+++I+ +T+  R++P  +T+  TSKS  +R+   E L L+ + W    LE+ ++ + E IKKGI DAD + R ++R+ +      FP   E L  SL+P+ QK+LQ  L S       S  V  +P ++   +          + K  T+ PS   GR  V  +K+ NP   S                        + +    G  A  P +  +  DTSD                                R R + VSQSQP +R  SP      +   T S+GA             S    +    ++ASP+  S  R        V++G  +  SR +S D
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIP-LITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKS-------SGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSVGGSKA-NPLPGSLQRSRSDIDVNAAAGAKAHHAAGQAVRSGRLGAGALNPGSYASLEDTSDKMDGTASDDGRVRAKLSTPLVAVGNAKTDSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGAQRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRD 545          

HSP 2 Score: 171.014 bits (432), Expect = 2.487e-42
Identity = 113/319 (35.42%), Postives = 178/319 (55.80%), Query Frame = 3
Query: 2637 SHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIA-------ELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            S P +S    G + +    P+  N++++          S P+ +S  S    P N   SIS   K  +        A        L   D+++E+LKELSNHN+R EERK  L+ L+K+ +E + + WDEHFKT+L LLLET+GD E           IRA +L+VL+E+ + Q  RF  Y +LT++K LEAHKDP K V+++AEE + VL +++  + C+K+L  +I    +  + L A+KM  K+I+  ++E++   +  +   L    ++ ES VRK  V C+V +H VIG+ +   L +L  S+ +LL +YIK+ 
Sbjct:  990 SGPGMSDPRAGGDAADGSQPALDNKASL--------LHSMPLHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKE---------PTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRA 1290          

HSP 3 Score: 140.584 bits (353), Expect = 6.305e-33
Identity = 80/269 (29.74%), Postives = 147/269 (54.65%), Query Frame = 3
Query: 1353 KSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            + R  S+  +  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P++K+++ +L+Y++ + +   P    TN+ +    +  ++ WT E KS+D+RK + +++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  625 RRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDF-TNSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 892          
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Match: Clasp2 (CLIP associating protein 2 [Source:MGI Symbol;Acc:MGI:1923749])

HSP 1 Score: 171.4 bits (433), Expect = 2.158e-42
Identity = 151/492 (30.69%), Postives = 224/492 (45.53%), Query Frame = 3
Query:  138 NKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKT----------TVKSVTSKPSNFTGRTRVNSAKSENPSANS------------------STEYLYSKQQSNFGWRAAKPKTATARIDTSD-------------------------------PRGRIQKVSQSQPSTRDPSPS---CKSGYITYSNGA-------------SDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK--SRRNSHD 1376
            +K+   GAV E+DF + F   P ++I S +EL E+L  I   L  D  DW  R + L+ +R ++ A     D F Q+++ LD  +K    DLRSQVVREACITVA LS  + NK D+  E I+ +L NLV N  K+M+TSG  A+++I+ +T+  R++P  +T+  TSKS  +R+   E L L+ + W    LE+ ++ + E IKKGI DAD + R ++R+ +      FP   E L  SL+P+ QK+LQ  L S       S  V  +P ++   +          + K  T+ PS   GR  V  +K+ NP   S                        + +    G  A  P +  +  DTSD                                R R + VSQSQP +R  SP      +   T S+GA             S    +    ++ASP+  S  R        V++G  +  SR +S D
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIP-LITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKS-------SGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSVGGSKA-NPLPGSLQRSRSDIDVNAAAGAKAHHAAGQAVRSGRLGAGALNPGSYASLEDTSDKMDGTASDDGRVRAKLSTPLVAVGNAKTDSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGAQRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRD 545          

HSP 2 Score: 171.014 bits (432), Expect = 2.582e-42
Identity = 113/319 (35.42%), Postives = 178/319 (55.80%), Query Frame = 3
Query: 2637 SHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIA-------ELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            S P +S    G + +    P+  N++++          S P+ +S  S    P N   SIS   K  +        A        L   D+++E+LKELSNHN+R EERK  L+ L+K+ +E + + WDEHFKT+L LLLET+GD E           IRA +L+VL+E+ + Q  RF  Y +LT++K LEAHKDP K V+++AEE + VL +++  + C+K+L  +I    +  + L A+KM  K+I+  ++E++   +  +   L    ++ ES VRK  V C+V +H VIG+ +   L +L  S+ +LL +YIK+ 
Sbjct:  970 SGPGMSDPRAGGDAADGSQPALDNKASL--------LHSMPLHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKE---------PTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRA 1270          

HSP 3 Score: 135.961 bits (341), Expect = 1.444e-31
Identity = 80/270 (29.63%), Postives = 148/270 (54.81%), Query Frame = 3
Query: 1353 KSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLE-NQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            + R  S+  +  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF + +   V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P++K+++ +L+Y++ + +   P    TN+ +    +  ++ WT E KS+D+RK + +++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  604 RRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDF-TNSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 872          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|A1A5G0|CLAP1_XENTR (CLIP-associating protein 1 OS=Xenopus tropicalis OX=8364 GN=clasp1 PE=1 SV=1)

HSP 1 Score: 285.419 bits (729), Expect = 5.348e-77
Identity = 222/725 (30.62%), Postives = 354/725 (48.83%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPITNAVKTTVKSVTSKPSNFTGRT------RVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATA---RIDT---------------SDPRG--RIQKVSQSQPSTRDPSPS--CKSGYITYSNGASDYKYTNNFQKKAS-----------------------------PNTYSSLRYKDAFETQVAEGLKKSRRNSHD---HYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            ++I S ++L ESL  I   L  D  DW+ R+  L+ +R ++ A     D F   ++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NLV N  KIM+TSG VA++ I+  T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R  +R+ +  F+  F K  E+L  +L+ + QKALQ  L +   D I S            +    P++ A ++   S  S+ S  T ++      R  S    N +  + ++       + F   AA P  + A   RI T               +D RG  R + VSQSQP +R  SP     SGY   ++G        + +K++                              P+    L      E  VA+ LKK  R  ++    Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  314 VQIYSSRDLEESLNKIREILSDDKHDWEQRISALKKIRSLLLAGAAEYDTFFPQLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTVFNLVPNSAKIMATSGVVAIRLIIRQTHVPRLIP-IITSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHVSVLAETIKKGIHDADSEARIVARKCYWGFHSHFSKEAEQLFHTLESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLS-AKRSPTGSTVSRASTATSKSTPGSLQRSRSDIDVNAATCAKSKATSGASAAPFSSVAALPPGSYASLGRIRTRRQSSGSTTSTASTPADTRGRSRAKVVSQSQPGSRSSSPGKLLGSGYGGIASGPQRVPQMPSSEKRSKIPRSQGCSRETSPSRIGLDRFGISQPGRIPSAMRVLSSSTDLEAAVADALKKPVRRRYEPYGMYSDDDANSDASSACSERSYSSKNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLIGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFVIIHKDDLQDWLFILLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1033          

HSP 2 Score: 167.933 bits (424), Expect = 1.802e-40
Identity = 110/306 (35.95%), Postives = 181/306 (59.15%), Query Frame = 3
Query: 2664 GGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKI-LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            GG+++      +  N++++ N   P  ++ GP       N  A  ++I S  K  LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE++   W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  +I    +  + L A+KM  K+I+  ++ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L   + +LL +YIK+ 
Sbjct: 1143 GGTDMVEGGRMALDNKTSLLNTQPPRAFT-GP--RGREYNPYAYSDSINSYDKTALKEAVFDDDMDQLRDVPIDHSDLVADLLKELSNHNERVEERKGALCELLKITREDSLAVWEEHFKTILLLLLETLGDKD---------HAIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERISKESLHQILPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGGKMKLLNLYIKRA 1435          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|A1A5K2|CLA1B_XENLA (CLIP-associating protein 1-B OS=Xenopus laevis OX=8355 GN=clasp1b PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 6.638e-74
Identity = 227/729 (31.14%), Postives = 351/729 (48.15%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPIT---NAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATA---RIDT---------------SDPRG--RIQKVSQSQPSTRDPS----------------------PSCKSGYITYSNGAS-----DYKYTNNF---QKKASPNTYSSLRYKDAFETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            ++I S ++L ESL  I   L  D  DW+ R+  L+ +R ++ A     D+F Q ++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E ++ ++ NLV N  KIM+TSG V ++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  S +AE IKKGI DAD + R  +R+ +  F+G F K  E+L  +L+ + QKALQ  L +   D I S            +    P++   +   +TV   TSK S      R  S    N +A S T+       + F   AA P  + A   RI T               +D RG  R + VSQSQP +R  S                      PS K   I  S G S          + F   Q    P+    L      E  VA+ L            + R   +  Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +  +  V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  314 VQIYSSRDLEESLNKIREILSDDKHDWEQRISALKKIRSLLLAGAAEYDNFFQQLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAVMPTVFNLVPNSTKIMATSGVVTIRLIIRHTHVPRLIP-IITSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHVSVLAETIKKGIHDADSEARIVARKCYWGFHGHFSKEAEQLFHALESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTVSRATSK-STTGSLQRSRSDIDVNAAATSKTKAASGASTAPFSSVAALPPGSYASLGRIRTRRQSSGSTTSTASTPADTRGRSRAKVVSQSQPGSRSSSPGKLLGSSYGGIATGPQRVPQMPSEKRSKIPRSQGCSRETSPSRTVLDRFGISQPGRIPSAMRVLSSSTDLEAAVADALLLGDSRNKMKPVRRRYEPYGMYSDDDANSDASSACSERSYSSKNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLVGLQNLLKSQRLLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFVIIHKDDLQDWLFILLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1037          

HSP 2 Score: 168.318 bits (425), Expect = 1.388e-40
Identity = 111/306 (36.27%), Postives = 181/306 (59.15%), Query Frame = 3
Query: 2664 GGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKI-LKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            GG+++      +  N++++ N   P  ++ GP       N  A  ++I S  K  LK  +    + ++ ++P +  D+++++LKELSNHN+R EERK  L  L+K+ RE+    W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  +I    +  + L A+KM  K+I+  ++ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1147 GGTDMVEGGRMALDNKTSLLNTQPPRAFT-GP--RGREYNPYAYSDSINSYDKTALKEAVFDDDMDQLRDVPIDHSDLVADLLKELSNHNERVEERKGALCELLKITREDNLAVWEEHFKTILLLLLETLGDKD---------HAIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERISKESLHQILPDIIPGLLQGYDNTESSVRKASVFCLVAVYSVIGEELKPYLAQLTGSKMKLLNLYIKRA 1439          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q4U0G1|CLA1A_XENLA (CLIP-associating protein 1-A OS=Xenopus laevis OX=8355 GN=clasp1-a PE=2 SV=2)

HSP 1 Score: 270.011 bits (689), Expect = 3.805e-72
Identity = 222/733 (30.29%), Postives = 353/733 (48.16%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPITNAVKTTVKSVTSKPSNFTGRT------RVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATA---RIDT---------------SDPRG--RIQKVSQSQPSTRDPSP-----------------------SCKSGYITYSNGASDYKYTNNF--------QKKASPNTYSSLRYKDAFETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQT-VVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            ++I S ++L ESL  I   L  D  DW+ R+  L+ +R ++ A     D+F Q ++ LD   K    DLRSQVVREACIT+  LS  + NK D+  E I+ ++ NLV N  KIM+TSG VA++ I+ +T+  R++P  +T+  TSKS ++R+ C + L L+ + W    LE+  S +AE IKKGI DAD + +  +R+ +  F+  F K  E L  +L+ + QKALQ  L +   D I S            +    P++   ++   S  S+ S+ T ++      R  S    N +A S ++       + F   AA P  + A   RI T               +D RG  R + VSQSQP +R  SP                       S K   I  S G S     +          Q+   P+    L      E  VA+ L            + R   +  Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++ +L  +E K L +IF  MF +  +  V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  314 VQIYSSRDLEESLNKIREILSDDKHDWEQRITALKKIRSLLLAGAAEYDNFFQQLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTVFNLVPNSAKIMATSGIVAIRLIIRHTHVPRLIP-IITSNCTSKSVAVRRRCYDFLDLLLQEWQTHSLERHVSVLAETIKKGIHDADSEAKIVARKCYWGFHSHFSKEAEHLFHTLESSYQKALQSHLKN--SDSIVSLPQSDRSSSSSQESLNRPLSTK-RSPTGSTVSRASSTTSKSTPGSLQRSRSDIDVNAAATSKSKAASGASTAPFISVAALPPGSYASLGRIRTRRQSSGSTTSTASTPADTRGRSRAKVVSQSQPGSRSNSPGKLLGSSYGGIATGPQRVPQMPSSEKRSRIPRSQGCSRETSPSRIGLDRFGISQQGRIPSAMRVLSSSTDLEAAVADALLLGDSRNKKKPVRRRYEPYGMYSDDDANSDASSACSERSYSSKNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEIFTRMFADPHSKRVFSMFLETLVDFVIIHKDDLQDWLFILLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1041          

HSP 2 Score: 166.777 bits (421), Expect = 4.431e-40
Identity = 96/230 (41.74%), Postives = 147/230 (63.91%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            D+++++LKELSNHN+R EERK  L  L+K+ RE+    W+EHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  +I    +  + L A+KM  K+I+  ++ES+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1224 DLVADLLKELSNHNERVEERKGALCELLKITREDNLAVWEEHFKTILLLLLETLGDKD---------HAIRALALRVLREILRNQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIIQTA-DYPINLAAIKMQAKVIERISKESLHQILPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKRA 1443          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|Q8BRT1|CLAP2_MOUSE (CLIP-associating protein 2 OS=Mus musculus OX=10090 GN=Clasp2 PE=1 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.508e-41
Identity = 151/492 (30.69%), Postives = 224/492 (45.53%), Query Frame = 3
Query:  138 NKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKT----------TVKSVTSKPSNFTGRTRVNSAKSENPSANS------------------STEYLYSKQQSNFGWRAAKPKTATARIDTSD-------------------------------PRGRIQKVSQSQPSTRDPSPS---CKSGYITYSNGA-------------SDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKK--SRRNSHD 1376
            +K+   GAV E+DF + F   P ++I S +EL E+L  I   L  D  DW  R + L+ +R ++ A     D F Q+++ LD  +K    DLRSQVVREACITVA LS  + NK D+  E I+ +L NLV N  K+M+TSG  A+++I+ +T+  R++P  +T+  TSKS  +R+   E L L+ + W    LE+ ++ + E IKKGI DAD + R ++R+ +      FP   E L  SL+P+ QK+LQ  L S       S  V  +P ++   +          + K  T+ PS   GR  V  +K+ NP   S                        + +    G  A  P +  +  DTSD                                R R + VSQSQP +R  SP      +   T S+GA             S    +    ++ASP+  S  R        V++G  +  SR +S D
Sbjct:   63 SKEGGAGAVDEDDFIKAFTDVPSVQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIP-LITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKS-------SGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSVGGSKA-NPLPGSLQRSRSDIDVNAAAGAKAHHAAGQAVRSGRLGAGALNPGSYASLEDTSDKMDGTASDDGRVRAKLSTPLVAVGNAKTDSRGRSRTKMVSQSQPGSRSGSPGRVLTTTALSTVSSGAQRVLVNSASAQKRSKIPRSQGCSREASPSRLSVARSSRIPRPSVSQGCSREASRESSRD 545          

HSP 2 Score: 171.014 bits (432), Expect = 1.714e-41
Identity = 113/319 (35.42%), Postives = 178/319 (55.80%), Query Frame = 3
Query: 2637 SHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIA-------ELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            S P +S    G + +    P+  N++++          S P+ +S  S    P N   SIS   K  +        A        L   D+++E+LKELSNHN+R EERK  L+ L+K+ +E + + WDEHFKT+L LLLET+GD E           IRA +L+VL+E+ + Q  RF  Y +LT++K LEAHKDP K V+++AEE + VL +++  + C+K+L  +I    +  + L A+KM  K+I+  ++E++   +  +   L    ++ ES VRK  V C+V +H VIG+ +   L +L  S+ +LL +YIK+ 
Sbjct:  969 SGPGMSDPRAGGDAADGSQPALDNKASL--------LHSMPLHSSPRSRDYNPYNYSDSISPFNKSALKEAMFDDDADQFPDDLSLDHSDLVAELLKELSNHNERIEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKE---------PTIRALALKVLKEILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERVSKETLNMLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRA 1269          

HSP 3 Score: 140.969 bits (354), Expect = 3.727e-32
Identity = 80/269 (29.74%), Postives = 147/269 (54.65%), Query Frame = 3
Query: 1353 KSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            + R  S+  +  DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P++K+++ +L+Y++ + +   P    TN+ +    +  ++ WT E KS+D+RK + +++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  604 RRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRIELKRLCEIFTRMFADPHGKVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDITRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPRDF-TNSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 871          
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Match: sp|O75122|CLAP2_HUMAN (CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3)

HSP 1 Score: 171.014 bits (432), Expect = 1.933e-41
Identity = 95/230 (41.30%), Postives = 149/230 (64.78%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            D+++E+LKELSNHN+R EERK  L+ L+K+ +E + + WDEHFKT+L LLLET+GD E           IRA +L+VL+E+ + Q  RF  Y +LT++K LEAHKDP K V+++AEE + VL +++  + C+K+L  +I    +  + L A+KM  K+I+  ++E++   +  +   L    ++ ES VRK  V C+V +H VIG+ +   L +L  S+ +LL +YIK+ 
Sbjct: 1058 DLVAELLKELSNHNERVEERKIALYELMKLTQEESFSVWDEHFKTILLLLLETLGDKE---------PTIRALALKVLREILRHQPARFKNYAELTVMKTLEAHKDPHKEVVRSAEEAASVLATSISPEQCIKVLCPIIQTA-DYPINLAAIKMQTKVIERVSKETLNLLLPEIMPGLIQGYDNSESSVRKACVFCLVAVHAVIGDELKPHLSQLTGSKMKLLNLYIKRA 1277          

HSP 2 Score: 168.703 bits (426), Expect = 1.013e-40
Identity = 115/310 (37.10%), Postives = 171/310 (55.16%), Query Frame = 3
Query:  138 NKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKT----------TVKSVTSKPSNFTGRTRVNSAKS 1031
            +K+   GAV E+DF + F   P I+I S +EL E+L  I   L  D  DW  R + L+ +R ++ A     D F Q+++ LD  +K    DLRSQVVREACITVA LS  + NK D+  E I+ +L NLV N  K+M+TSG  A+++I+ +T+  R++P  +T+  TSKS  +R+   E L L+ + W    LE+ ++ + E IKKGI DAD + R ++R+ +      FP   E L  SL+P+ QK+LQ  L S       S  V  +P ++   +          + K  T+ PS   GR    S+K+
Sbjct:   57 SKEGGAGAVDEDDFIKAFTDVPSIQIYSSRELEETLNKIREILSDDKHDWDQRANALKKIRSLLVAGAAQYDCFFQHLRLLDGALKLSAKDLRSQVVREACITVAHLSTVLGNKFDHGAEAIVPTLFNLVPNSAKVMATSGCAAIRFIIRHTHVPRLIP-LITSNCTSKSVPVRRRSFEFLDLLLQEWQTHSLERHAAVLVETIKKGIHDADAEARVEARKTYMGLRNHFPGEAETLYNSLEPSYQKSLQTYLKS-------SGSVASLPQSDRSSSSSQESLNRPFSSKWSTANPSTVAGRVSAGSSKA 358          

HSP 3 Score: 140.198 bits (352), Expect = 6.628e-32
Identity = 85/282 (30.14%), Postives = 153/282 (54.26%), Query Frame = 3
Query: 1326 ETQVAEGLKKSRRNSHDHY---QSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLE-NQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            E  VA+ LKK  R  ++ Y     DD  S+ SS  S++        +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF + +   V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  +++   + F +  +F  D+T  P++K+++ +L+Y++ + +   P     N+ +    +  ++ WT E KS+D+RK + +++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  599 EEAVADALKKPARRRYESYGMHSDDDANSDASSACSERSYSSRNGSIPTYMRQTEDVAEVLNRCASSNWSERKEGLLGLQNLLKNQRTLSRVELKRLCEIFTRMFADPHGKRVFSMFLETLVDFIQVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPNDLQFNILMRFTVDQTQTPSLKVKVAILKYIETLAKQMDPGDF-INSSETRLAVSRVITWTTEPKSSDVRKAAQSVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 879          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A4S2L4P5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009853 PE=4 SV=1)

HSP 1 Score: 530.791 bits (1366), Expect = 2.386e-162
Identity = 381/1246 (30.58%), Postives = 627/1246 (50.32%), Query Frame = 3
Query:  147 QEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIK--ANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSN---FTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRI---QKVSQSQPSTRDPSPSCKSGYITYS-------------------NGASDYKY---------------------TNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSR-----------------RNSHDHYQSDDNTSETSSVISDQ--------LPS------FNEVVVLLNSKTWNDRKRGLNKAEKYITEAS-LKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQ--KIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSIS---------------------KILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKK 3566
            Q  GAV E+ F  +F     I   S KEL + +  I + L   A++W+ RVD L+ LR ++   AN+F  ++F+  +K L+ ++  C+ DLRS VVREACITVA+LS+++  + D F E I+++L+ L+SN  KIM++SG +A+++I+ NT+S R+LP  +++++   + + +  C E L++I   W +  LEK    + +++++GI DAD++ R  SR AF  F  KFP     LLQ+LD  K+K ++K+L+      I      +    +  ++ V  VT +P+     T     N A+S  P  N        +   N   R A+  +    + ++ PRGR    + VSQSQP++R+ SP+ +  Y++Y                    NG +D +                      +    ++ SP    S   +  + TQ +   ++ R                  NS    +SDDN SETSS  SD+         PS        E++  L+   W+DRK GL   + Y+   S L P + + L +IF+ MF ++Q  V+  F+  L  F+  Y+  L DWLY+L+I+L   Q +E V S +  IQ+ L ++  ++   + F  CC+++ D    P IK+++CLLEY+K ++ +  P  L++ + ++   +  I+ W+ E KS ++R+++S +VIKL+DLN++ F+ + + LP   +DRAT +L AY       + T T + +      ++PT +A  +   +           T                       RTP    ++ PE  +  I+  TE LQ+L++                                       Q  T+   TPR+      P   + YD+     +LS   +  + +  NG S +SS +   T   SN+ N   P   S G I + V  +  AP   +G                        K+ KPVIGYQTLRKI E+PPED+MSEIL+ELSNHN+R+E+RKA + +LIK+ R+ T  +WDE+FK  L +LLET+GD+           E R+ +L+VLQEL +++   F ++  L ++KVL+A +D EK+V +AAEEC++ +   +P  +C  +L  +I+D T+ Q+ LPA+KM   +++NS  + +   ++ +   L +  NH++S +RK S+ CMV +   IG+ IW  L  L+ S+ RLL++YI +
Sbjct:   37 QGAGAVDEDMFRASFVPPMSITAYSSKELLDIMGRIKDNLSVPAEEWEKRVDALKTLRVLVANGANQF--EEFIPQLKTLETQVDGCLRDLRSSVVREACITVAYLSQQLGTRFDRFAETILQTLIGLMSNSAKIMASSGVLAIRFILENTHSPRLLPILMSSMTCKSNVTRKCIC-EFLEVIFRTWPVNVLEKHLGLLQDSLRRGIYDADQEARGFSRRAFPLFAEKFPDQANSLLQNLDAQKRKLIEKDLIGIGLGGIGDDGSARN--RSNSQSAVNPVTKRPNKPILGTAAVGANGARSRPPVTN--------QNDINTVGRYARHGSV---MSSAGPRGRGTGRKNVSQSQPTSREVSPT-RLAYMSYGIPGDYNQQGPYNAAGYAGRNGLADARQMGGATSTMSPYGVGTGSRIPRSQGASREPSPTRSVSGYQQPVYNTQYSSFRQRGRPSISTMSDYGDSVDTFMTNSRHPMESDDNFSETSSQCSDRSARSGFRRQPSVRVTSNLKEILGQLSGAQWSDRKDGLINLQNYMRSGSPLNPDDIRRLTEIFSKMFADSQRQVVSLFMDTLQFFIKEYNPLLRDWLYTLLIRLFNRQGSEAVGSYQKAIQEALFVVRSHFPLNLQFTNCCRYIMDNAQAPNIKVKVCLLEYLKDLILMMSPDALNSPSQEVTSAIARIISWSGEPKSPEIRRMASRVVIKLYDLNSTSFAAISQGLPRAIKDRATEVLKAY-------QKTTTGTGISSL---MEPTPTAPAWKPQSVDQDGHLSHGAT-----------------------RTPNDPGRLSPETMNNMIRQTTEGLQSLTVG-------------------------------------MQAPTAG--TPRRVSTGSVPNTAHQYDS-----YLSYNPA--QAAATNGMSEISSGVL-RTMQPSNIPN---PSSMSPGIIPSPVSHSYAAPPVPLGDSPTSARFDNRPLGTMGFDQGDGPKLKKPVIGYQTLRKIREMPPEDIMSEILQELSNHNERYEQRKASMLKLIKLLRDGTICNWDEYFKPTLLILLETLGDD---------GCETRSLALKVLQELVRAKPELFHDFACLFVIKVLDACRDEEKTVTRAAEECAKSIAQHLPPDLCFSVLTPLIND-TKMQVNLPAVKMQEHVVRNSPPDLVTDVLDVIIPGLIVACNHEDSSMRKASIFCMVAIALKIGDAIWEHLNDLHVSKKRLLKLYIDR 1172          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: H2KQ22 (CLIP-associating protein 1 (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_103052 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.720e-145
Identity = 352/1182 (29.78%), Postives = 595/1182 (50.34%), Query Frame = 3
Query:  156 GAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLH--ADDWQHRVDNLRILRGIIK--ANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFK-GDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSS---TEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRI---QKVSQSQPSTRDPSPSCKSGYITYS-------------------NGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDH----YQSDDNTSETSSVISDQLPSFNEVVVLLNS-KTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTV----VIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQ--KIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIG---SISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKK 3566
            GAV EE F  +F     I   S KEL + +  I + L   A++W+ RVD L+ LR ++   AN+F  ++F+  +K L+ ++  C+ DLRS VVREACITVA+LS+++  + D F E I+++L+ L+SN  KIM++SG +A+++I+ NT+S R+LP  +++++   + + +  C E L++I   W +  LEK    + +++++GI DAD++ R  SR AF  F  KFP     LLQ+LD  K+K ++K+L+    G   D +       +++    V    +KP   T     N A+S  P  N +   T   Y +  S               + ++ PRGR    + VSQSQP++R+ SP+ +  Y++Y                    NG +D +         SP       Y  A  +++      SR  S       YQ     ++ SS      PS + +    +S  T+    R   +++   +E S +  +R A      S F    +V    V+  F+  L  F+  Y+  L DWLY+L+I+L   Q +E V S +  IQ+ L ++  ++   + F+ CC+++ D    P IK+++CLLEY+K ++ +  P  L++ + ++   +  I+ W+ E KS ++R+++S +VIKL+DLN++ F+ + + LP   +DRAT +L AY       + T T + +      ++PT +A  + +  S        +                         RTP    ++ PE  +  I+  TE LQ+L++                                       Q  T+   TPR+      P   + YD+     +LS   +  + +  NG S +S  +   T   SN+    NP   S G I + V  +  AP   +G   + ++     +G     +  E+PPED+MSEIL+ELSNHN+R+E+RKA + +LIK+ R+ T  +WDE+FK  L +LLET+GD+           E R+ +L+VLQEL +++   F ++  L ++KVL+A +D EK+V +AAEEC++ +   +P  +C  +L  +I+D T+ Q+ LPA+KM   +++NS  + +   ++ +   L +  NH++S +RK S+ CMV +   IG+ IW  L  L+ S+ RLL++YI +
Sbjct:    2 GAVDEEMFRASFVPAMSITAYSSKELLDIMGRIKDNLSVSAEEWEKRVDALKTLRVLVANGANQF--EEFIPQLKTLETQVDGCLRDLRSSVVREACITVAYLSQQLGTRFDRFAETILQTLIGLMSNSAKIMASSGVLAIRFILENTHSPRLLPILMSSMTCKSNVTRKCIC-EFLEVIFRTWPVNVLEKHLGLLQDSLRRGIYDADQEARGFSRRAFPLFAEKFPDQANSLLQNLDAQKRKLIEKDLIGIGLGGVADDSSARNRSNSHSAVNPVTKRPNKPILGTAAVGANGARSRPPVTNQNDINTVGRYVRHGS--------------VVSSAGPRGRGNGRKNVSQSQPTSREVSPT-RLAYMSYGIPGDYNQQGPYNAAGYAGRNGLADARQMGGATMTMSP-------YGAAAGSRIPRSQGASREPSPTRSVSGYQQPVYNTQYSSFRQRGRPSISTMSDYGDSVDTFMTNSRHPMESDDNFSETSSQCSDRSA-----RSGFRRQPSVRVTSVVSLFMDTLQFFIKEYNPLLRDWLYTLLIRLFNRQGSEAVGSYQKAIQETLFVVRSHFPLNLQFINCCRYIMDNAQAPNIKVKVCLLEYLKDLILMMSPDALNSPSQEVTSAIARIISWSGEPKSPEIRRMASRVVIKLYDLNSTSFAAISQGLPRAIKDRATEVLKAY-------QKTTTGTGISSL---MEPTPTAPAW-KPQSIDQDGHLSHGAT----------------------RTPNDPGRLSPETMNNMIRQTTEGLQSLTVG-------------------------------------MQAPTAG--TPRRVSTGSVPNAAHQYDS-----YLSYDPA--QTAATNGMSEISGGVL-RTMQPSNIP---NPSSMSPGIIPSPVSHSYAAPPVPLGDSPTSARFDNRPLGTMGFDQGDEMPPEDIMSEILQELSNHNERYEQRKASMLKLIKLLRDGTICNWDEYFKPTLLILLETLGDD---------GCETRSLALKVLQELVRAKPELFHDFACLFVIKVLDACRDEEKTVTRAAEECAKSIAQHLPPDLCFSVLTPLIND-TKMQVNLPAVKMQEHVVRNSPPDLVTDVLDVIIPGLIVACNHEDSSMRKASIFCMVAIALKIGDAIWEHLNDLHVSKKRLLKLYIDR 1060          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A4Z2DGD7 (CLIP-associating protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001234 PE=4 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.213e-119
Identity = 269/837 (32.14%), Postives = 446/837 (53.29%), Query Frame = 3
Query: 1164 KVSQSQPSTRDPSP--SCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAE-------------GLKKSRRNSHDHYQSDDNTSETSSVISDQ----LPSFN------------EVVVLLNSKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSN--VSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSV-HSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKK 3566
            +V +SQ ++R+PSP  S  SGY   S     Y++ N FQ   + +    + Y+      +               G   S  N+   Y SDDN SETSS  S++    +P +             E++  L +  W+D+K GL   + Y+     L P + ++L +IF+ MF ++Q+ V+  F+  L  F+  Y+  L DWLY+L+I+LL  Q++E + S +  IQ+ L +L  ++     F  CC F+ D  + P  +++ CLLEY+K ++ +  P  +   + ++   +G I+ W+AE KS D+R+++S +VIKLFDLNA+ FS LL+ LP   QDRA  +L  Y       + T T   + +   T    NS+ K +  +  H  ++   + +  +     S++++  S    H      ++ PE  +  ++  T+ LQ+LSL        + +++ + ++   PG      Q G  +N +    T+  P     L    P+N  +      Q  +   N +   +   G  N   S S Y   +N++              P++T + +   D P        K+ KPVIGYQTL+KI E+PPED+MSEIL+ELSNHN+R+E+RK C+ +L+K+ R+   ++WDE+FK  L +LLET+GD+           E RA +LRVLQEL +++   F ++  L ++KVLEA +D EKSV++AAEEC+  +  ++P+++CL +L  +I+D ++  + LPA+KM +++++NS+ E +   VN L   L I  NH+ES +RK SV C+V +   +G+ IWS L +LN  + RLL++YI +
Sbjct:  273 RVPRSQGASREPSPTRSTASGYTMPS-----YQHNNTFQLSGA-SQIGQMNYRKQQRPSLGTLSDCADLGDGPLYGRHYSVGNNRGPYGSDDNFSETSSQCSERSGRSVPGYRRQPSVKVTSNLKEIIAQLQAVQWSDKKDGLTNLQNYLRSGYPLNPDDIRSLTEIFSKMFADSQSKVVSLFMDTLQFFIKEYNPLLRDWLYTLLIRLLYRQSHEALSSHQKAIQETLFVLRSHFPLNSQFNSCCHFIMDNAHTPNFRVKTCLLEYLKDLILMMSPDAIANPSNEVTNAIGKIISWSAEPKSADVRRMASRVVIKLFDLNATSFSTLLQSLPRGVQDRAHEVLKTY-------QKTATGGGLMNLTDTNHNHNSSWKSSSVDQDHIISSPPGSGRYASIGGPCSTYSAQRS----HDSASSGRVSPESMNRIMRETTDGLQSLSLGGGYSGMLTSVTSPTRRASADPGFTTSPLQYG--TNDYNAHITNGNPGV---LRTMQPSNFSNSQQAVSQPCIIPSNMNQTYASSEGVPNDPTSQSTYGLRTNKA--------------PLNTLINYDPTDGP--------KLKKPVIGYQTLKKIREMPPEDIMSEILQELSNHNERYEQRKTCMLKLMKLLRDGAISNWDEYFKPTLLILLETLGDD---------GHETRALALRVLQELVRAKPELFHDFAYLFVIKVLEACRDSEKSVVRAAEECANTVAQSLPQELCLNVLTPLIND-SQLHINLPAIKMQMQVVQNSSPELVHEFVNALIPGLVIACNHEESAIRKASVFCLVAIAMKLGDDIWSYLTELNAGKKRLLKLYIDR 1055          

HSP 2 Score: 97.4413 bits (241), Expect = 2.107e-16
Identity = 74/243 (30.45%), Postives = 130/243 (53.50%), Query Frame = 3
Query:  540 MSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTR------VNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASD 1250
            M+TSG VA+++I+ NT S R+LP  ++ +S+  + + +  C E L++I   W    LEK+ S + +A+++GISDAD++ R  SR +F  F  KFP+     LQ+LD  K+K ++K+L++  G  ++     ++  T + ++      S+ SN T ++       V    S   + N S   L S+ + N   R  +  +  +  D+       + VSQSQP++R+ SPS  + + TY    +D
Sbjct:    1 MATSGVVAMRFILENTFSSRLLPILISALSSKSNITRKCIC-EFLEIIFRTWPTNILEKNLSVLQDALRRGISDADQEARQFSRRSFPLFVEKFPEQANLFLQNLDAQKRKLIEKDLIA-AGLPLEGIVSGEINTTASSRSQSGGAGSQ-SNLTYQSTKRPNRPVLGTSSLANNTNRSRPPLTSQNEYNTVGRYVRQGSIVSNYDSRSLHTGRKLVSQSQPTSREVSPSRLAYFTTYGATVND 240          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A4Z2DG68 (CLIP-associating protein isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001234 PE=4 SV=1)

HSP 1 Score: 406.371 bits (1043), Expect = 3.002e-116
Identity = 272/851 (31.96%), Postives = 447/851 (52.53%), Query Frame = 3
Query: 1164 KVSQSQPSTRDPSP--SCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAE-------------GLKKSRRNSHDHYQSDDNTSETSSVISDQ----LPSFN------------EVVVLLNSKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAY-----------LSSQQAVRSTETASDVGDCRVTVKP-TNSASKFNRS-NSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSN--VSSSLYPSTSNESNVDN--KYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKK 3566
            +V +SQ ++R+PSP  S  SGY   S     Y++ N FQ   + +    + Y+      +               G   S  N+   Y SDDN SETSS  S++    +P +             E++  L +  W+D+K GL   + Y+     L P + ++L +IF+ MF ++Q+ V+  F+  L  F+  Y+  L DWLY+L+I+LL  Q++E + S +  IQ+ L +L  ++     F  CC F+ D  + P  +++ CLLEY+K ++ +  P  +   + ++   +G I+ W+AE KS D+R+++S +VIKLFDLNA+ FS LL+ LP   QDRA  +L  Y           L+      ++   S  G  R    P T   S   RS +  H  ++   + +  +     S++++  S    H      ++ PE  +  ++  T+ LQ+LSL        + +++ + ++   PG      Q G  +N +    T+  P     L    P+N  +      Q  +   N +   +   G  N   S S Y   +N++ ++    Y+P   + GP                    K+ KPVIGYQTL+KI E+PPED+MSEIL+ELSNHN+R+E+RK C+ +L+K+ R+   ++WDE+FK  L +LLET+GD+           E RA +LRVLQEL +++   F ++  L ++KVLEA +D EKSV++AAEEC+  +  ++P+++CL +L  +I+D ++  + LPA+KM +++++NS+ E +   VN L   L I  NH+ES +RK SV C+V +   +G+ IWS L +LN  + RLL++YI +
Sbjct:  441 RVPRSQGASREPSPTRSTASGYTMPS-----YQHNNTFQLSGA-SQIGQMNYRKQQRPSLGTLSDCADLGDGPLYGRHYSVGNNRGPYGSDDNFSETSSQCSERSGRSVPGYRRQPSVKVTSNLKEIIAQLQAVQWSDKKDGLTNLQNYLRSGYPLNPDDIRSLTEIFSKMFADSQSKVVSLFMDTLQFFIKEYNPLLRDWLYTLLIRLLYRQSHEALSSHQKAIQETLFVLRSHFPLNSQFNSCCHFIMDNAHTPNFRVKTCLLEYLKDLILMMSPDAIANPSNEVTNAIGKIISWSAEPKSADVRRMASRVVIKLFDLNATSFSTLLQSLPRGVQDRAHEVLKTYQKTATGGGLMNLTDTNHNHNSSWKSSSGPLRKYSLPVTTGRSSMTRSVDQDHIISSPPGSGRYASIGGPCSTYSAQRS----HDSASSGRVSPESMNRIMRETTDGLQSLSLGGGYSGMLTSVTSPTRRASADPGFTTSPLQYG--TNDYNAHITNGNPGV---LRTMQPSNFSNSQQAVSQPCIIPSNMNQTYASSEGVPNDPTSQSTYGLRTNKAPLNTLINYDP---TDGP--------------------KLKKPVIGYQTLKKIREMPPEDIMSEILQELSNHNERYEQRKTCMLKLMKLLRDGAISNWDEYFKPTLLILLETLGDD---------GHETRALALRVLQELVRAKPELFHDFAYLFVIKVLEACRDSEKSVVRAAEECANTVAQSLPQELCLNVLTPLIND-SQLHINLPAIKMQMQVVQNSSPELVHEFVNALIPGLVIACNHEESAIRKASVFCLVAIAMKLGDDIWSYLTELNAGKKRLLKLYIDR 1243          

HSP 2 Score: 184.882 bits (468), Expect = 2.967e-43
Identity = 129/376 (34.31%), Postives = 214/376 (56.91%), Query Frame = 3
Query:  147 QEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHA--DDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTR------VNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASD 1250
            Q  GAV E+ F Q+F  +  I  SS KEL + +  I + L    ++W+ RVD L+ LR I+       D+F+ ++K L+  I   + DLRS VVREACITVAFLS+EI+++ D F E ++++++ L+SN  K+M+TSG VA+++I+ NT S R+LP  ++ +S+  + + +  C E L++I   W    LEK+ S + +A+++GISDAD++ R  SR +F  F  KFP+     LQ+LD  K+K ++K+L++  G  ++     ++  T + ++      S+ SN T ++       V    S   + N S   L S+ + N   R  +  +  +  D+       + VSQSQP++R+ SPS  + + TY    +D
Sbjct:   36 QGAGAVDEDVFRQSFIPSMSITASSAKELIDIMNRIKDTLSGNPEEWEKRVDALKTLRAIVANGALQYDEFIPSLKTLENCIDLSLRDLRSSVVREACITVAFLSQEIRSRFDRFAESVLQTIIALLSNSAKVMATSGVVAMRFILENTFSSRLLPILISALSSKSNITRKCIC-EFLEIIFRTWPTNILEKNLSVLQDALRRGISDADQEARQFSRRSFPLFVEKFPEQANLFLQNLDAQKRKLIEKDLIA-AGLPLEGIVSGEINTTASSRSQSGGAGSQ-SNLTYQSTKRPNRPVLGTSSLANNTNRSRPPLTSQNEYNTVGRYVRQGSIVSNYDSRSLHTGRKLVSQSQPTSREVSPSRLAYFTTYGATVND 408          
BLAST of CLIP-associating protein 1 vs. TrEMBL
Match: A0A5K4EVE1 (Putative clasp2 protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 5.313e-115
Identity = 273/840 (32.50%), Postives = 448/840 (53.33%), Query Frame = 3
Query: 1164 KVSQSQPSTRDPSP--SCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVA---------------EGLKKSRRNSHDHYQSDDNTSETSSVISDQ----LPSFN------------EVVVLLNSKTWNDRKRGLNKAEKYITEA-SLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSAS-KFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQN---SHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKK 3566
            +V +SQ ++R+ SP  S  SGY   S     Y++ N+FQ   + N    + Y+   + + +                G   S  N+   Y SDDN SETSS  S++    +P +             E++  L +  W+DRK GL   + Y+     L P +   L +IF+ MF ++Q+ V+  F+  L  F+  Y+  L DWLY+L+I+LL  Q++E + S +  IQ+ L +L  ++     F  CC F+ D  + P  +++ CLLEYMK ++ +  P L+   + ++   +G I+ W+AE KS D+R+++S +VIKLFDLN++ FS LL+ LP   QDRA  +L  Y          +TA+  G   +T    NS S K +  +  H   +   + +  + +  Y S   + +S      +   ++ PE  +  I+  T+ LQ+LS+         +L++    S T          +  S++P + T            N+Y+ A N    NT + + +   N   S P  +     + + S++ PS ++        +P   S+  + T+          + G   K+ KPVIGYQTL+KI E+PPED+MSEIL+ELSNHN+R+E+RK C+ +LIK+ R+   ++WDE+FK  L +LLET+GD+           E RA +LRVLQEL +++   F ++  L ++KVLEA +D EKSV++AAE+C+  +   +P+++CL +L  +I+D ++  + LPA+KM +++I+NS+ E +   +N L   L I  NH+ES +RK SV C+V +   +G+ IWS L +LN  + RLL++YI +
Sbjct:  445 RVPRSQGASRETSPTRSTASGYTMPS-----YQHNNSFQLTGT-NQIGQMNYRRQQQQRPSLGTLSDCADLGDGPLYGRHYSTGNNRGPYGSDDNFSETSSQCSERSGRSVPGYRRQSSSKVTSNLKEIISQLQAVQWSDRKDGLTNLQNYMRSGYPLNPDDIHCLTEIFSKMFADSQSKVVSLFMDTLQFFIKEYNPLLRDWLYTLLIRLLYRQSHEALSSHQKAIQETLFVLRSHFPLNTQFNSCCHFIMDNAHTPNFRVKTCLLEYMKDLILMMSPDLIANPSNEVINAVGKIISWSAEPKSADVRRMASRVVIKLFDLNSTSFSNLLQSLPRGVQDRAHEVLKTY---------QKTATGGGLINLTDTNHNSPSWKSSSVDQDHMIFSPPSSGRYGSISGPYYSSQRSHNSAG----SDSGRVSPESMNRIIRETTDGLQSLSMGASG---GGILTSVGITSPT----------RRVSADPSFTT------------NDYTYATN---GNTGVLRTVQPNNFPNSQP--TALQSPNIIPSNVNPSYASSQGTTASNDPTLQSTYGLRTNKALLNTLINYDPGDGPKLKKPVIGYQTLKKIREMPPEDIMSEILQELSNHNERYEQRKTCMLKLIKLLRDGVISNWDEYFKPTLLILLETLGDD---------GHETRALALRVLQELVRAKPELFHDFAYLFVIKVLEACRDSEKSVVRAAEDCANTVAQNLPQELCLNVLTPLIND-SQLHINLPAIKMQMQVIQNSSPELVHEFINALIPGLVIACNHEESAIRKASVFCLVAIAMKLGDDIWSYLTELNAGKKRLLKLYIDR 1225          

HSP 2 Score: 189.504 bits (480), Expect = 9.807e-45
Identity = 132/373 (35.39%), Postives = 218/373 (58.45%), Query Frame = 3
Query:  147 QEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHA--DDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDE-IDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPR--GRIQKVSQSQPSTRDPSPSCKSGYITYSNGASD 1250
            Q  GAV E+ F Q+F  +  I  SS KEL E +  I + L    ++W+ RVD L+ LR I+       D+F+  +K L+  I   + DLRS VVREACITVAFLS+EI+N+ D F E ++++++ L+SN  K+M+TSG VA+++I+ NT S R+LP  ++++S+  + + +  C E L++I   W +  LEK+ S + +A+++GISDAD++ R  +R +F  F  KFP+     LQ+LD  K+K ++K+L++    E I + D      + +   +  ++T + +    R  + ++   N + N S   L S+ + N   R+ +  +  +  D S PR  GR + VSQSQP++R+ SPS  + +  Y    S+
Sbjct:   36 QGAGAVDEDVFRQSFIPSMSITASSGKELTEIINRIKDALSGNPEEWEKRVDALKTLRAIVANGALQYDEFIPLLKTLENSIDLSLRDLRSSVVREACITVAFLSQEIRNRFDRFAESVLQTIIALLSNSAKVMATSGVVAMRFILENTCSSRLLPILISSLSSKSNVTRKCIC-EFLEIIFRTWPLNILEKNLSVLQDALRRGISDADQEARLFTRRSFPLFVAKFPEQANLFLQNLDSQKRKLIEKDLIAAGLSEGIGAGDTATTGSSRSQPGSQSNLTYQSTKRPNRPVLGTSSLAN-NTNRSRPPLTSQNEYNTVGRSYRQGSIASNYD-SRPRQIGR-KLVSQSQPTSREVSPSRLAYFTAYGTTTSN 404          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 306.99 bits (785), Expect = 1.005e-84
Identity = 228/733 (31.11%), Postives = 362/733 (49.39%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSAD-----------------VFKVPITNAVKTTVKSVTSKPSNFTG---RTRVN-------SAKSENPSANSSTEY---------LYSKQQSNFGWRAAKPKT--------ATARIDTSDPRGRIQK--VSQSQPSTRDPSPSCKSGY--------------------ITYSNGAS-----------DYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDH---YQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            I+I S +EL +S+  I   L  D  DW+HRV  L+ +R ++ A     + FLQ ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  KIM+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKG+ DAD + R+ +R+ +  F+G F K  E+L Q+L+ T QKALQ  L S   D I S                     K  + N+  T  K +TSK S+  G   R+R +       SAKS  P+  ++  +          Y+   +  G+   + +T        A   +  +D RGR +   VSQSQP +R  SP    G+                    I  S G S            +   +  +  AS N    L      E  VA+ L++  R  ++    Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   PS    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  304 IQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIP-IMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLFQALELTYQKALQSHLKS--SDSIMSLPQSDRSSSSSQESLNRPLSAKAAVGNSSVTRTKVITSKVSSTPGSLQRSRSDVDVNAAASAKSRMPTVPAAAPFSSATALPPGSYASLDATPGYMEGRVRTRRQSSVNSAGGGVSVTDSRGRSRAKVVSQSQPGSRSSSPGKLGGHSYGRVPRATGSATPSEKRSKIPRSQGCSRETSPSRSGQDRFGLIHQARISASVNAMRILNTGMEVEAAVADALRRPMRRRYESPGMYSDDDANSDASSACSERSYSSRNGGVPHYMRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1032          

HSP 2 Score: 164.851 bits (416), Expect = 1.900e-40
Identity = 103/283 (36.40%), Postives = 165/283 (58.30%), Query Frame = 3
Query: 2730 YNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI-WSLLKLNNSQARLLEVYIKKG 3569
            Y+         D  V   RD  + + G  +KI+ P       +  +  P +  +++ ++LKELS H++R EER+A L  L+K+ R+++   W+EHFKT+L LLLETMGD +           IRA +LRVL+E+ +SQ  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  ++    +  + L A+KM  K+I+   ++S+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1223 YDKSALREAVFDDDVEQFRDGRRQDFGE-NKIMHP-------KSFSTGPTQNLELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKD---------HTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTA-DYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKQHLGQLTGSKMKLLNLYIKRA 1487          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 301.597 bits (771), Expect = 2.837e-83
Identity = 227/725 (31.31%), Postives = 361/725 (49.79%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSAD-----------------VFKVPITNAVKTTVKSVTSKPSNFTG---RTRVN-------SAKSENPSANSSTEY-----LYSKQQSNFG----WRAAKPKTATARIDTSDPRG--RIQKVSQSQPSTRDPSPSCKSGY--------------------ITYSNGAS-----------DYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDH---YQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            I+I S +EL +S+  I   L  D  DW+HRV  L+ +R ++ A     + FLQ ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  KIM+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKG+ DAD + R+ +R+ +  F+G F K  E+L Q+L+ T QKALQ  L S   D I S                     K  + N+  T +  +TSK S+  G   R+R +       SAKS  P+  ++  +     L     ++ G     R +   +A   +  +D RG  R + VSQSQP +R  SP    G+                    I  S G S            +   +  +  AS N    L      E  VA+ L++  R  ++    Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   PS    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  273 IQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIP-IMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLFQALELTYQKALQSHLKS--SDSIMSLPQSDRSSSSSQESLNRPLSAKAAVGNSSVTRI--ITSKVSSTPGSLQRSRSDVDVNAAASAKSRMPTVPAAAPFSSATALPPGSYASLGRVRTRRQSSVNSAGGGVSVTDSRGRSRAKVVSQSQPGSRSSSPGKLGGHSYGRVPRATGSATPSEKRSKIPRSQGCSRETSPSRSGQDRFGLIHQARISASVNAMRILNTGMEVEAAVADALRRPMRRRYESPGMYSDDDANSDASSACSERSYSSRNGGVPHYMRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 991          

HSP 2 Score: 162.155 bits (409), Expect = 1.240e-39
Identity = 93/230 (40.43%), Postives = 147/230 (63.91%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI-WSLLKLNNSQARLLEVYIKKG 3569
            +++ ++LKELS H++R EER+A L  L+K+ R+++   W+EHFKT+L LLLETMGD +           IRA +LRVL+E+ +SQ  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  ++    +  + L A+KM  K+I+   ++S+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1165 ELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKD---------HTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTA-DYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKQHLGQLTGSKMKLLNLYIKRA 1384          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 298.13 bits (762), Expect = 5.946e-82
Identity = 229/733 (31.24%), Postives = 359/733 (48.98%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSAD-----------------VFKVPITNAVKTTVKSVTSKPSNFTG---RTRVN-------SAKSENPSANSSTEY-----LYSKQQSNFGW----RAAKPKTATARIDTSDPRGRIQK--VSQSQPSTRDPSPSCKSGY--------------------ITYSNGASD-----------YKYTNNFQKKASPNTYSSLRYKDAFETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            I+I S +EL +S+  I   L  D  DW+HRV  L+ +R ++ A     + FLQ ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  KIM+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKG+ DAD + R+ +R+ +  F+G F K  E+L Q+L+ T QKALQ  L S   D I S                     K  + N+  T  K +TSK S+  G   R+R +       SAKS  P+  ++  +     L     ++ G     R +   +A   +  +D RGR +   VSQSQP +R  SP    G+                    I  S G S            +   +  +  AS N    L      E  VA+ L            + R  S   Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   PS    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  304 IQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIPI-MTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLFQALELTYQKALQSHLKS--SDSIMSLPQSDRSSSSSQESLNRPLSAKAAVGNSSVTRTKVITSKVSSTPGSLQRSRSDVDVNAAASAKSRMPTVPAAAPFSSATALPPGSYASLGRVRTRRQSSVNSAGGGVSVTDSRGRSRAKVVSQSQPGSRSSSPGKLGGHSYGRVPRATGSATPSEKRSKIPRSQGCSRETSPSRSGQDRFGLIHQARISASVNAMRILNTGMEVEAAVADALLLGDSRNKRRPMRRRYESPGMYSDDDANSDASSACSERSYSSRNGGVPHYMRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1032          

HSP 2 Score: 154.836 bits (390), Expect = 2.342e-37
Identity = 95/261 (36.40%), Postives = 152/261 (58.24%), Query Frame = 3
Query: 2730 YNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI 3506
            Y+         D  V   RD  + + G  +KI+ P       +  +  P +  +++ ++LKELS H++R EER+A L  L+K+ R+++   W+EHFKT+L LLLETMGD +           IRA +LRVL+E+ +SQ  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  ++    +  + L A+KM  K+I+   ++S+   + ++   L    ++ ES VRK SV C+V ++ VIGE +
Sbjct: 1183 YDKSALREAVFDDDVEQFRDGRRQDFGE-NKIMHP-------KSFSTGPTQNLELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKD---------HTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTA-DYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1425          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 295.434 bits (755), Expect = 4.557e-81
Identity = 228/746 (30.56%), Postives = 361/746 (48.39%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSAD-----------------VFKVPITNAVKTTVKSVTSKPSNFTG---RTRVN-------SAKSENPSANSSTEY---------LYSKQQSNFGWRAAKPKT--------ATARIDTSDPRGRIQK--VSQSQPS---------------------------------TRDPSPSCKSGYITYSNGAS-----------DYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDH---YQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            I+I S +EL +S+  I   L  D  DW+HRV  L+ +R ++ A     + FLQ ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  KIM+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKG+ DAD + R+ +R+ +  F+G F K  E+L Q+L+ T QKALQ  L S   D I S                     K  + N+  T  K +TSK S+  G   R+R +       SAKS  P+  ++  +          Y+   +  G+   + +T        A   +  +D RGR +   VSQSQ S                                 T   +PS K   I  S G S            +   +  +  AS N    L      E  VA+ L++  R  ++    Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   PS    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  304 IQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIP-IMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLFQALELTYQKALQSHLKS--SDSIMSLPQSDRSSSSSQESLNRPLSAKAAVGNSSVTRTKVITSKVSSTPGSLQRSRSDVDVNAAASAKSRMPTVPAAAPFSSATALPPGSYASLDATPGYMEGRVRTRRQSSVNSAGGGVSVTDSRGRSRAKVVSQSQRSKSANPVGGKTYAGSRSSSPGKLGGHSYGRVPRATGSATPSEKRSKIPRSQGCSRETSPSRSGQDRFGLIHQARISASVNAMRILNTGMEVEAAVADALRRPMRRRYESPGMYSDDDANSDASSACSERSYSSRNGGVPHYMRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1045          

HSP 2 Score: 154.836 bits (390), Expect = 2.144e-37
Identity = 95/261 (36.40%), Postives = 152/261 (58.24%), Query Frame = 3
Query: 2730 YNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI 3506
            Y+         D  V   RD  + + G  +KI+ P       +  +  P +  +++ ++LKELS H++R EER+A L  L+K+ R+++   W+EHFKT+L LLLETMGD +           IRA +LRVL+E+ +SQ  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  ++    +  + L A+KM  K+I+   ++S+   + ++   L    ++ ES VRK SV C+V ++ VIGE +
Sbjct: 1236 YDKSALREAVFDDDVEQFRDGRRQDFGE-NKIMHP-------KSFSTGPTQNLELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKD---------HTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTA-DYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDL 1478          
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Match: CLASP1 (cytoplasmic linker associated protein 1 [Source:HGNC Symbol;Acc:HGNC:17088])

HSP 1 Score: 295.049 bits (754), Expect = 5.332e-81
Identity = 228/746 (30.56%), Postives = 361/746 (48.39%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSAD-----------------VFKVPITNAVKTTVKSVTSKPSNFTG---RTRVN-------SAKSENPSANSSTEY---------LYSKQQSNFGWRAAKPKT--------ATARIDTSDPRGRIQK--VSQSQPS---------------------------------TRDPSPSCKSGYITYSNGAS-----------DYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDH---YQSDDNTSETSSVISDQ--------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            I+I S +EL +S+  I   L  D  DW+HRV  L+ +R ++ A     + FLQ ++ L+   K    DLRSQVVREACIT+  LS  + NK D+  E I+ +L+NLV N  KIM+TSG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C E L L+ + W    LE+  + + E IKKG+ DAD + R+ +R+ +  F+G F K  E+L Q+L+ T QKALQ  L S   D I S                     K  + N+  T  K +TSK S+  G   R+R +       SAKS  P+  ++  +          Y+   +  G+   + +T        A   +  +D RGR +   VSQSQ S                                 T   +PS K   I  S G S            +   +  +  AS N    L      E  VA+ L++  R  ++    Y  DD  S+ SS  S++        +P +     +V  +LN   S  W++RK GL   +  + ++  L  +E K L +IF  MF +    V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++QK L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + +   PS    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD AT +L+ +L
Sbjct:  304 IQIYSSRELEDSMNKIREVLSDDKHDWEHRVAALKKVRSLLLAGATDHEGFLQQLRQLESAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAESIMPTLLNLVPNSAKIMATSGIAAIRLIIRHTHYPRLIP-IMTSNCTSKSVAVRRRCYEFLDLLLQEWQTHSLERHIAVLMETIKKGVHDADSEARSVARKCYWGFHGHFSKEAEQLFQALELTYQKALQSHLKS--SDSIMSLPQSDRSSSSSQESLNRPLSAKAAVGNSSVTRTKVITSKVSSTPGSLQRSRSDVDVNAAASAKSRMPTVPAAAPFSSATALPPGSYASLDATPGYMEGRVRTRRQSSVNSAGGGVSVTDSRGRSRAKVVSQSQRSKSANPVGGKTYAGSRSSSPGKLGGHSYGRVPRATGSATPSEKRSKIPRSQGCSRETSPSRSGQDRFGLIHQARISASVNAMRILNTGMEVEAAVADALRRPMRRRYESPGMYSDDDANSDASSACSERSYSSRNGGVPHYMRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRILSRVELKRLCEIFTRMFADPHGKVFSMFLETLVDFITLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRDSFPYDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPSDF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQMVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNHL 1045          

HSP 2 Score: 164.851 bits (416), Expect = 2.084e-40
Identity = 103/283 (36.40%), Postives = 165/283 (58.30%), Query Frame = 3
Query: 2730 YNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI-WSLLKLNNSQARLLEVYIKKG 3569
            Y+         D  V   RD  + + G  +KI+ P       +  +  P +  +++ ++LKELS H++R EER+A L  L+K+ R+++   W+EHFKT+L LLLETMGD +           IRA +LRVL+E+ +SQ  RF  Y +LTI+K LEAHKD  K V++AAEE +  L S++  + C+K+L  ++    +  + L A+KM  K+I+   ++S+   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1196 YDKSALREAVFDDDVEQFRDGRRQDFGE-NKIMHP-------KSFSTGPTQNLELVGDLLKELSGHSERVEERRAALLELLKVTRDDSVAVWEEHFKTMLLLLLETMGDKD---------HTIRALALRVLKEILRSQPARFKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIVQTA-DYPIDLAAIKMQTKVIERIPQDSLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLKQHLGQLTGSKMKLLNLYIKRA 1460          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003792.1 (pep scaffold:Pmarinus_7.0:GL477033:101956:230147:1 gene:ENSPMAG00000003427.1 transcript:ENSPMAT00000003792.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.17 bits (435), Expect = 2.505e-43
Identity = 133/382 (34.82%), Postives = 196/382 (51.31%), Query Frame = 3
Query:  210 EISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKEL---------------LSFKGDEIDSADVFKVPI-------TNAVKTTVKSVTSKPSNFT-GRTR----VNSAKSEN-----PSANSSTEYLYSKQ--QSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGAS 1247
            +I S ++L ESL  +   L  D  DW+ RV  L+ LR ++ A     D F Q+++ LD  +K    DLRSQVVREACIT++ L+  +KNK D+  E  + +L+NLV+N  KIM+TSG VA++ I+ NT++ R++P  LT   TSKS ++R+ C E L L+   W    LEK    + + IKKGI DAD   R ++R+A+    G FP   E L  +L+P+ QKALQ +L                S   + ++     K P+       T  V  + KS+T  P+  +  R+R    VN+A S       PS++++   L S+   Q  FG  AA P  + A +      GR+          R   PS  S +  +S  AS
Sbjct:  323 QIFSTRDLEESLAKVREVLADDKHDWEQRVTALKKLRSLVIAGATEYDCFFQHLRLLDAALKLSAKDLRSQVVREACITLSHLALVLKNKFDHTAESTLPTLLNLVANSAKIMATSGVVAIRIIIRNTHAPRLIP-LLTNNCTSKSVAVRRRCFEFLDLMLHEWQQNTLEKHIGLLVDTIKKGIHDADSDARMEARKAYWGLRGNFPAEAEALFAALEPSYQKALQSQLRGSSSVGSLPRSDHSTSSSQESLNRPASAKRPLSSPSANATGRVSGSSKSLTGVPATASLTRSRSDIDVNAAASAKSRATPPSSSAAPPGLASRSAAQPRFGAAAALPPGSYASL------GRV----------RSRRPSAGSAHSAHSATAS 687          

HSP 2 Score: 140.584 bits (353), Expect = 1.233e-33
Identity = 99/311 (31.83%), Postives = 165/311 (53.05%), Query Frame = 3
Query: 2655 IDNGGSNVSSSLYPSTSNESN-VDNKYNPEYYSSGPID-TSVHSNRDAP-QNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHND--RHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWS-LLKLNNSQARLLEVYIKKG 3569
            +DN  S++ ++L P  +  S+ +   YNP +Y+   I   SVH +     ++  G +S+                     M+S+IL+EL+   D  R EER+  L  L+K+ RE+     DE FK +L  LL+T+ D         A   +R  +LRVL+E+ +++   F  Y +LTI++ LEAHKDP K V++AAEE +  L +++  + CL++L  ++   T     L A+KML ++++  +   +   V  +   L    ++ ES VRK SV C+V +H VIG+ +   L +L  S+ +LL +YIK+ 
Sbjct: 1261 LDNKTSSLLNTLAPRPAGSSSRLVRDYNPLHYADTLIAIGSVHEDEAGQLRHGAGDMSEQCA------------------MVSDILRELAADADGSRGEERRTALLELLKLAREDALGTRDESFKAVLVTLLDTLKD---------ADYTVRTLALRVLREIVRNRPDPFKNYAELTIIRSLEAHKDPHKEVVRAAEETAMALATSIQPEQCLQVLCPIVQTAT-YPTNLAAIKMLTRVVERISHGDLLPLVPAVIPGLLQGYDNTESSVRKASVFCLVAVHSVIGDDLKPHLAQLTGSKIKLLNLYIKRA 1543          

HSP 3 Score: 123.25 bits (308), Expect = 2.107e-28
Identity = 117/439 (26.65%), Postives = 206/439 (46.92%), Query Frame = 3
Query:  939 PITNAVKTTVKSVTSKPSNFTGRTRV-----NSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARI--------DTSDPRGRIQKVSQSQPSTRDPSPS----CKSG-----YITYSNGASDYKYTNNFQKKASPN------TYSSLRYKDAFETQVAEGLKKSRRNSHDH---YQSDDNTSETSSVISDQ------------LPSFNEVVVLLN---SKTWNDRKRGLNKAEK-YITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYL 2111
            P   +  +   +  S P++  GRTR        +KS NP    S      K  S        P ++ + +         TS P  +  ++ +SQ  +R+ SPS     +SG       + S G S     +    +  P+      ++S     +  E  VA+ L K RR    +   Y  DD  S+ SS  S++            L    +V  LLN   S  W +RK GL   +  + ++ +L  +E K L +IF  MF +  +  +  F + L+     + D LHDWLY L+ +LL     + + S + ++Q+ L++  D++     F +  +F+ D+T  P +K+++ +L+Y++ + LQ+     ++++   L   +  I+ WT+E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQ+ AT +L+ +L
Sbjct:  673 PSAGSAHSAHSATASSPADSRGRTRTKISQSQRSKSANPGGAGSRSGSPGKMLS------VAPGSSLSGVVQRVPLPAATSSP-AKHSRIPRSQGCSRETSPSRLSLARSGSSRIPRPSVSQGCSRDNSRDTSPVRGFPSLDRFSLSHSGRLLGNDIEAAVADALNKPRRRYEPYGSMYSDDDANSDASSACSERSYGSRNGSTSLYLRQMEDVAELLNRCASANWTERKEGLIGLQALFKSQRTLSRVELKRLCEIFTRMFADPPSKEV--FSSQLFKV---HFDELHDWLYLLLTQLLKKMGADLLGSVQTKVQRCLDVTRDSFQFDQQFNILMRFIVDQTQTPNLKVKVAVLKYIESLALQMDPADFVNSSETRLA--VSRIITWTSEPKSSDVRKAAQAVLIALFELNTPEFTMLLGSLPKTFQEGATKLLHNHL 1097          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008085.1 (pep scaffold:Pmarinus_7.0:GL476334:564674:633296:-1 gene:ENSPMAG00000007261.1 transcript:ENSPMAT00000008085.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 152.91 bits (385), Expect = 1.377e-37
Identity = 88/229 (38.43%), Postives = 133/229 (58.08%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKE 887
            ++I S ++L +SL  I   L  D  DW+ R+  L+ LR ++ A     D F Q+++ LD   K    DLRSQVVREACIT+  L+  +++K D+  E II +L NLV N  ++++TSG  A++ I+ +T+  R++P  +T   TSKS ++R+ C E L L+   W    LE+  + + E IKKGI DAD + R ++R A+      FP   E L  +L  + QKAL  E
Sbjct:   25 VQIYSSRDLEDSLNIIRGTLSDDKHDWEKRIAALKKLRSLVIAGAPEYDCFFQHLRLLDSAFKLSAKDLRSQVVREACITLGHLATVLRSKFDHAAEAIIPTLFNLVPNCARVIATSGVAAIRLIIRHTHVPRLIP-LITGNCTSKSVAVRRRCYEFLNLLLHEWQSHILERHVAVLVETIKKGIPDADAEARVEARRAYWGLYSHFPAEAEALHATLAFSYQKALLSE 252          

HSP 2 Score: 100.138 bits (248), Expect = 2.091e-21
Identity = 67/226 (29.65%), Postives = 118/226 (52.21%), Query Frame = 3
Query: 1464 NSKTWNDRKRGLNKAEKYITEASLKPL---ERKALIDIFNSMFLE-NQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKST-DLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQA 2126
            +S  W +RK GL      +  AS +PL   E + L D F  MF + +   V   FL  L  FV + H  LH WLY L+ +LL       + S + ++Q+ L++  D +     F +  K + D++   T K++L  + Y++ + +         N+ +    +  ++ W+ E KS+ + RK++  ++I LF+LN ++F+ LL  LP TFQ+ AT +L+++L +  A
Sbjct:  606 SSADW-ERKDGLRGLRALL--ASRRPLSQAELRRLCDTFTRMFADPHGKQVFCVFLDTLVDFVAQCHSELHHWLYVLLTQLLSRACASLLGSVQAKVQRGLDITRDCFPFDQQFNIIMKCIVDQSQ--TAKMKLATMRYLEGLARRMDSEHF-ANSSETRHAVSRVITWSTEAKSSSETRKVAQAVLIALFELNTAEFTMLLGALPRTFQEGATRLLHSHLHALGA 825          

HSP 3 Score: 79.7221 bits (195), Expect = 4.548e-15
Identity = 68/231 (29.44%), Postives = 123/231 (53.25%), Query Frame = 3
Query: 2889 MSEILKELSNH---NDRHEER-KACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLK-LNNSQARLLEVYIKK 3566
            + +IL+ELS+     +R  ER +A L  L ++  +   TD       LL  L + + D +           +R  +L VL+E+A ++   F  + ++ +++ LEAH+DP K V+ AAEE +  L S +P + CL++L   +   T     L A+KM  K+    + + + + + ++   L    ++ E+ VRK SV C+V ++ VIG+ +   L  L++S+ +LL +YIK+
Sbjct:  994 LPDILRELSSGAEGGERQGERMRAALQDLWRLAHDGWLTDSGS--TPLLLTLTDAVADPD---------HTVRMLALHVLREMALNRPESFASHVEVAVIRTLEAHRDPHKEVVHAAEEAAAALASALPPEPCLRLLWPFVQTATYPG-NLAAIKMQTKVXGIRSLDVLLSLLPDVVPGLVQGYDNAETSVRKASVFCLVAIYTVIGDELTPHLALLSSSKMKLLNLYIKR 1212          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006778.1 (pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 gene:ENSPMAG00000006089.1 transcript:ENSPMAT00000006778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 3.713e-35
Identity = 83/225 (36.89%), Postives = 138/225 (61.33%), Query Frame = 3
Query:  210 EISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKAL 878
            ++ S +EL ES+  + + L  D  DW+ RV  L+ LRG++ A     D F  +++ L+   K    DLRSQVVREACIT+ + S  + N+ D+  E ++ +L NLV N  K+M+TSG  A++ I+ +T++ R++P  +T+  +SKS ++R+ C E + L+ + W +  LE+  + +++ IKKG+ DAD   RA++R+A+  F   FP   + L  +L+P  QK L
Sbjct:  251 QVHSSRELEESISGVRDVLCDDKNDWEQRVAALKKLRGLLLAGAAEQDSFPGHLRLLEPAFKLSAKDLRSQVVREACITLGYFSTVLGNRFDHCAETLMPTLFNLVPNSAKVMATSGVAAIRLIIRHTHTARLIP-LITSNCSSKSVAVRRRCFEFMDLLLQVWQISSLERHVTVLSDTIKKGMHDADADARAEARKAYWGFRSHFPSESDALYAALEPKYQKLL 474          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006783.1 (pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 gene:ENSPMAG00000006089.1 transcript:ENSPMAT00000006783.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.813 bits (351), Expect = 6.121e-35
Identity = 83/225 (36.89%), Postives = 138/225 (61.33%), Query Frame = 3
Query:  210 EISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKAL 878
            ++ S +EL ES+  + + L  D  DW+ RV  L+ LRG++ A     D F  +++ L+   K    DLRSQVVREACIT+ + S  + N+ D+  E ++ +L NLV N  K+M+TSG  A++ I+ +T++ R++P  +T+  +SKS ++R+ C E + L+ + W +  LE+  + +++ IKKG+ DAD   RA++R+A+  F   FP   + L  +L+P  QK L
Sbjct:  248 QVHSSRELEESISGVRDVLCDDKNDWEQRVAALKKLRGLLLAGAAEQDSFPGHLRLLEPAFKLSAKDLRSQVVREACITLGYFSTVLGNRFDHCAETLMPTLFNLVPNSAKVMATSGVAAIRLIIRHTHTARLIP-LITSNCSSKSVAVRRRCFEFMDLLLQVWQISSLERHVTVLSDTIKKGMHDADADARAEARKAYWGFRSHFPSESDALYAALEPKYQKLL 471          
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002178.1 (pep scaffold:Pmarinus_7.0:GL493696:28:2121:1 gene:ENSPMAG00000001982.1 transcript:ENSPMAT00000002178.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 8.664e-23
Identity = 55/157 (35.03%), Postives = 93/157 (59.24%), Query Frame = 3
Query: 3108 RVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLK-LNNSQARLLEVYIKKGGS 3575
            R+  E  + Q   F +Y +LTI+KVLEAH+DP K V +AAEE + VL +++P + CLK+L  ++    +  + L A+KM  ++++     ++   + ++   L    ++ ES VRK SV C+V +H  IGE +   L  L+ S+ +LL +YI++  S
Sbjct:    1 RLCFEFLRRQPTCFRKYAELTIMKVLEAHRDPHKEVCRAAEETASVLAASLPAEQCLKVLCPIVQTA-DFPINLAAIKMQTRVMQRLPHTALTQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIHTAIGESLTPYLTHLSGSKMKLLNLYIQRAES 156          
BLAST of CLIP-associating protein 1 vs. Ensembl Nematostella
Match: EDO44820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUW5])

HSP 1 Score: 128.642 bits (322), Expect = 1.926e-30
Identity = 74/229 (32.31%), Postives = 133/229 (58.08%), Query Frame = 3
Query: 2889 MSEILKELSN-HNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIW--SLLKLNNSQARLLEVYIKK 3566
            ++ IL  LS+  +DR +E++  L  L++M RE  P  W   F  +   L+ ++ D          +  IR+ ++RVL+++ ++Q   F +    T+ KVL+AHKDP+K V++ AEE +  +  ++  + C+++L  +I+D +E  + L ALKML K+++  +  +IE  + +L   L    +H ES VRK SV  +V LH ++GE +    L +L+ ++ +LL +YIK+
Sbjct:  396 LAPILSPLSDPSSDRMDEKRGSLVDLLRMIREEIPALWAA-FPKVFSALIRSIDD---------VQPSIRSLAIRVLKDMVRAQPHTFHDVIGTTVSKVLQAHKDPQKEVVRLAEEAAATIARSVAPEDCMRVLGPIIND-SEFPVSLAALKMLTKVVEGVDSVTIEEHLPDLIPGLVKCYDHVESSVRKASVFSLVALHAIVGEEVLLPHLAELSGTKMKLLNLYIKR 613          

HSP 2 Score: 123.25 bits (308), Expect = 1.063e-28
Identity = 67/226 (29.65%), Postives = 131/226 (57.96%), Query Frame = 3
Query: 1446 EVVVLL-NSKTWNDRKRGLNKAEKYITEAS-LKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSS 2117
            E+V L  N+ +  DR+ G++    ++  +  +  +E   + D    +F +    V   FL  L  F+  +   L+DWL+ L+ +LL     + + S + +I ++L+++ D++   + F +  +F+TD+T  P +K+++ +L+Y++ ++ L  PS   TN+ +    +  I+ WT E KS D+RK S+ +++ LF+LN  +FS +L +LP +FQD AT +L+++L S
Sbjct:    5 EIVRLCHNNNSSTDRRDGISGLLAFLKSSRVMSDVELSKIKDCLTRLFCDPNNKVYSAFLDALCEFIVVHKVDLNDWLFVLLSRLLIKLGTDILGSMQSKIVRVLDVIRDSFPYDLQFSILTRFITDQTQTPNLKVKIAVLQYLQGLISLMDPSDF-TNSGETRLAVSRIISWTTEPKSADVRKESAAVIVALFELNTPEFSMMLSVLPKSFQDGATKLLHSHLKS 229          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 263.077 bits (671), Expect = 5.798e-71
Identity = 203/712 (28.51%), Postives = 345/712 (48.46%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKP---SNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSD--------------PRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKK--------ASPNTYSSLRYKDAFETQVAEGLKKSRRN---SHDHYQSDDNTSETSSVISD----------------QLPSFNEVVVLLNSKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASK 2201
            I+I S +E+ E+L  I + L  D  DW+ RV  L+ LR ++ A     D FLQ ++ ++   K    DLRSQVVREACIT+ + S  +  + D+  E ++ +L+NLV N  K+M+TSG  A++ I+ +T+  R++P   +  ++            +   + ++ + +++    + + E IKKGI DAD + R+ +R+ +  F+  F +  E+L Q+L+ + QKALQ  L S  GD + S     +P ++   ++ +   ++P    N  G T+   + +  P+  SS   L+ + +S+    AA    A  R+                  P G    + + +  TR  S S  S  +T S G S  K  +  Q +        AS N    L      E  VA+ L++  R    S   Y  DD  S+ SS  S+                Q+    EV+    S  W++RK GL   +  + ++  L  +E K L +IF  MF +  + V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  +++     F +  +F+ D+T  P +K+++ +L Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD  T +L+ +L      RS  TA           P+NSA++
Sbjct:  280 IQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIPIITSNCTSKAVAVRSCVSPSVFLSVIDSSSRRHV----AVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHLRS--GDSLMS-----LPASDRSSSSSQESLNRPLSVKNSVGSTKAVPS-TRKPATASSPGSLH-RSRSDVDVNAAASANARTRMSAVSSAVPSSPFSSASALPPGSYASLGRVR--TRRTS-SGNSPSLTDSRGRSRGKVVSQSQHRLSHQARISASVNAMRILNTGTEVEAAVADALRRPARRRFESPGMYSDDDANSDASSACSERSYSSRNGGVTPHYMRQMEDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLIALFELNTPEFTMLLGALPKTFQDGTTKLLHNHL------RSASTA--------VAAPSNSATR 960          

HSP 2 Score: 149.058 bits (375), Expect = 1.282e-35
Identity = 99/284 (34.86%), Postives = 153/284 (53.87%), Query Frame = 3
Query: 2730 YNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRH---EERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            YNP  Y+ GP                GS+ K      G +  R        +++ ++LKELS         EER+  L  L+K+ RE+    WDEHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  ++    +  + L A+KM  + I+  ++E +   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1073 YNPGNYTDGP----------------GSLDKAALYEDGGEPRRDACPTEQLELVGQLLKELSQGQGGEKGPEERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKD---------HTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTA-DYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKRA 1330          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 254.603 bits (649), Expect = 3.800e-68
Identity = 221/808 (27.35%), Postives = 360/808 (44.55%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPI----------TNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNF-----------GWRAAKPKTATARIDT------SDPRGRIQK--VSQSQPSTRDPSP----SCKSGYI-----------TYSNGASDY--------------------------KYTNNFQKKASPNTYSSLRYKDAFETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISD----------------QLPSFNEVVVLLNSKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKI--------------------------------SSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASK 2201
            I+I S +E+ E+L  I + L  D  DW+ RV  L+ LR ++ A     D FLQ ++ ++   K    DLRSQVVREACIT+ + S  +  + D+  E ++ +L+NLV N  K+M+TSG  A++ I+ +T+  R++P  +T+  TSK+ ++R+ C E + L+   W    LE+  + + E IKKGI DAD + R+ +R+ +  F+  F +  E+L Q+L+ + QKALQ  L S  GD + S            +    P+          + AV +T K  T+       R+R +   +   SAN+ T                      G  A+  +  T R  +      +D RGR +   VSQSQP +R  SP    +   G I           T ++ +S Y                          + ++  +  AS N    L      E  VA+ L            + R  S   Y  DD  S+ SS  S+                Q+    EV+    S  W++RK GL   +  + ++  L  +E K L +IF  MF +  + V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  +++     F +  +F+ D+T  P +K+++ +L Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK                                 +  ++I LF+LN  +F+ LL  LP TFQD  T +L+ +L      RS  TA           P+NSA++
Sbjct:  308 IQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIP-IITSNCTSKAVAVRRRCFEFVDLLLHEWQASSLERHVAVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHLRS--GDSLMSLPASDRSSSSSQESLNRPLSVKNSVGSSRSKAVPSTRKPATASSPGSLHRSRSDVDVNAAASANARTRMSAVSSAVPSSPFSSASALPPGSYASLGRVRTRRTSSGNSPSLTDSRGRSRGKVVSQSQPGSRSGSPGRLLTSTYGRIPRPTMGAPSPQTPTSISSSYSEKNRPRGHRSQGCSRDNSPTRSGADRLSHQARISASVNAMRILNTGTEVEAAVADALLLGDSRSKRRPARRRFESPGMYSDDDANSDASSACSERSYSSRNGGVTPHYMRQMEDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADF-VNSSETRLAVSRIITWTTEPKSSDVRKTLQSWAGEEPSGRAGTVASLPGEGNLEERCKQAAQVVLIALFELNTPEFTMLLGALPKTFQDGTTKLLHNHL------RSASTAV------AMAAPSNSATR 1099          

HSP 2 Score: 149.828 bits (377), Expect = 8.372e-36
Identity = 104/294 (35.37%), Postives = 161/294 (54.76%), Query Frame = 3
Query: 2730 YNPEYYSSGP--IDTSV------HSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRH---EERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            YNP  Y+ GP  +D +          RDA +      +KIL P       +     P E  +++ ++LKELS         EER+  L  L+K+ RE+    WDEHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  ++    +  + L A+KM  + I+  ++E +   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1217 YNPGNYTDGPGSLDKAALYEDGGEPRRDARRQECVE-NKILNP-------KSFPACPTEQLELVGQLLKELSQGQGGEKGPEERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKD---------HTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQT-ADYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKRA 1492          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:101157230])

HSP 1 Score: 173.711 bits (439), Expect = 3.220e-43
Identity = 92/208 (44.23%), Postives = 133/208 (63.94%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI 3506
            ++++E+LKELSNHN+R EERKA L+ L+K+ RENT   WDEHFKT+L LLLETMGD E           IR  +LRVL+E+   Q  RF  Y +LTI+K LEAHKDP K V++AAEE + +L  ++  + C+K+L  +I    +  + L A+KM  K+++   RE + + +  +   L    ++ ES VRK  V C+V ++ VIGE +
Sbjct: 1025 ELVAELLKELSNHNERIEERKAALWELLKLIRENTLQVWDEHFKTILLLLLETMGDRE---------HVIRTLALRVLREILGKQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEETAAMLALSISPEQCIKVLCPIIQSA-DYPINLAAIKMQTKVVERIPREGLISMLPEIVPGLVQGYDNSESSVRKACVFCLVAIYAVIGEDL 1222          

HSP 2 Score: 148.673 bits (374), Expect = 1.377e-35
Identity = 86/232 (37.07%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLS 896
            ++I S ++L  +L  I      D  DW  R + L+ +R ++ A     D F Q+++ LD   K    DLRSQVVREACITVA LS  + NK D+  E I+  L NL+ N  K+M+ SG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C + L L+ + W    LE+ ++ + E+IKKGI D D + R ++R+A+      FP   + L  SL+ + Q+ LQ  L S
Sbjct:   72 VQIYSARDLEGNLNKIREICSDDKHDWDQRANALKKIRSLLVAGAAGYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAHLSSVLGNKFDHGAEAIVPVLFNLIPNCAKVMAMSGVSAIRIIIRHTHVPRLIP-LITSNCTSKSVAVRRRCYDFLDLLLQEWQTHSLERHTAVLVESIKKGIHDPDSEARVEARKAYWGLRNHFPAEADALYNSLETSYQRTLQSYLKS 302          

HSP 3 Score: 133.65 bits (335), Expect = 6.736e-31
Identity = 87/309 (28.16%), Postives = 157/309 (50.81%), Query Frame = 3
Query: 1326 ETQVAEGLKKSRRNSHDHY---QSDDNTSETSSVISDQ---------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTV--------------------VIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAV 2129
            E  +A+ LKK  R  +++Y     DD  S+ SS  S++         +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF +  +                     V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++Q+ L++  +++   + F +  +F  D+T  P +K+++ +L+Y++ + LQ+  P  ++++   L   +  I+ WT E KS+D+RK +  ++I LF LN  +F+ LL  LP TFQD AT +L  +L +  +V
Sbjct:  572 EEALADALKKPARRRYENYGMYSDDDANSDASSACSERSYSSRNGGAIPTYMRQTEDVAEVLNRCASANWSERKEGLLGLQALLKNQRTLSRVELKRLCEIFTRMFADPHSKRDSGRVYGTAESGISSASFKVFSMFLETLVDFILVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQRALDITRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEAPDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQAVLIALFQLNTPEFTMLLAALPKTFQDGATKLLQNHLKNTGSV 878          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: clasp2 (cytoplasmic linker associated protein 2 [Source:NCBI gene;Acc:101157230])

HSP 1 Score: 172.94 bits (437), Expect = 7.086e-43
Identity = 92/208 (44.23%), Postives = 133/208 (63.94%), Query Frame = 3
Query: 2883 DMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGI 3506
            ++++E+LKELSNHN+R EERKA L+ L+K+ RENT   WDEHFKT+L LLLETMGD E           IR  +LRVL+E+   Q  RF  Y +LTI+K LEAHKDP K V++AAEE + +L  ++  + C+K+L  +I    +  + L A+KM  K+++   RE + + +  +   L    ++ ES VRK  V C+V ++ VIGE +
Sbjct: 1223 ELVAELLKELSNHNERIEERKAALWELLKLIRENTLQVWDEHFKTILLLLLETMGDRE---------HVIRTLALRVLREILGKQPWRFKNYAELTIMKALEAHKDPHKEVVRAAEETAAMLALSISPEQCIKVLCPIIQSA-DYPINLAAIKMQTKVVERIPREGLISMLPEIVPGLVQGYDNSESSVRKACVFCLVAIYAVIGEDL 1420          

HSP 2 Score: 154.066 bits (388), Expect = 4.221e-37
Identity = 119/383 (31.07%), Postives = 194/383 (50.65%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTV-----KSVTSKPSNFTGR-----------TRVNSAKSE-NPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTS-------------DPRG--RIQKVSQSQPSTRDPSPS---CKSGYITYSNGA 1244
            ++I S ++L  +L  I      D  DW  R + L+ +R ++ A     D F Q+++ LD   K    DLRSQVVREACITVA LS  + NK D+  E I+  L NL+ N  K+M+ SG  A++ I+ +T+  R++P  +T+  TSKS ++R+ C + L L+ + W    LE+ ++ + E+IKKGI D D + R ++R+A+      FP   + L  SL+ + Q+ LQ  L S       S  V  +P ++   ++      + ++SK S   GR           T +  ++S+ + +A + ++  +  Q    G + A+  ++  R+ T              D RG  R + VSQSQP +R  SP      +   T S+GA
Sbjct:  309 VQIYSARDLEGNLNKIREICSDDKHDWDQRANALKKIRSLLVAGAAGYDCFYQHLRLLDGAFKLSAKDLRSQVVREACITVAHLSSVLGNKFDHGAEAIVPVLFNLIPNCAKVMAMSGVSAIRIIIRHTHVPRLIP-LITSNCTSKSVAVRRRCYDFLDLLLQEWQTHSLERHTAVLVESIKKGIHDPDSEARVEARKAYWGLRNHFPAEADALYNSLETSYQRTLQSYLKS-------SGSVASLPQSDRSSSSSQESLNRPLSSKWSAAPGRVPASSKGGVSLTSLQRSRSDVDVNAAAVSKQRHVGQARVAGQQPARSYSSLGRVRTKQLLTTASSVSSQVDSRGRSRAKMVSQSQPGSRSGSPGRVLTTTALSTMSSGA 683          

HSP 3 Score: 140.584 bits (353), Expect = 5.195e-33
Identity = 83/284 (29.23%), Postives = 151/284 (53.17%), Query Frame = 3
Query: 1353 KSRRNSHDHYQSDDNTSETSSVISDQ---------LPSF----NEVVVLLN---SKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCI-LQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETAS 2150
            + R  ++  Y  DD  S+ SS  S++         +P++     +V  +LN   S  W++RK GL   +  +  + +L  +E K L +IF  MF +  + V   FL  L  F+  + D L DWL+ L+ +LL     + + S + ++Q+ L++  +++   + F +  +F  D+T  P +K+++ +L+Y++ + LQ+  P  ++++   L   +  I+ WT E KS+D+RK +  ++I LF LN  +F+ LL  LP TFQD AT +L  +L +  +V      S
Sbjct:  802 RRRYENYGMYSDDDANSDASSACSERSYSSRNGGAIPTYMRQTEDVAEVLNRCASANWSERKEGLLGLQALLKNQRTLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFILVHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQRALDITRESFPNDLQFTILMRFTVDQTQTPNLKVKVAILKYIETLTLQMEAPDFVNSSETRLA--VSRIITWTTEPKSSDVRKAAQAVLIALFQLNTPEFTMLLAALPKTFQDGATKLLQNHLKNTGSVAQAPMGS 1083          
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Match: CLASP1 (H(+)/Cl(-) exchange transporter 4 [Source:NCBI gene;Acc:101155751])

HSP 1 Score: 165.236 bits (417), Expect = 1.851e-40
Identity = 120/376 (31.91%), Postives = 189/376 (50.27%), Query Frame = 3
Query:  207 IEISSIKELRESLLNINNKLHAD--DWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDS-----------ADVFKVPI----------TNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNF-----------GWRAAKPKTATARIDT------SDPRGRIQK--VSQSQPSTRDPSPS 1208
            I+I S +E+ E+L  I + L  D  DW+ RV  L+ LR ++ A     D FLQ ++ ++   K    DLRSQVVREACIT+ + S  +  + D+  E ++ +L+NLV N  K+M+TSG  A++ I+ +T+  R++P  +T+  TSK+ ++R+ C E + L+   W    LE+  + + E IKKGI DAD + R+ +R+ +  F+  F +  E+L Q+L+ + QKALQ  L S  GD + S            +    P+          + AV +T K  T+       R+R +   +   SAN+ T                      G  A+  +  T R  +      +D RGR +   VSQSQP +R  SP 
Sbjct:  308 IQIYSNREVEEALTKIRDVLSDDKRDWELRVAALKKLRSLLLAGAAEFDGFLQQLRLMEAAFKLSAKDLRSQVVREACITLGYFSLVLGGRFDHAAEAVMPTLLNLVPNSAKVMATSGVAAIRLILRHTHFPRLIP-IITSNCTSKAVAVRRRCFEFVDLLLHEWQASSLERHVAVLMETIKKGIHDADAEARSVARKCYWGFHAHFSREAEQLFQALESSYQKALQAHLRS--GDSLMSLPASDRSSSSSQESLNRPLSVKNSVGSSRSKAVPSTRKPATASSPGSLHRSRSDVDVNAAASANARTRMSAVSSAVPSSPFSSASALPPGSYASLGRVRTRRTSSGNSPSLTDSRGRSRGKVVSQSQPGSRSGSPG 680          

HSP 2 Score: 150.214 bits (378), Expect = 7.287e-36
Identity = 104/294 (35.37%), Postives = 161/294 (54.76%), Query Frame = 3
Query: 2730 YNPEYYSSGP--IDTSV------HSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPE--DMMSEILKELSNHNDRH---EERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLL-KLNNSQARLLEVYIKKG 3569
            YNP  Y+ GP  +D +          RDA +      +KIL P       +     P E  +++ ++LKELS         EER+  L  L+K+ RE+    WDEHFKT+L LLLET+GD +           IRA +LRVL+E+ ++Q  RF  Y +LTI+K LEAHKD  K V++AAEE +  L  ++  + C+K+L  ++    +  + L A+KM  + I+  ++E +   + ++   L    ++ ES VRK SV C+V ++ VIGE +   L +L  S+ +LL +YIK+ 
Sbjct: 1279 YNPGNYTDGPGSLDKAALYEDGGEPRRDARRQECVE-NKILNP-------KSFPACPTEQLELVGQLLKELSQGQGGEKGPEERRGTLLELLKVAREDALMVWDEHFKTMLLLLLETLGDKD---------HTIRALALRVLKEILRNQPARFKNYAELTIMKALEAHKDSHKEVVRAAEEAASTLAGSIHPEQCIKVLCPIVQTA-DYPINLAAIKMQTRAIERISKEPLHQLLPDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEELKPYLAQLTGSKMKLLNLYIKRA 1554          

HSP 3 Score: 136.346 bits (342), Expect = 1.263e-31
Identity = 118/448 (26.34%), Postives = 199/448 (44.42%), Query Frame = 3
Query: 1002 GRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQP--------STRDPSP------------SCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGL-----------KKSRRNSHDHYQSDDNTSETSSVISD----------------QLPSFNEVVVLLNSKTWNDRKRGLNKAEKYI-TEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASK 2201
            GR    +  + +P   +S    YS++    G R+       +   +   R RI + S SQ         S+RD SP            S  +  ++ +   SD + ++  +  AS N    L      E  VA+ L            + R  S   Y  DD  S+ SS  S+                Q+    EV+    S  W++RK GL   +  + ++  L  +E K L +IF  MF +  + V   FL  L  FV  + D L DWL+ L+ +LL     + + S + ++QK L++  +++     F +  +F+ D+T  P +K+++ +L Y++ + +   P+    N+ +    +  I+ WT E KS+D+RK +  ++I LF+LN  +F+ LL  LP TFQD  T +L+ +L      RS  TA           P+NSA++
Sbjct:  688 GRIPRPTMGAPSPQTPTSISSSYSEKNRPRGHRSQGCSRDNSPTRSGAARSRIPRPSMSQGCSRETSRESSRDTSPARGFSPLVSRRHSRSTSALSSAECCSD-RLSHQARISASVNAMRILNTGTEVEAAVADALLLGDSRSKRRPARRRFESPGMYSDDDANSDASSACSERSYSSRNGGVTPHYMRQMEDVAEVLNHCASANWSERKEGLLGLQNLLKSQRMLSRVELKRLCEIFTRMFADPHSKVFSMFLETLVDFVVLHRDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQKALDVTRESFPYEQQFNILMRFIVDQTQTPNLKVKVAILRYIEALARQMDPADF-VNSSETRLAVSRIITWTTEPKSSDVRKAAQVVLIALFELNTPEFTMLLGALPKTFQDGTTKLLHNHL------RSASTAV------AMAAPSNSATR 1121          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 2184.84 bits (5660), Expect = 0.000e+0
Identity = 1127/1147 (98.26%), Postives = 1127/1147 (98.26%), Query Frame = 3
Query:  135 MNKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 3575
            MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA                    KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHTKTTKVYNTKKTASNTTYSSHNSNMSSVSFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS
Sbjct:    1 MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA--------------------KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHTKTTKVYNTKKTASNTTYSSHNSNMSSVSFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 1127          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 2172.51 bits (5628), Expect = 0.000e+0
Identity = 1095/1147 (95.47%), Postives = 1095/1147 (95.47%), Query Frame = 3
Query:  135 MNKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 3575
            MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR                                                    TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS
Sbjct:    1 MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR----------------------------------------------------TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 1095          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 2093.16 bits (5422), Expect = 0.000e+0
Identity = 1066/1147 (92.94%), Postives = 1066/1147 (92.94%), Query Frame = 3
Query:  135 MNKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 3575
            MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA                    KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR                                                    TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNE         SEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS
Sbjct:    1 MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA--------------------KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR----------------------------------------------------TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNE---------SEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 1066          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000072426.1 (SMESG000072426.1)

HSP 1 Score: 2066.58 bits (5353), Expect = 0.000e+0
Identity = 1055/1147 (91.98%), Postives = 1055/1147 (91.98%), Query Frame = 3
Query:  135 MNKKQEFGAVXXXXXXXXXXXXXXIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 3575
            MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA                    KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR                                                    TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNI                    ELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS
Sbjct:    1 MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQHRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSENPSA--------------------KPKTATARIDTSDPRGRIQKVSQSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQVAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCR----------------------------------------------------TPKQKIEPEKSSEFIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNI--------------------ELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS 1055          
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Match: SMESG000016277.1 (SMESG000016277.1)

HSP 1 Score: 426.402 bits (1095), Expect = 1.797e-127
Identity = 364/1204 (30.23%), Postives = 612/1204 (50.83%), Query Frame = 3
Query:  210 EISSIKELRESLLNINNKL--HADDWQHRVDNLRILRGIIKANRFP-TDDFLQNIKFLDLEIKNCVSDLRSQVVREACITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYNTNSVRILPFFLXXXXXXXXXXLRQFCSELLKLICENWNMKYLEKSSSNIAEAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQKELLSF--KGDEIDSADVFKVPITNAVKTTVKSVTSKPSN---------------FTGRTRVNSAKSENPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVS-QSQPSTRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFE-----------TQVAEGLKKSRRNSHD-----------HYQSDDNTSETSSVISDQL---------PSFN--EVVVLLNSKTWNDRKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYAFVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTIVMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGPMLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDRATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFHKRTPKQKIEPEKSSE----------FIKINTEALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKTSQIPTPRQNLN----NYSPANN--YSYDNTNMQKFLSSQNSHPELSIDNGGSNVSSSLYPSTSN-ESNVDNKYN----PEYYSSG----PID--TSVHSNRDAPQNNIGSISKILKPVIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFRENTPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKSQAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKMLIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNHKESQVRKESVLCMVELHKVIGEGIWSLLK-LNNSQARLLEVYIKKGGS 3575
            E+ + +EL+E +  I + L  +++DW+ RV  L+ L+ +  ++ F   ++F+  ++ L + +++C+SDLRSQVVREAC+ VA+L+  +K + +   +  + SL++L+ N  +IM+TSG   L  IV N +S ++L   +++   SKS S R+F S+LL+ IC +W+   LEK   N+  A++KG++DAD++ RA SR AF  F   FP+   K+L  +D  ++  L+KE LSF   G  +      K   TN   TT+K  TS   N                TG++R N +        + ++   +   S+   RAA  +++  R   S   G   K S ++ P +   S S  +  IT +NG+    +T N       ++YSS RYK +             T   +GL     N  D              SDDN SETSS+ S ++         PS N  E++  L+S  W+++K GL   +  +    L  L+ K  I++ N++F + ++ +   FL  +   ++ +  +L DWLY L++ L+  QA E + S +  IQ+ LN +   +   +    CC+ V D      +K +L ++ + K ++ ++  ++++ +   L P +  I+ W  E+K  ++RKIS+ +++KL +L+      +   LP   + +   I+N +          +T++D GD    +K     SK  RSNSFH    K      + +   Y  +  ++     +    K +++P   S           +I+ NTE LQ L++  + +D T       N+          SY +    N   +T+ S  P P  N N    N    +N   SY     Q  L + N +P   I N    +  S  P   N  + VDN       P Y +SG    P++   S  S++   + N   +    +  +G+Q L+KI+ LPP DM+  IL EL   N R E+RKACL +L+ + REN   +W+E FKT+L  LL+T+ D +          EIR  SLRVLQEL K+   RF ++T LT+LK+L +HKD +K+V++AAEECS+V+   + + +C+K+L +V++D  + ++ L ALKML++++KN     + + + ++   L     H+ES +RK S+ C+VE+++ IGE IW+ L+ L++S+ RLL +YI+K  S
Sbjct:   43 EVGNSRELQEVIGEIISGLKGNSEDWEKRVKALKTLQSV--SSSFSNMEEFISYLRQLQVPLQSCLSDLRSQVVREACLAVAYLTHILKIRAEVLTDAFMPSLISLIPNSARIMATSGMTCLSIIVTNIHSAKVL-IHVSSAMNSKSNSTRRFASKLLETICSSWDPTVLEKQLPNLQNALEKGMADADQEARAISRSAFIGFVLNFPQEANKMLVLMDSGRRSLLEKE-LSFHPAGQVLAQFSNAKQRATNP-PTTLKLGTSSYGNRSVKKSSVSDSGDELITGKSRTNYSSLTRSKIKTQSDRGQNIMTSSVS-RAA--ESSNIRGSNSSLTGYTYKSSARTTPQSTRRSSSGTAPVITVNNGSV---HTKN-------DSYSSYRYKTSGSVSASLPRRKNLTSTGKGLYSGFENGVDPPNSGLLSRRRMDSSDDNGSETSSIESSEVSRSSLRAIKPSENTQEILRQLSSVHWSEKKDGLINFQNLLQSRKLNTLDLKKYIEVLNTLFNDTKSKIFPLFLICIQQLIENHKQYLFDWLYPLLLNLISKQAAETLASRQKPIQETLNTIRSQFPLEIQVRDCCRVVIDSYQNTGMKFKLSIMAFFKTVVIVAPSTVMEQSLASLTPTVNIIVEWIFESKWQEIRKISNALLLKLHNLHPQVMEAISNCLPPVTRQK---IMNLF----------KTSAD-GDLNSRLK---MRSKILRSNSFH---DKNTENPGSKALDHYGYYGHSVKPRDVYTNRNKSQLKPTSGSANSMTQEDIDNYIRRNTEDLQALAVAYERYDGT-----DGNR----------SYSRTRPYNSQLRTQLSDPPYPDGNANGNHINQGMVSNSAASYMINRFQSSLRNTN-YPPSGISNSSDMLQDSFSPHNRNLLAGVDNSLAYSCYPNYDASGYNYYPVNDAASTLSDQMLMKMNTSDVYLQSQCPMGFQMLQKISTLPPNDMIVTILAELCYLNQRTEQRKACLMKLMNLVRENAVENWNEVFKTILMRLLDTVKDTD---------PEIRTLSLRVLQELTKTMPQRFDDFTHLTVLKILHSHKDSDKTVVRAAEECSQVMARCLSQNLCMKVLSEVLNDN-DCRVNLGALKMLLEVLKNVPESLLLSSLESMVPGLIRTSEHEESHIRKASIFCLVEINRKIGETIWTYLQSLSSSKTRLLRLYIEKNNS 1182          
The following BLAST results are available for this feature:
BLAST of CLIP-associating protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLASP13.882e-7629.96cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP12.101e-7529.79cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP15.734e-7429.75cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP13.525e-7329.75cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP12.861e-7129.27cytoplasmic linker associated protein 1 [Source:HG... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cls-21.734e-3924.43pep chromosome:WBcel235:III:9055052:9058849:1 gene... [more]
cls-21.734e-3924.43pep chromosome:WBcel235:III:9055052:9058882:1 gene... [more]
cls-22.063e-3924.43pep chromosome:WBcel235:III:9055052:9058843:1 gene... [more]
cls-22.063e-3924.43pep chromosome:WBcel235:III:9055052:9058882:1 gene... [more]
cls-31.357e-3022.97pep chromosome:WBcel235:III:9186556:9191127:-1 gen... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
chb1.665e-3830.50gene:FBgn0021760 transcript:FBtr0089460[more]
chb1.665e-3830.50gene:FBgn0021760 transcript:FBtr0089461[more]
chb1.665e-3830.50gene:FBgn0021760 transcript:FBtr0089462[more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clasp1a3.282e-4332.73cytoplasmic linker associated protein 1a [Source:Z... [more]
clasp21.313e-4232.60cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp22.546e-4232.60cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp1a2.863e-4241.38cytoplasmic linker associated protein 1a [Source:Z... [more]
clasp23.239e-4136.16cytoplasmic linker associated protein 2 [Source:NC... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TOGARAM21.139e-620.36TOG array regulator of axonemal microtubules 2 [So... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clasp14.485e-7630.86CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
Clasp17.504e-7630.53CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
Clasp12.288e-7430.49CLIP associating protein 1 [Source:MGI Symbol;Acc:... [more]
Clasp22.044e-4230.69CLIP associating protein 2 [Source:MGI Symbol;Acc:... [more]
Clasp22.158e-4230.69CLIP associating protein 2 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of CLIP-associating protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1A5G0|CLAP1_XENTR5.348e-7730.62CLIP-associating protein 1 OS=Xenopus tropicalis O... [more]
sp|A1A5K2|CLA1B_XENLA6.638e-7431.14CLIP-associating protein 1-B OS=Xenopus laevis OX=... [more]
sp|Q4U0G1|CLA1A_XENLA3.805e-7230.29CLIP-associating protein 1-A OS=Xenopus laevis OX=... [more]
sp|Q8BRT1|CLAP2_MOUSE1.508e-4130.69CLIP-associating protein 2 OS=Mus musculus OX=1009... [more]
sp|O75122|CLAP2_HUMAN1.933e-4141.30CLIP-associating protein 2 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of CLIP-associating protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L4P52.386e-16230.58Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KQ221.720e-14529.78CLIP-associating protein 1 (Fragment) OS=Clonorchi... [more]
A0A4Z2DGD71.213e-11932.14CLIP-associating protein isoform 2 OS=Schistosoma ... [more]
A0A4Z2DG683.002e-11631.96CLIP-associating protein isoform 1 OS=Schistosoma ... [more]
A0A5K4EVE15.313e-11532.50Putative clasp2 protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLASP11.005e-8431.11cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP12.837e-8331.31cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP15.946e-8231.24cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP14.557e-8130.56cytoplasmic linker associated protein 1 [Source:HG... [more]
CLASP15.332e-8130.56cytoplasmic linker associated protein 1 [Source:HG... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003792.12.505e-4334.82pep scaffold:Pmarinus_7.0:GL477033:101956:230147:1... [more]
ENSPMAT00000008085.11.377e-3738.43pep scaffold:Pmarinus_7.0:GL476334:564674:633296:-... [more]
ENSPMAT00000006778.13.713e-3536.89pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 ge... [more]
ENSPMAT00000006783.16.121e-3536.89pep scaffold:Pmarinus_7.0:GL479472:848:23794:-1 ge... [more]
ENSPMAT00000002178.18.664e-2335.03pep scaffold:Pmarinus_7.0:GL493696:28:2121:1 gene:... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO448201.926e-3032.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLASP15.798e-7128.51H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
CLASP13.800e-6827.35H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
clasp23.220e-4344.23cytoplasmic linker associated protein 2 [Source:NC... [more]
clasp27.086e-4344.23cytoplasmic linker associated protein 2 [Source:NC... [more]
CLASP11.851e-4031.91H(+)/Cl(-) exchange transporter 4 [Source:NCBI gen... [more]
back to top
BLAST of CLIP-associating protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072426.10.000e+098.26SMESG000072426.1[more]
SMESG000072426.10.000e+095.47SMESG000072426.1[more]
SMESG000072426.10.000e+092.94SMESG000072426.1[more]
SMESG000072426.10.000e+091.98SMESG000072426.1[more]
SMESG000016277.11.797e-12730.23SMESG000016277.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033412 ID=SMED30033412|Name=CLIP-associating protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4314bp
GTTAAATTTATAAAATTTTACTGCAGCAAACAAATAACTTTAAAAGTGTT
TTTGCCTAACTTTACAGATTAAAATTGTTAGATTGTATATATTTTTCTCA
AAGCTTTCAGATTATATCTTATATGGTATAAGTTATGAATAAAAAACAAG
AATTTGGAGCAGTAACAGAAGAGGATTTTGAACAAACTTTTGAACAAACT
CCTGAAATAGAAATTAGCTCTATTAAAGAATTGCGAGAAAGTTTGCTTAA
CATAAACAACAAATTACATGCGGATGATTGGCAACATAGAGTTGACAATC
TTCGTATTCTACGAGGTATTATTAAAGCAAATAGATTTCCAACGGATGAT
TTTTTACAAAACATTAAATTTCTCGACTTAGAAATAAAAAATTGTGTTAG
TGATTTAAGATCTCAAGTTGTCCGAGAGGCATGCATTACTGTTGCGTTTC
TCTCCAAAGAGATAAAGAATAAACTTGATTACTTTTTGGAACAAATTATC
GAAAGTTTAATGAATCTCGTATCAAACGGTGTGAAGATTATGTCAACAAG
TGGAAAAGTTGCTCTAAAATATATAGTCTATAACACAAATAGCGTACGAA
TTCTTCCATTTTTCCTTACAACTATTTCTACGTCAAAATCAACTTCATTA
CGACAATTCTGTAGTGAATTGTTGAAACTTATCTGTGAAAATTGGAACAT
GAAATATCTGGAAAAATCTTCAAGTAATATCGCGGAAGCAATAAAAAAAG
GTATCAGTGACGCAGACGAGCAAACCAGAGCTCAATCCAGAGAAGCATTT
TGTTGGTTTAATGGGAAATTTCCGAAATTAGGTGAAAAATTACTACAAAG
CCTTGACCCAACCAAACAGAAAGCTTTACAAAAAGAGCTTTTGTCGTTTA
AAGGAGATGAAATAGATTCCGCTGACGTTTTCAAAGTACCTATAACAAAT
GCTGTGAAAACAACTGTTAAATCGGTAACCTCAAAACCATCAAATTTCAC
TGGGAGAACTCGTGTTAATTCAGCAAAAAGTGAAAACCCATCAGCAAATA
GCTCTACAGAATATCTATATTCTAAGCAACAATCAAATTTCGGATGGCGT
GCTGCTAAACCAAAAACTGCAACAGCCCGAATAGATACCAGTGATCCGAG
AGGAAGAATCCAGAAAGTTTCCCAATCACAACCTTCTACTCGAGACCCAT
CTCCTTCATGCAAATCCGGTTACATTACCTATTCAAATGGTGCAAGCGAT
TATAAATATACAAATAATTTCCAGAAAAAGGCTTCTCCGAATACATATAG
CAGTTTACGTTATAAAGATGCATTTGAAACTCAGGTAGCAGAAGGGTTGA
AAAAGTCTAGAAGAAACAGTCATGACCATTACCAGTCGGATGACAATACC
AGTGAAACATCTTCTGTCATTTCCGACCAGTTGCCTTCATTTAATGAAGT
TGTTGTTCTATTAAACAGTAAAACTTGGAACGATCGCAAACGGGGACTTA
ATAAGGCAGAAAAATACATTACCGAAGCATCATTAAAACCATTGGAAAGA
AAAGCACTAATCGATATTTTCAATTCCATGTTCTTAGAAAATCAAACAGT
AGTTATCAAGAGATTTTTGACAGTGCTTTACGCTTTTGTTGACAGATATC
ATGATCATCTCCATGATTGGTTATATTCATTAATTATCAAGCTTCTCGGT
CTTCAAGCCAATGAAAGAGTCAAGAGTAGCAAAATGGAAATACAGAAAAT
CCTTAATTTATTAATAGATAATTATGGTACAATTGTCATGTTTATGTTAT
GTTGTAAGTTTGTTACGGACAAAACAAATGAGCCTACTATCAAGATCAGA
CTTTGTCTTCTAGAATATATGAAATGTATTTTGCAATTATCACAACCTAG
TCTTCTTGATACAAACAACCCTGACCTGGGCCCAATGTTAGGTAATATTC
TCGTTTGGACAGCCGAAACAAAATCAACTGATCTCCGTAAAATATCAAGC
AATATAGTTATTAAATTATTTGACCTTAACGCTTCGCAATTCTCGAGGCT
GCTAAAATTGTTGCCCAACACTTTTCAGGATCGAGCGACGTCGATACTAA
ATGCTTACCTTTCCTCTCAGCAAGCAGTCAGGAGTACTGAAACCGCTTCG
GATGTCGGAGATTGCCGAGTCACTGTCAAACCAACTAATAGTGCCAGCAA
ATTTAATAGATCAAATTCTTTCCATACTAAAACTACAAAGGTCTATAATA
CAAAGAAAACTGCTTCTAATACGACATACTCTTCTCACAATTCCAATATG
TCGTCGGTTTCGTTTCATAAACGTACACCTAAACAAAAAATCGAGCCCGA
AAAATCTTCAGAATTTATTAAGATCAATACAGAAGCCCTTCAAAATCTTT
CTTTGAATTGTGATAACTTTGATAAAACTTCGGTTTTGTCCAACAGTTCT
AATAAATCTGGCACTACTCCTGGAAGTCATTGGGGTTCTTATCAAAAAGG
AGCGAGTTCAAATCCATTTTATCAGACTAAAACCAGTCAAATTCCCACGC
CGAGACAAAACCTCAATAATTATTCACCGGCTAATAATTATTCATATGAT
AATACTAATATGCAGAAATTCTTATCATCTCAGAATTCCCACCCAGAACT
TTCTATTGACAACGGAGGTTCCAATGTATCATCGAGTCTTTATCCGTCCA
CAAGCAATGAAAGCAATGTTGACAATAAATACAATCCAGAATATTATAGT
AGTGGACCGATCGACACATCAGTCCATTCCAACAGAGATGCACCTCAAAA
CAATATCGGTTCTATTTCAAAAATCCTTAAACCAGTAATTGGTTATCAGA
CATTACGTAAAATAGCCGAATTGCCTCCCGAAGATATGATGTCAGAAATA
TTGAAGGAATTATCAAATCACAACGATCGACACGAGGAGAGAAAAGCCTG
TTTGTTTCGCCTTATTAAAATGTTCCGAGAGAATACACCAACGGATTGGG
ACGAACATTTCAAGACGTTACTCTTTCTATTACTAGAAACCATGGGTGAC
AATGAGATTGATATAGAAAATAACAATGCTAAATCAGAAATAAGAGCACA
ATCTTTGCGAGTATTACAAGAATTAGCAAAGAGTCAAGCTCCTCGATTTC
TTGAATATACACAATTGACAATTTTAAAAGTACTCGAAGCTCATAAAGAT
CCAGAAAAATCTGTAATTAAAGCTGCTGAAGAGTGTAGTCGAGTCTTAAC
ATCGACGATGCCAAGGAAGGTGTGTCTTAAAATGCTAATTGATGTCATAT
CCGATGGCACCGAGAACCAGCTGTGTTTACCAGCTCTGAAAATGTTGATC
AAGCTCATTAAAAATTCCAATCGTGAATCGATTGAAGCTGATGTCAACAA
TTTATGCCAAGCATTATCAATTGTGGTTAATCATAAAGAAAGCCAAGTTA
GAAAGGAATCAGTTCTTTGTATGGTAGAATTGCATAAAGTTATCGGAGAA
GGAATTTGGTCACTTCTTAAATTAAACAACTCACAGGCTCGTTTGTTGGA
AGTTTATATAAAGAAAGGTGGCAGCTAAATAAATACTTTATCTTCGCGTT
CTTTCTGGAAAACCTACTCTGATTGAATGAATGATAGAGTTCATAAGAAC
TATAATGTTATCTTTGAGATACATTTGGTGATATATATGAGCATATTAAA
TTTTGATGTTGTATTTTTTTGTTTGTGTTGCGTTTCGCTTTGAGTCTATT
TGATTTGATTTATTATTAATAATTTACAAGTTGCAAATTATATATTTATG
TCCCGGTATGTGATGGAGGATGAGGATGATGATAAATGGTTCTATTTTTT
TATTATTGAGTGTCAAGTTTATTGATTTATAATGTGGCATATATTTAATG
ATTGATTGATTTCTACAATGATTTGGCTACTTTCATGTTGTCCATCCGAG
GGCAAAGTCGTTGTGAGGGGAGGGAGCGGGATGTTTGCTAGAATATCCTG
TCAAAAGTTCAATTTATAATATGAGTTGATGTCGGGTAGAAATGTTCAAA
TGAATTTGAGTTCCCTTATTGGATTTTTGCGCCCGTGTTATCAAAGAAAA
TTTGAATCTTTTATTTGTCATATTATAGATGAACATATTTGAGTATTGAA
TTTGAGTTTGTACAGAGATTTAATAAAGTTTGCACTCGAGTTTTTGTGTT
CTTTTCATTTATTCTAATTAAGTTTCTAGATAATAATCTAAATTGACTGT
GCCTGAATACAATTGAAATGTGTCGGTTTGTTCTGTTATGTGTATTTTAT
TCTTGAACCCTGGA
back to top

protein sequence of SMED30033412-orf-1

>SMED30033412-orf-1 ID=SMED30033412-orf-1|Name=SMED30033412-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1148bp
MNKKQEFGAVTEEDFEQTFEQTPEIEISSIKELRESLLNINNKLHADDWQ
HRVDNLRILRGIIKANRFPTDDFLQNIKFLDLEIKNCVSDLRSQVVREAC
ITVAFLSKEIKNKLDYFLEQIIESLMNLVSNGVKIMSTSGKVALKYIVYN
TNSVRILPFFLTTISTSKSTSLRQFCSELLKLICENWNMKYLEKSSSNIA
EAIKKGISDADEQTRAQSREAFCWFNGKFPKLGEKLLQSLDPTKQKALQK
ELLSFKGDEIDSADVFKVPITNAVKTTVKSVTSKPSNFTGRTRVNSAKSE
NPSANSSTEYLYSKQQSNFGWRAAKPKTATARIDTSDPRGRIQKVSQSQP
STRDPSPSCKSGYITYSNGASDYKYTNNFQKKASPNTYSSLRYKDAFETQ
VAEGLKKSRRNSHDHYQSDDNTSETSSVISDQLPSFNEVVVLLNSKTWND
RKRGLNKAEKYITEASLKPLERKALIDIFNSMFLENQTVVIKRFLTVLYA
FVDRYHDHLHDWLYSLIIKLLGLQANERVKSSKMEIQKILNLLIDNYGTI
VMFMLCCKFVTDKTNEPTIKIRLCLLEYMKCILQLSQPSLLDTNNPDLGP
MLGNILVWTAETKSTDLRKISSNIVIKLFDLNASQFSRLLKLLPNTFQDR
ATSILNAYLSSQQAVRSTETASDVGDCRVTVKPTNSASKFNRSNSFHTKT
TKVYNTKKTASNTTYSSHNSNMSSVSFHKRTPKQKIEPEKSSEFIKINTE
ALQNLSLNCDNFDKTSVLSNSSNKSGTTPGSHWGSYQKGASSNPFYQTKT
SQIPTPRQNLNNYSPANNYSYDNTNMQKFLSSQNSHPELSIDNGGSNVSS
SLYPSTSNESNVDNKYNPEYYSSGPIDTSVHSNRDAPQNNIGSISKILKP
VIGYQTLRKIAELPPEDMMSEILKELSNHNDRHEERKACLFRLIKMFREN
TPTDWDEHFKTLLFLLLETMGDNEIDIENNNAKSEIRAQSLRVLQELAKS
QAPRFLEYTQLTILKVLEAHKDPEKSVIKAAEECSRVLTSTMPRKVCLKM
LIDVISDGTENQLCLPALKMLIKLIKNSNRESIEADVNNLCQALSIVVNH
KESQVRKESVLCMVELHKVIGEGIWSLLKLNNSQARLLEVYIKKGGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR034085TOG
IPR011989ARM-like
IPR024395CLASP_N_dom
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0043515kinetochore binding
GO:0051010microtubule plus-end binding
Vocabulary: cellular component
TermDefinition
GO:0005828kinetochore microtubule
GO:0005881cytoplasmic microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR034085TOG domainSMARTSM01349TOG_3coord: 20..259
e-value: 5.2E-9
score: 45.9
coord: 911..1147
e-value: 1.3E-8
score: 44.6
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 432..660
e-value: 1.5E-40
score: 141.3
coord: 916..1144
e-value: 7.1E-21
score: 76.9
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 9..255
e-value: 1.9E-64
score: 219.6
IPR024395CLASP N-terminal domainPFAMPF12348CLASP_Ncoord: 40..249
e-value: 2.6E-35
score: 122.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 340..360
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..729
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 282..309
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 707..741
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 404..420
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 323..360
NoneNo IPR availablePANTHERPTHR21567CLASPcoord: 417..1145
NoneNo IPR availablePANTHERPTHR21567:SF30CLIP-ASSOCIATING PROTEIN 2coord: 3..253
NoneNo IPR availablePANTHERPTHR21567CLASPcoord: 3..253
NoneNo IPR availablePANTHERPTHR21567:SF30CLIP-ASSOCIATING PROTEIN 2coord: 417..1145
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 42..1125