Dynein light chain

Overview
NameDynein light chain
Smed IDSMED30033411
Length (bp)3241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein light chain (SMED30033411) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein light chain (SMED30033411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein light chain (SMED30033411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein light chain (SMED30033411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033411SMESG000041239.1 dd_Smed_v4_3149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033411SMESG000041239.1 dd_Smed_v4_3149_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30033411SMESG000041239.1 dd_Smed_v6_3149_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033411SMESG000041239.1 dd_Smed_v6_3149_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30033411SMESG000041239.1 dd_Smed_v6_3149_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033411SMESG000041239.1 dd_Smed_v4_3149_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033411SMESG000041239.1 dd_Smed_v4_3149_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein light chain vs. TrEMBL
Match: A0A1I8FHH7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.845e-12
Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDED-MNKH 243
            MDF + F  IDTD SGEIT  EL  +  + N+ E+FV+KWL LFD +Q GRIT D++C  LGL   +D + KH
Sbjct:    9 MDFHKAFLSIDTDHSGEITVDELQSYCRKMNYQETFVQKWLMLFDADQNGRITYDEYCNALGLPPKKDVIAKH 81          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A267FI43 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004334g1 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.920e-12
Identity = 37/69 (53.62%), Postives = 48/69 (69.57%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDM 234
            MDF + F  IDTDQSGEIT  EL  +  + N+ E+FV+KWL LFD +Q GRIT D++C  LGL   +D+
Sbjct:    9 MDFHKAFLSIDTDQSGEITVDELQSYCRKMNYQETFVQKWLMLFDADQNGRITYDEYCNALGLPPKKDV 77          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A1I8IIW6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 2.083e-12
Identity = 37/69 (53.62%), Postives = 48/69 (69.57%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDM 234
            MDF + F  IDTDQSGEIT  EL  +  + N+ E+FV+KWL LFD +Q GRIT D++C  LGL   +D+
Sbjct:    9 MDFHKAFLSIDTDQSGEITVDELQSYCRKMNYQETFVQKWLMLFDADQNGRITYDEYCNALGLPPKKDV 77          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A1I8I7N8 (Dynein light chain OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001380g1 PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.229e-12
Identity = 34/64 (53.12%), Postives = 45/64 (70.31%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLV 219
            MDF+  +  IDTD SGEIT  EL  +  ++N+ + FVEKWL LFD +  G IT+++FCE LGLV
Sbjct:    1 MDFLTAYEAIDTDFSGEITSEELEAYCRKHNYEDKFVEKWLRLFDHDNSGTITIEEFCETLGLV 64          
BLAST of Dynein light chain vs. TrEMBL
Match: A0A267GN94 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004334g2 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.846e-12
Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDED-MNKH 243
            MDF + F  IDTD SGEIT  EL  +  + N+ E+FV+KWL LFD +Q GRIT D++C  LGL   +D + KH
Sbjct:    9 MDFHKAFLSIDTDHSGEITVDELQSYCRKMNYQETFVQKWLMLFDADQNGRITYDEYCNALGLPPKKDVIAKH 81          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000041239.1 (SMESG000041239.1)

HSP 1 Score: 1857.03 bits (4809), Expect = 0.000e+0
Identity = 1037/1054 (98.39%), Postives = 1042/1054 (98.86%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMNKHLKHHRPSYINIXXXXXXXXXXXKMEQQIIHVSTNKPISTPIKRNSYFQEKYLXXXXXXXXXXXXXXXXXXAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKSFKFMDFLNLNKLRTKSNENKPKSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGESSANNSDITDHXXXXXXXXXXRNIFHKIFQNDKKSNIKKEDKHEKMGKQTDKK-NAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNYFRENESKNLVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEXXXXXXXXXXXQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGXXXXXXXXXXSLPKSIIENPFNSETETETENXXXXXXXXXXXXXXXXXXXSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPNPAEKFDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQXXXXXXXXXXXXXXDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP 3186
            MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDM+KHLKHHRPSYINIDDLDDFVDVDDKMEQQIIHVSTNKPISTPIKRNSYFQEKYLEEIPEMKEVEKEVITKKTAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKS KFMDFLNLNKLR KSNENK KSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGES ANNSDITDHKAENKKKEKNRNIF KIFQNDKKSN KK++KHEKMGK+TDKK NAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNY RENESK+LVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEKNDKDNSSKKNQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGDDDFADQDQDSLPKSIIENPFNS  ETETENKIHKTKNKPKDKPDPKSDKSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPN AE FDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQKIKPPYRKIKIIHKDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP
Sbjct:    1 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMHKHLKHHRPSYINIDDLDDFVDVDDKMEQQIIHVSTNKPISTPIKRNSYFQEKYLEEIPEMKEVEKEVITKKTAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKSSKFMDFLNLNKLRPKSNENKHKSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGESLANNSDITDHKAENKKKEKNRNIFQKIFQNDKKSNTKKDEKHEKMGKETDKKKNAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNYIRENESKDLVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEKNDKDNSSKKNQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGDDDFADQDQDSLPKSIIENPFNS--ETETENKIHKTKNKPKDKPDPKSDKSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPNSAETFDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQKIKPPYRKIKIIHKDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP 1052          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000041239.1 (SMESG000041239.1)

HSP 1 Score: 1846.25 bits (4781), Expect = 0.000e+0
Identity = 1032/1049 (98.38%), Postives = 1037/1049 (98.86%), Query Frame = 1
Query:   43 MFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMNKHLKHHRPSYINIXXXXXXXXXXXKMEQQIIHVSTNKPISTPIKRNSYFQEKYLXXXXXXXXXXXXXXXXXXAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKSFKFMDFLNLNKLRTKSNENKPKSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGESSANNSDITDHXXXXXXXXXXRNIFHKIFQNDKKSNIKKEDKHEKMGKQTDKK-NAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNYFRENESKNLVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEXXXXXXXXXXXQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGXXXXXXXXXXSLPKSIIENPFNSETETETENXXXXXXXXXXXXXXXXXXXSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPNPAEKFDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQXXXXXXXXXXXXXXDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP 3186
            MFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDM+KHLKHHRPSYINIDDLDDFVDVDDKMEQQIIHVSTNKPISTPIKRNSYFQEKYLEEIPEMKEVEKEVITKKTAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKS KFMDFLNLNKLR KSNENK KSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGES ANNSDITDHKAENKKKEKNRNIF KIFQNDKKSN KK++KHEKMGK+TDKK NAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNY RENESK+LVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEKNDKDNSSKKNQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGDDDFADQDQDSLPKSIIENPFNS  ETETENKIHKTKNKPKDKPDPKSDKSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPN AE FDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQKIKPPYRKIKIIHKDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP
Sbjct:    1 MFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMHKHLKHHRPSYINIDDLDDFVDVDDKMEQQIIHVSTNKPISTPIKRNSYFQEKYLEEIPEMKEVEKEVITKKTAFPLFGVSPSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNLPVEQDNKHRIRSNTVKSSSPNSKTPDKSSKFMDFLNLNKLRPKSNENKHKSATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQNPPNTSKMEFENEDKKTHLLLKGLSQKRTREKGESLANNSDITDHKAENKKKEKNRNIFQKIFQNDKKSNTKKDEKHEKMGKETDKKKNAEHYKNSTSKISSRKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKLDDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFTNNYIRENESKDLVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLSTSLNSLSHIDKDNKISFNFESIEKNDKDNSSKKNQFTDHNKIDFQHNNSEDVIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDPIGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNSLQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIEKCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPRDDVHAIKGDDDFADQDQDSLPKSIIENPFNS--ETETENKIHKTKNKPKDKPDPKSDKSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPNSAETFDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEIPEYSKLQKIKPPYRKIKIIHKDFGKNNYPNLVEDIVKIYEETKTADDWNGHERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTIESP 1047          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000042102.1 (SMESG000042102.1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.039e-16
Identity = 35/77 (45.45%), Postives = 54/77 (70.13%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMNKHLKHHR 258
            M+FI+ F  ID+D SGEITR ELI++M   N+  +FVEKWL +FD +  G IT+++FC  LGL+ +++  K ++  +
Sbjct:    1 MEFIKAFEEIDSDNSGEITRGELIRYMRLKNYKPAFVEKWLNIFDADNSGTITLEEFCNTLGLIPNKNYQKRIEKRK 77          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000008592.1 (SMESG000008592.1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.568e-16
Identity = 35/68 (51.47%), Postives = 48/68 (70.59%), Query Frame = 1
Query:   28 MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDED 231
            MD I+ F  IDTD SGEIT+ ELI +M + ++   FV KW+ +FD N  GRIT+++FC+ LGL  +ED
Sbjct:    1 MDLIKAFEEIDTDYSGEITKDELINYMIKKDYEMGFVNKWMEIFDPNNTGRITLEEFCDALGLQPNED 68          
BLAST of Dynein light chain vs. Planmine SMEST
Match: SMESG000006950.1 (SMESG000006950.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.916e-15
Identity = 35/69 (50.72%), Postives = 47/69 (68.12%), Query Frame = 1
Query:   34 FIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRGRITMDDFCERLGLVIDEDMNK 240
            FI+ +  ID D SG IT  EL  +M ENN+ E FV KWL LFD +  GRIT+++FCE LGL + + ++K
Sbjct:    5 FIKAYCQIDKDGSGTITADELRAYMTENNYQEDFVTKWLRLFDRDNTGRITLEEFCETLGLEVSDFIDK 73          
The following BLAST results are available for this feature:
BLAST of Dynein light chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FHH71.845e-1252.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FI431.920e-1253.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8IIW62.083e-1253.62Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8I7N89.229e-1253.13Dynein light chain OS=Macrostomum lignano OX=28230... [more]
A0A267GN949.846e-1252.05Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Dynein light chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041239.10.000e+098.39SMESG000041239.1[more]
SMESG000041239.10.000e+098.38SMESG000041239.1[more]
SMESG000042102.11.039e-1645.45SMESG000042102.1[more]
SMESG000008592.15.568e-1651.47SMESG000008592.1[more]
SMESG000006950.11.916e-1550.72SMESG000006950.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033411 ID=SMED30033411|Name=Dynein light chain|organism=Schmidtea mediterranea sexual|type=transcript|length=3241bp
ATTAATTAGAGCTCAAAACATTAATAAATGGATTTCATTCGCATGTTCAA
TCTGATTGACACTGACCAATCAGGTGAGATCACAAGGCCAGAGCTTATCA
AGTTTATGCATGAAAACAATTTCACAGAAAGTTTTGTTGAAAAATGGCTG
GCATTATTTGATTTTAATCAAAGAGGTCGAATAACGATGGATGATTTCTG
TGAGAGATTGGGCCTAGTAATTGATGAAGACATGAATAAACATTTGAAGC
ACCACAGGCCGTCGTACATCAATATAGATGATCTCGATGATTTTGTGGAT
GTTGATGACAAAATGGAGCAACAAATTATACATGTCAGCACAAATAAACC
AATTTCAACTCCAATAAAACGAAATTCTTATTTTCAAGAAAAATATCTCG
AAGAAATTCCTGAAATGAAAGAAGTGGAAAAAGAAGTAATAACTAAGAAA
ACAGCATTTCCACTGTTTGGAGTGTCACCAAGTAAAACAAAACCTGAGAA
AAAGGATACAAAAAACGAACAAATTTCTCATGACGTTCCAGAAGTCCAAA
CAAGCAGTGCAAACTTTAGAAAGGCATCTAGCTTGCCAAAATCAATGGAA
AATAGTAATGAAAAAAGTTACAACCTTCCAGTTGAGCAAGATAATAAACA
CAGAATAAGATCGAATACGGTGAAGTCAAGCTCTCCAAATAGTAAAACCC
CTGATAAATCATTCAAATTTATGGATTTCTTAAATTTGAATAAACTTAGA
ACCAAATCTAATGAAAACAAACCTAAAAGTGCAACTTCAGTTTCAATTAG
AAAACAAAAAAACATTGACGATAATGTCTCCAGTCCTACAACAACCAACG
AATATAGAAATAAAGATAATATAACTAAATCTAATGAAAAAGACCGCGAA
CAACCAAATTCAACTAACTTTCAAAATCCTCCAAATACTTCGAAAATGGA
ATTTGAAAATGAAGATAAAAAAACTCATTTGCTTCTGAAAGGTTTATCAC
AAAAGCGAACTCGTGAAAAAGGAGAATCTTCGGCAAACAACTCTGATATT
ACAGATCACAAAGCGGAAAATAAAAAAAAAGAAAAAAACAGAAATATTTT
CCACAAAATATTTCAAAACGATAAAAAAAGCAACATCAAAAAAGAGGATA
AACATGAAAAAATGGGTAAGCAAACAGATAAGAAGAATGCGGAGCATTAT
AAAAACTCTACATCAAAAATTTCAAGTAGAAAATATTTCGATGATAAACC
AGATCCTAAAGAAAAGAATACACAAGAAAACAGAAGATCACTTTTAGACA
ATGAACATGGGATAGAAACTGAACCAGTTTTTAAAGGTGGGAAAATAGAA
AGTAAATTGCATGATCTACTGAAATTGGACGACACTCGCATAGAAAGTTA
TATTTCAAATGAAGAAAAACTTAAAATAAAAAATCATCAAGAGTTCGAAA
AAGAAATGGATAAATTGATTCTACAAAGAAAAAGCACAAAATATTTTCCC
CAAAAAGTAAACAATGAAGAATTCACAAACAATTATTTCCGAGAGAATGA
GTCGAAAAATTTAGTTCATGATCCAGTTAGTAAAGGCTCTGAAAGATCAA
TCAAGTCATCGCCATTAGAATTGAATATTTCAAATCATCTATTGAAAAGT
CCAGCGGATGAAACTGATCTTTCAACCTCATTAAATTCTCTCAGCCATAT
TGATAAAGACAATAAAATTTCTTTCAATTTTGAATCTATTGAAAAGAACG
ATAAAGATAATTCTTCGAAAAAAAATCAGTTTACAGATCACAACAAGATT
GACTTTCAACACAATAACTCAGAAGACGTGATTGAAGAAGTCATTGTTTC
CAAAGTTCATCGTCCATTAGGGAGTCAACTGCCAGAGATTGTTGACCAAG
ATATTAATGAGACATCTAATGCTGATAAATGCCTACCTGAAGAAATCATA
ATGAAATACAATGAAAATTATGACCCCATTGGGAATGATTTGAATTTTAC
ATTTTCAGGAGAACAGAATCTCAATAACCAGACTGGAAAACGAAACCAGA
TTAAGAAAGATTTACAAACAGAACTCCTCAATGAACGGGAAAATCAGGCT
AAATTGAATAAAAATCTACGCAACTCACTACAATGGAATGCCTTAGAAAA
GGATCAAGAAAACAAAACAAATCCAAATGAATCTGATTCACTTATTCTTG
AAAAGGATTTAAATGATGACGAAAATAAAGGTTTGATAGAAGATGTGAAA
ACTAATGATCTTTTTACTTCCATTGAAAAATGTAAAAGTGATCCATTAGA
TTCCAAACCAAAGAACAGTCTCACCATTCAAATGATTGAAAACGAATTAA
ACACAAATTTCCAAGATAAAAACTCTTTGCAGGTAAATAAAAACAAACTA
AGTAAAGACTCAAAAATCATTCCTAGAGATGACGTTCATGCGATCAAAGG
TGACGATGACTTTGCAGATCAAGATCAAGATTCTCTACCAAAGTCTATCA
TTGAAAATCCATTCAATTCAGAAACGGAAACGGAAACTGAAAACAAAATT
CATAAAACAAAAAATAAACCAAAAGATAAACCTGATCCGAAATCAGATAA
AAGCGGATTGGATAATATCGAATGTCACGATGAAACGGCAATGAAAACTG
TCAACAATGAAAAGAGAATTTTACAAGAAAATAAAGATTTCAACAGATTT
CCCAAAGCGGCAGGTGATCCAAATCCAGCTGAAAAATTTGACAAAATACA
AATTGAAAGCGATTCGACTTTAACTGGAAACAAATCAAAAATTCAGAACT
ATTCGAATGAGACTATTCCATCCGTTGGCCAGTTAGGGAATATCAAAAGT
GAAACGGATCCGAATGAGAACGAAATTCCCGAATATTCAAAGCTTCAGAA
GATCAAACCCCCGTATCGTAAAATTAAAATCATCCATAAAGACTTTGGGA
AAAATAATTATCCAAATCTAGTTGAGGACATTGTGAAAATTTATGAAGAA
ACGAAAACGGCAGATGACTGGAATGGACATGAACGGATGAAGGTGTACTT
GGATCAATATTATGAACGGATCTGGAGTGTGATCATTGTCAATAAAGCCT
ATGAATTATATGTTACTTATGAAAACATGGTGATCTTTCAGTACAATTCT
TTAACATTTATCCTTTGGAAAACTATAGAGTCACCTTGACTAAGTTCTTT
TTACTATTTTATTAAAAAATTTTTGTTCATTTAAAAAAAAA
back to top

protein sequence of SMED30033411-orf-1

>SMED30033411-orf-1 ID=SMED30033411-orf-1|Name=SMED30033411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1054bp
MDFIRMFNLIDTDQSGEITRPELIKFMHENNFTESFVEKWLALFDFNQRG
RITMDDFCERLGLVIDEDMNKHLKHHRPSYINIDDLDDFVDVDDKMEQQI
IHVSTNKPISTPIKRNSYFQEKYLEEIPEMKEVEKEVITKKTAFPLFGVS
PSKTKPEKKDTKNEQISHDVPEVQTSSANFRKASSLPKSMENSNEKSYNL
PVEQDNKHRIRSNTVKSSSPNSKTPDKSFKFMDFLNLNKLRTKSNENKPK
SATSVSIRKQKNIDDNVSSPTTTNEYRNKDNITKSNEKDREQPNSTNFQN
PPNTSKMEFENEDKKTHLLLKGLSQKRTREKGESSANNSDITDHKAENKK
KEKNRNIFHKIFQNDKKSNIKKEDKHEKMGKQTDKKNAEHYKNSTSKISS
RKYFDDKPDPKEKNTQENRRSLLDNEHGIETEPVFKGGKIESKLHDLLKL
DDTRIESYISNEEKLKIKNHQEFEKEMDKLILQRKSTKYFPQKVNNEEFT
NNYFRENESKNLVHDPVSKGSERSIKSSPLELNISNHLLKSPADETDLST
SLNSLSHIDKDNKISFNFESIEKNDKDNSSKKNQFTDHNKIDFQHNNSED
VIEEVIVSKVHRPLGSQLPEIVDQDINETSNADKCLPEEIIMKYNENYDP
IGNDLNFTFSGEQNLNNQTGKRNQIKKDLQTELLNERENQAKLNKNLRNS
LQWNALEKDQENKTNPNESDSLILEKDLNDDENKGLIEDVKTNDLFTSIE
KCKSDPLDSKPKNSLTIQMIENELNTNFQDKNSLQVNKNKLSKDSKIIPR
DDVHAIKGDDDFADQDQDSLPKSIIENPFNSETETETENKIHKTKNKPKD
KPDPKSDKSGLDNIECHDETAMKTVNNEKRILQENKDFNRFPKAAGDPNP
AEKFDKIQIESDSTLTGNKSKIQNYSNETIPSVGQLGNIKSETDPNENEI
PEYSKLQKIKPPYRKIKIIHKDFGKNNYPNLVEDIVKIYEETKTADDWNG
HERMKVYLDQYYERIWSVIIVNKAYELYVTYENMVIFQYNSLTFILWKTI
ESP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030286dynein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037177DLC_sf
IPR002048EF_hand_dom
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 677..697
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..112
e-value: 1.5E-11
score: 46.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 307..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 213..231
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 834..868
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 153..167
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 292..306
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 574..593
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 149..427
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 812..868
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 256..279
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 168..200
IPR002048EF-hand domainSMARTSM00054efh_1coord: 2..30
e-value: 0.0033
score: 26.7
coord: 36..64
e-value: 6.5
score: 11.2
IPR002048EF-hand domainPFAMPF13499EF-hand_7coord: 5..59
e-value: 2.8E-8
score: 34.1
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 34..67
score: 7.428
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1..33
score: 11.78
IPR002048EF-hand domainCDDcd00051EFhcoord: 2..59
e-value: 1.8095E-8
score: 49.8537
IPR001372Dynein light chain, type 1/2PFAMPF01221Dynein_lightcoord: 966..1048
e-value: 1.5E-5
score: 25.3
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 11..23
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 3..79
IPR037177Dynein light chain superfamilySUPERFAMILYSSF54648DLCcoord: 958..1048