Dimer_Tnp_hAT domain-containing protein

Overview
NameDimer_Tnp_hAT domain-containing protein
Smed IDSMED30033409
Length (bp)2598
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dimer_Tnp_hAT domain-containing protein (SMED30033409) t-SNE clustered cells

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30033409) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dimer_Tnp_hAT domain-containing protein (SMED30033409) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dimer_Tnp_hAT domain-containing protein (SMED30033409) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033409

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30033409SMESG000074559.1 SMESG000059177.1 SMESG000037051.1 SMESG000006351.1 Contig20289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033409SMESG000074559.1 SMESG000059177.1 SMESG000037051.1 SMESG000006351.1 Contig20289uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30033409 dd_Smed_v4_20227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 99.3673 bits (246), Expect = 6.769e-37
Identity = 71/203 (34.98%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  612 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 50.447 bits (119), Expect = 6.769e-37
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 1284
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 606          

HSP 3 Score: 46.2098 bits (108), Expect = 6.769e-37
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  818 DGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 946          

HSP 4 Score: 56.225 bits (134), Expect = 2.770e-7
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  408 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMER--MRDEKLHELKKGL 493          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 98.9821 bits (245), Expect = 9.993e-37
Identity = 71/203 (34.98%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  774 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 971          

HSP 2 Score: 50.8322 bits (120), Expect = 9.993e-37
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 1284
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  708 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 768          

HSP 3 Score: 45.8246 bits (107), Expect = 9.993e-37
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  980 DGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 1108          

HSP 4 Score: 56.225 bits (134), Expect = 2.917e-7
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  570 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMER--MRDEKLHELKKGL 655          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 98.5969 bits (244), Expect = 4.632e-36
Identity = 70/203 (34.48%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            +LVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  612 RLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 48.9062 bits (115), Expect = 4.632e-36
Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          

HSP 3 Score: 46.2098 bits (108), Expect = 4.632e-36
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  818 DGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 946          

HSP 4 Score: 56.6102 bits (135), Expect = 2.004e-7
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  408 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTER--MRDEKLHELKKGL 493          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 97.8265 bits (242), Expect = 6.892e-36
Identity = 70/203 (34.48%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            +LVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  779 RLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 976          

HSP 2 Score: 49.2914 bits (116), Expect = 6.892e-36
Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  713 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 763          

HSP 3 Score: 45.8246 bits (107), Expect = 6.892e-36
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  985 DGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 1113          

HSP 4 Score: 55.0694 bits (131), Expect = 5.913e-7
Identity = 32/88 (36.36%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L N E     K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  575 LSNGEYSTVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTER--MRDEKLHELKKGL 660          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 82.4185 bits (202), Expect = 1.309e-28
Identity = 63/206 (30.58%), Postives = 109/206 (52.91%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL---MAQLNS 1915
            K V + +D + A+ G+    + L +     P+  S HC++++  L  K++  ++ +++    +I N I AR  Q RL K+  EE     +T L ++ +VRWLS  K L R     +E+ VF+ S       L +  WLL L +L DI +KLN++NL +QGK+  +F +   + +  +KL      +E+ N + FP L   + ++NS
Sbjct:  337 KCVDVCSDASRAVDGKIAEAVTLIKY--VAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQ-HTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINS 539          

HSP 2 Score: 65.855 bits (159), Expect = 1.309e-28
Identity = 65/228 (28.51%), Postives = 111/228 (48.68%), Query Frame = 1
Query:  670 CLIC-----NTSLALPKKGNSERHFRTVHKKY----------EIDYPQNSDLRKVKIMELKTGLATQQS--VLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            C++C     N+SLA P K    RH  T H  Y           +D P+N+     KI+      AT+ S  V     L  +A TI  + +        KP +  V+ +         +F +  +K      I+ +QLS ++V RR+ +++ D++++L   L+ C  FSLQ+DES DV  ++ L++F+R  F + + +E+LL    L+    GE+IF+   +F+   +I
Sbjct:  132 CVLCKKILSNSSLA-PSK--LRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLI--------KPCAKDVVMR---------MFDEQYSKK-----IDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRF-NKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEI 333          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 139.813 bits (351), Expect = 6.093e-82
Identity = 83/227 (36.56%), Postives = 128/227 (56.39%), Query Frame = 1
Query:  622 EWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            EWE+ YF +    K  CLIC TSL+  K  N ERHF ++H     ++P+ S+LRK K+  LK     Q  +  K +  S+  T+AS +++  IA+AKKP+ +G   K    +A   L  +  N   +  ++ DLQLSR++V +R+++I   ++  L  DL+ C  FS+ +DES DV D  Q  IF+R +  D   +EELL I+PLK +T G D+  +  T +    +
Sbjct:   23 EWEDLYFFVERNGKPFCLICQTSLSHFKASNLERHFTSLHSAVAREFPKGSELRKHKVKTLKGQAEKQTQLFRKFSKHSETVTLASYQLAWNIARAKKPYLEGEFVKKCLSDAVAILCPENEN---LKRSVKDLQLSRHTVEQRISDIDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDLKETLMTVVEKANL 246          

HSP 2 Score: 135.961 bits (341), Expect = 6.093e-82
Identity = 82/196 (41.84%), Postives = 113/196 (57.65%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLM 1900
            KL +I TD APAMLG     + LC+ DD FP F ++HCIIHQ+   +K +N+  IM    +I N +   +L  R FK  ++E D D  ++L  H  VRWLS    L RF   +  +K+FL  + +EY  L D +W+ DL FL D+   LN LN+ LQGK K +  +V SV AF  KL L    L+K +  +FP L+
Sbjct:  250 KLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLNLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLL 445          

HSP 3 Score: 71.633 bits (174), Expect = 6.093e-82
Identity = 50/160 (31.25%), Postives = 81/160 (50.62%), Query Frame = 1
Query: 1942 RYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*K-------TGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIASN 2400
            RY T ++N+   F+ RF + ++    + F++NP F   SG   C K  +       +         +R  S  +  T     I    ++  +++ + KL + FGSTY CE  FS LK++K+K+R+ LTD H+   LR   T Y P+ KKIV+  +C  S+
Sbjct:  461 RYATLLENLEQSFEERFSNLQQKRQQITFLINP-FTAESG---CLKAPLVEDEAASQLEMIELSEDDRLKSVLREGTVEFWKIVPVERYPNVKQAALKLLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVSH 616          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 112.464 bits (280), Expect = 1.657e-51
Identity = 72/198 (36.36%), Postives = 118/198 (59.60%), Query Frame = 2
Query: 1316 LVSITTD*APAMLGRYNCFINLCR--VDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            L+S+ TD AP+M G    F+ L +  +D N    L++HCI+HQ+ LCA+        +M    ++ N I A++L  R F+  ++E D + Y++L +H  VRWLS  + L+RF   ++ +K FL S+   Y  LED +WL  L F+ D+TS LN LN  LQ +     QM+ +V +F++KL++    +++  L++FP+L
Sbjct:  244 LISVATDGAPSMRGSKRGFVTLLQKALDRNL---LAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSE-YSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQLEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSL 437          

HSP 2 Score: 112.079 bits (279), Expect = 1.657e-51
Identity = 74/207 (35.75%), Postives = 111/207 (53.62%), Query Frame = 1
Query:  670 CLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLN 1290
            CL+C+  L+  KK N ERHF+  H  +  +YP  S+ RK  I  L   L  +++   K      + T AS   +R I K  KPF+DG   K +F+  ++ LFSDF NK EI+  I D+ LS  +V  R  +++ ++ +Q  KD+    A+S+  DES D        +  R +  D   +EE++ +IPLKG+T GEDI  +    LN
Sbjct:   37 CLLCSEKLSNNKKSNVERHFQGRHATFAAEYPVGSE-RKSAIALLVEKLEERKNKFKKWIASPNSTTAASFVATREIIKRGKPFTDGDYMKESFINISEHLFSDFKNKTEIIQKIKDMPLSAKTVKERAIKMAGNITEQQIKDINSAPAYSIACDESCDTA------LLCRYVNSD-GPQEEIIKLIPLKGQTRGEDICEAVLKCLN 235          

HSP 3 Score: 56.9954 bits (136), Expect = 9.148e-8
Identity = 24/48 (50.00%), Postives = 33/48 (68.75%), Query Frame = 1
Query: 2227 FGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKI 2370
            FGSTY CE  FS +  IK+KYR  LT E L SC++  +T+Y P+ +K+
Sbjct:  582 FGSTYLCEQIFSNMNYIKSKYRTRLTHESLQSCVKIKVTSYMPDVEKL 629          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.102 bits (318), Expect = 3.572e-65
Identity = 81/241 (33.61%), Postives = 131/241 (54.36%), Query Frame = 1
Query:  556 KNILENCEIMNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFK 1278
            K+  +NC        +  ++ ++WE +YF    K+K  CL+C  +++  K+ N +RH+ T+H      Y   + L  +K  +LK+ L  Q+++ +  T   KAA  AS  V+  IAK K PFS G + K   L+ A++    F N+  +   +  + LS  +V R +  I+  L  +L+  L     FS+ +DESTD+ D  QL+IF+R +  +F   EELL I+PL G T GEDI+++ K
Sbjct:    8 KSFTKNCAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIK--DLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEA----FGNET-MAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          

HSP 2 Score: 115.161 bits (287), Expect = 3.572e-65
Identity = 83/201 (41.29%), Postives = 107/201 (53.23%), Query Frame = 2
Query: 1307 FFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*A--RSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLIS---RGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPN 1894
            F     I TD A AM+GR        R+     D   +HCI+HQ+ LC   + MADIM    K+ N I    RSL  R FK  +EE D   Y +L +H +VRWLS  K L RF    KEI ++L          + L D  +L  L FLTDIT  LN LNL LQG+D+ + Q+ S + AF+ KL LL   L KN+L +F +
Sbjct:  250 FSSCTCIVTDGARAMVGRNQGLAG--RLRKEGIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELD-AAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFES 447          

HSP 3 Score: 49.2914 bits (116), Expect = 3.572e-65
Identity = 40/165 (24.24%), Postives = 77/165 (46.67%), Query Frame = 1
Query: 1879 ELFSQFDGTT*QSAAINYDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIV 2373
            ELF +  G       +N+  ++++ ++  +  EF+ RFQDF+ ++       NPI    + +     + +         G++   S          +  + ++  LR    ++ + FGSTY CE AFS +  IK+KYRN++ D  L   +R   T+ + +  ++V
Sbjct:  450 ELFQEMKG---NGVILNF--SQFVPKMDILIHEFNTRFQDFEGMEASFKLFNNPINTDIAAQDTKYHMELCE-----LQGDQFLHSCSEKGVAFFKLLSQEQYPILRDFGMRMASMFGSTYICEKAFSDMGFIKSKYRNSICDSTLQQIIRISTTSISADIDELV 604          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 127.102 bits (318), Expect = 1.116e-56
Identity = 81/241 (33.61%), Postives = 131/241 (54.36%), Query Frame = 1
Query:  556 KNILENCEIMNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFK 1278
            K+  +NC        +  ++ ++WE +YF    K+K  CL+C  +++  K+ N +RH+ T+H      Y   + L  +K  +LK+ L  Q+++ +  T   KAA  AS  V+  IAK K PFS G + K   L+ A++    F N+  +   +  + LS  +V R +  I+  L  +L+  L     FS+ +DESTD+ D  QL+IF+R +  +F   EELL I+PL G T GEDI+++ K
Sbjct:    8 KSFTKNCAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYTGEARLTIIK--DLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEA----FGNET-MAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          

HSP 2 Score: 115.161 bits (287), Expect = 1.116e-56
Identity = 83/203 (40.89%), Postives = 107/203 (52.71%), Query Frame = 2
Query: 1301 SPFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*A--RSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLIS---RGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPN 1894
              F     I TD A AM+GR        R+     D   +HCI+HQ+ LC   + MADIM    K+ N I    RSL  R FK  +EE D   Y +L +H +VRWLS  K L RF    KEI ++L          + L D  +L  L FLTDIT  LN LNL LQG+D+ + Q+ S + AF+ KL LL   L KN+L +F +
Sbjct:  248 GGFSSCTCIVTDGARAMVGRNQGLAG--RLRKEGIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELD-AAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFES 447          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 92.8189 bits (229), Expect = 3.798e-31
Identity = 70/225 (31.11%), Postives = 114/225 (50.67%), Query Frame = 1
Query:  613 YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFL 1287
            + + WE DYF +    K  CL+C+  LA+ K+ N +RH+ ++H+K    Y    D R   + EL++ L  Q++V + +T    AA  AS  +   I K K+ F    + K    E A  +   F N+ E+ +  + + L   +V RRV+ +   + Q+L   L++C  FSL +DE+TD      L+IFIR I   F   E++L  + L      ED+ +  K+ L
Sbjct:   16 FKERWELDYFFVKCNGKPLCLLCSQILAVCKEYNVKRHYISLHEKTYSQYT--GDHRMAILNELRSKLNKQETVTSIETATDTAALKASFIICEEIVKRKQAFDSVDVVK----ECAVKMARVFGNE-EMAAKFDSISLQPQTVARRVSAMHQQITQKLHAILKNCCYFSLALDETTDSCGTDLLVIFIRAIDDGFNISEDILKCVSLPKTAKEEDLLNEAKSSL 233          

HSP 2 Score: 56.6102 bits (135), Expect = 3.798e-31
Identity = 59/204 (28.92%), Postives = 95/204 (46.57%), Query Frame = 2
Query: 1307 FFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*AR-----SLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXX---XXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPN 1894
            F K  S+ T+ + +M  +      L R +    D +  HCI+H++ L   ++ M+D+M    KI+N I  +     ++ ++ FK  ++E     Y +   H +  W S  + L RF    KEI +FL     +    E          L FLTD+T  L+ L   ++ KD+ I Q+ + V  F  KL LL   L  N+L YF +
Sbjct:  239 FDKCTSVMTNGSKSMTAKSLGLSALLRKEG--ADCVVLHCIMHEEMLIGTLLKMSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSA-AYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFES 439          

HSP 3 Score: 27.335 bits (59), Expect = 3.798e-31
Identity = 11/37 (29.73%), Postives = 22/37 (59.46%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPI 2043
            D ++++ +I+ +   F+ RFQDF K++       NP+
Sbjct:  455 DFSKFVEKIEVLIENFNLRFQDFSKINSCFKLYNNPL 491          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000010836.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:63865670:63866962:-1 gene:ENSXETG00000001503.1 transcript:ENSXETT00000010836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 8.354e-26
Identity = 58/137 (42.34%), Postives = 86/137 (62.77%), Query Frame = 1
Query:  637 YFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNA-------FLEAADSLFSDFSNKAEILSAINDLQ 1026
            YF    + KC C+I +  +A+ KK N E HF T+H+KY++++P  ++L KVK+ ELK+ L+ QQ++  K   KSKAATIAS +V+ ++AK KKP+ DG I K+A       +L    S FS+   K E+ S + D Q
Sbjct:   13 YFFTNFREKCICIIYHAPVAIGKKCNVESHFTTMHRKYDVEFPVGTNLWKVKVKELKSVLSAQQAIFKKPANKSKAATIASFKVAHVLAKKKKPYEDGEIVKDAMVAVRFHYLLPEISQFSE--EKDELYSELYDYQ 147          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 97.4413 bits (241), Expect = 2.388e-37
Identity = 70/199 (35.18%), Postives = 98/199 (49.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDD----NFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   +  +   R          D  S  CIIH + LCA+ + M  +M       N I +R L    F   + E D   Y  L  H  ++WL     L+RF  S++EI  F+ SRG+    L    W+LDL FL D+T+ LN L+  LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  606 KLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQ-YGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTL 803          

HSP 2 Score: 79.337 bits (194), Expect = 2.388e-37
Identity = 65/238 (27.31%), Postives = 105/238 (44.12%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H ++   Y  +   R+ K+ ELK GL        ++ L         +  S I+   ++PF +     N+ ++ A+ +      K          Q  R+ V                       A+S+ +DE TD+ D +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  404 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSVSVSKEYNLRRHYQTNHSRHYDQY--SGQAREEKLRELKRGL--------RKYL---------LGASEIVC-PEQPFPNASPPTNSAVQPAEEVAGSLWEKLR--------QKIRSFV-----------------------AYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 85.1149 bits (209), Expect = 2.237e-16
Identity = 68/214 (31.78%), Postives = 101/214 (47.20%), Query Frame = 2
Query: 1274 LRHS*IAFKSPFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXX--XXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMA 1903
            LR   I++KS    +  + TD APA LG  + F  L  V +  P  +  HC++H QTL  K +  +  ++M +     N + A SL  RLF     + D    T L +H + RWLS  K L+R      E+K+F   +          D   L  + +L DI + LN+LNL LQG +     +   + +F+ KL L   KL++N     P L A
Sbjct:  389 LRQHEISWKS----ICGVCTDGAPATLGCQSGFQRL--VLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKT-LLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSA 595          

HSP 2 Score: 55.0694 bits (131), Expect = 4.054e-7
Identity = 71/272 (26.10%), Postives = 125/272 (45.96%), Query Frame = 1
Query:  544 CIILKNILENCEIMNT----------KKVKTYQYHKEWENDYFVIMVK---NKCCCLICNTSLALP--KKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKP--FSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAF--SLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            C     +L  C I N           + VK  +Y++ +    F   +     +  C+IC   L+    K    +RHF + H  +     ++++  + K   LK       S   KQ +   AA   S  V+  IA+  KP  F++ ++F  A       +  +F  K   LSA++   LS ++V RR++++S D+  Q+ ++++       S+Q+DESTDV +  QL++++R I  D   K+E L   PL+      D+F +  +FL   +I
Sbjct:  136 CEGFNEVLRQCRIANVDHPRPVDHGERNVKRRKYNEGFLQYGFTSTITVGIERPQCVICGVVLSAESMKPNKLKRHFESKHSSFA---GKDTNYFRSKADGLKKARPDTGSKSNKQNV---AAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTK---LSAVS---LSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYI-NDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEI 394          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 56.9954 bits (136), Expect = 1.707e-14
Identity = 50/195 (25.64%), Postives = 99/195 (50.77%), Query Frame = 2
Query: 1319 VSITTD*APAMLGRYNCFINLCRVDDNFPDFLSY-HCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXX-XXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFP 1891
            V   TD A +M  RY  F    ++ +   + +++ HC IH++ L AK ++  + +I+  + +I + +   +   ++  +  EE   + +  L ++A+VRWLS  + L R      EI++FL  +  +      ++  +  L +L DI S +N LN  LQG     F + + V  F+++L + + + ++N+   FP
Sbjct:  808 VGFCTDGAASMTDRY--FRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSE-HVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFP 999          

HSP 2 Score: 42.743 bits (99), Expect = 1.707e-14
Identity = 49/181 (27.07%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  766 QNSDL--RKVKIMELKT-GLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGV-IFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFA-TKEELLAIIPLKGKTCGEDIFSSFKTFLNS 1293
            ++SDL  + V   E K+  +  Q S L K  L  ++   AS  ++  IA   KPFS    + K   +E    +    S+  E +  I    LS +++  R+ ++S D++ QL + + +   F+LQVDES++  ++  L+ ++R I  D    KEELL    +   +   ++F     +++S
Sbjct:  624 KHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLG--SSAGEKMKTI---PLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDS 799          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 56.9954 bits (136), Expect = 2.250e-14
Identity = 50/195 (25.64%), Postives = 99/195 (50.77%), Query Frame = 2
Query: 1319 VSITTD*APAMLGRYNCFINLCRVDDNFPDFLSY-HCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXX-XXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFP 1891
            V   TD A +M  RY  F    ++ +   + +++ HC IH++ L AK ++  + +I+  + +I + +   +   ++  +  EE   + +  L ++A+VRWLS  + L R      EI++FL  +  +      ++  +  L +L DI S +N LN  LQG     F + + V  F+++L + + + ++N+   FP
Sbjct:  900 VGFCTDGAASMTDRY--FRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSE-HVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFP 1091          

HSP 2 Score: 42.3578 bits (98), Expect = 2.250e-14
Identity = 49/181 (27.07%), Postives = 89/181 (49.17%), Query Frame = 1
Query:  766 QNSDL--RKVKIMELKT-GLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGV-IFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFA-TKEELLAIIPLKGKTCGEDIFSSFKTFLNS 1293
            ++SDL  + V   E K+  +  Q S L K  L  ++   AS  ++  IA   KPFS    + K   +E    +    S+  E +  I    LS +++  R+ ++S D++ QL + + +   F+LQVDES++  ++  L+ ++R I  D    KEELL    +   +   ++F     +++S
Sbjct:  716 KHSDLENKPVDFFEEKSLEMECQNSSLKKCLLVEESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLG--SSAGEKMKTI---PLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDS 891          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 53.1434 bits (126), Expect = 1.247e-6
Identity = 54/210 (25.71%), Postives = 95/210 (45.24%), Query Frame = 1
Query:  613 YHKEWENDYFVI--MVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPL 1236
            +  EW   Y V+     +   CL+C   +A  ++ +  RH+   H+ YE       + R   +  L+ G  +  +VLT +    + AT A + + R +A   + + +G  F +  +E    L     +   +L  I+   LS     +R+  I  +L+ QL     D  A+SL +D+   V   + L++FIR +  D   +E+LL II L
Sbjct:   18 FRPEWTQRYLVVEPAEGDGALCLVCRRLVASTRERDVRRHYEAEHEFYE--RFVGDEERAALVERLRQGDMSLAAVLTPE----ERATRAGLGLCRFLALKGRGWGEG-DFVHQCMEVL--LREVLPDHVGVLEGID---LSPEITRQRILSIDSNLRSQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGRDLEVQEDLLTIINL 215          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 2.241e-44
Identity = 71/203 (34.98%), Postives = 104/203 (51.23%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   +  +         +C+  D      S  CIIH ++LCA+ + M  IM+      N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L  + W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  613 KLVSVASTGTPAMVDANDGLVTKLKSKVAMVCKGSD----LKSVCCIIHPESLCAQKLKMDHIMSVVVNAVNWICSRGLNHSEFTTLLYELDCQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSQDWIKDLAFLVDMTMHLNTLNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLARNNLAHFPTL 810          

HSP 2 Score: 79.337 bits (194), Expect = 2.241e-44
Identity = 61/238 (25.63%), Postives = 111/238 (46.64%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL                                         +   L ++D++  +   + ++ + +N  +   N+  + V +++ +L ++L++ +    A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  409 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTEK--MRDEKLQELKEGL-----------------------------------------RKYLLGSSDTVCPE---QKQVFAKVNPRE---NAAVQPVEDVAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 597          

HSP 3 Score: 44.2838 bits (103), Expect = 2.241e-44
Identity = 37/140 (26.43%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVI-------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +    +   ++ +        +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KT+Y + L D   DS L 
Sbjct:  819 DGLNYIPKIVELKTEFQKRLSDFKLYESELTLFSSPFSMKIESVQEALQMEVIDLQCNTVLKTKYDKVGIPEFYKHLWGSYPK----------YKIHCA-KILSMFGSTYICEQLFSIMKLSKTEYCSQLKDSQWDSVLH 947          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99NI3|GT2D2_MOUSE (General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.454e-36
Identity = 70/199 (35.18%), Postives = 98/199 (49.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDD----NFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   +  +   R          D  S  CIIH + LCA+ + M  +M       N I +R L    F   + E D   Y  L  H  ++WL     L+RF  S++EI  F+ SRG+    L    W+LDL FL D+T+ LN L+  LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  606 KLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQ-YGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTL 803          

HSP 2 Score: 79.337 bits (194), Expect = 1.454e-36
Identity = 65/238 (27.31%), Postives = 105/238 (44.12%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H ++   Y  +   R+ K+ ELK GL        ++ L         +  S I+   ++PF +     N+ ++ A+ +      K          Q  R+ V                       A+S+ +DE TD+ D +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  404 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSVSVSKEYNLRRHYQTNHSRHYDQY--SGQAREEKLRELKRGL--------RKYL---------LGASEIVC-PEQPFPNASPPTNSAVQPAEEVAGSLWEKLR--------QKIRSFV-----------------------AYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86UP8|GTD2A_HUMAN (General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 2.987e-36
Identity = 71/203 (34.98%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  612 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 50.447 bits (119), Expect = 2.987e-36
Identity = 26/61 (42.62%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 1284
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 606          

HSP 3 Score: 46.2098 bits (108), Expect = 2.987e-36
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  818 DGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 946          

HSP 4 Score: 56.225 bits (134), Expect = 1.330e-6
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  408 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYMER--MRDEKLHELKKGL 493          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6EKJ0|GTD2B_HUMAN (General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.044e-35
Identity = 70/203 (34.48%), Postives = 102/203 (50.25%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            +LVS+ +   PAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLS    L+RF  S++EI  F+ SRG+    L    W+ DL FL D+T  LN LN+ LQG  + + QM   ++AF  KL L    L +NNL +FP L
Sbjct:  612 RLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 48.9062 bits (115), Expect = 2.044e-35
Identity = 22/51 (43.14%), Postives = 33/51 (64.71%), Query Frame = 1
Query: 1114 AFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            A+S+ +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          

HSP 3 Score: 46.2098 bits (108), Expect = 2.044e-35
Identity = 41/140 (29.29%), Postives = 58/140 (41.43%), Query Frame = 1
Query: 1933 DANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYR-HSGRRNCRKIVI------AI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR 2331
            D   YI +I  + TEF +R  DFK  +  L    +P   +  S     +  VI       +  +Y K G          +Y            +   C+ K+ + FGSTY CE  FS +K+ KTKY + L D   DS L 
Sbjct:  818 DGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSSPFSTKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLWGSYPK----------YKHHCA-KILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQWDSVLH 946          

HSP 4 Score: 56.6102 bits (135), Expect = 9.626e-7
Identity = 32/88 (36.36%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  565 LENCEIMNTKKVKTYQ----YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGL 816
            L   E+ N  K K  Q    + ++WE  YF + V+N   CLIC  S+++ K+ N  RH++T H K+   Y +   +R  K+ ELK GL
Sbjct:  408 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTER--MRDEKLHELKKGL 493          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.422e-28
Identity = 64/206 (31.07%), Postives = 109/206 (52.91%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL---MAQLNS 1915
            K V + +D + AM G+    + L +     P+  S HC++++  L  K++  ++ +++    +I N I AR  Q RL K+  EE     +T L ++ +VRWLS  K L R     +E+ VF+ S       L +  WLL L +L DI +KLN++NL +QGK+  +F +   + +  +KL      +E+ N + FP L   + ++NS
Sbjct:  338 KCVDVCSDASRAMDGKIAEAVTLIKY--VAPESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQ-HTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINS 540          

HSP 2 Score: 65.855 bits (159), Expect = 1.422e-28
Identity = 65/228 (28.51%), Postives = 111/228 (48.68%), Query Frame = 1
Query:  670 CLIC-----NTSLALPKKGNSERHFRTVHKKY----------EIDYPQNSDLRKVKIMELKTGLATQQS--VLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            C++C     N+SLA P K    RH  T H  Y           +D P+N+     KI+      AT+ S  V     L  +A TI  + +        KP +  V+ +         +F +  +K      I+ +QLS ++V RR+ +++ D++++L   L+ C  FSLQ+DES DV  ++ L++F+R  F + + +E+LL    L+    GE+IF+   +F+   +I
Sbjct:  133 CVLCKKILSNSSLA-PSK--LRRHLETKHAAYKDKDISFFKQHLDSPENNKPPTPKIVNTDNESATEASYNVSYHIALSGEAHTIGELLI--------KPCAKDVVMR---------MFDEQYSKK-----IDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRF-NKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEI 334          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A498MQH6 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_023746 PE=4 SV=1)

HSP 1 Score: 246.899 bits (629), Expect = 2.844e-144
Identity = 129/220 (58.64%), Postives = 162/220 (73.64%), Query Frame = 1
Query:  649 MVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            M  +KC CLIC + +A+PKKGN ERHFRTVHK Y+ D+P  S+LRK ++ ELK+ L+ QQS  ++ T K++AAT AS RVS +I K KK F DG + K AF+EAADSLF DF NK EILS+I  LQLSR++VTRR   ++ DL QQL KD+ DC  FSLQ+DESTDV D +QL IFIRM+F D   KEELL ++P+K  T GEDIF SFK F+   ++PV
Sbjct:    1 MSFSKCICLICQSVIAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKARAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSEAMAEDLTQQLWKDVTDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLPV 220          

HSP 2 Score: 218.009 bits (554), Expect = 2.844e-144
Identity = 122/204 (59.80%), Postives = 150/204 (73.53%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFL-ISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLN 1912
            P  KLVSITTD APAM+GR N FI  CR DD FPDFL+YHCIIHQQ LCAK++NM +IM    KIA SI ARSLQRRLF+  +E +D D ++EL +H DVRWLS  KFLQRFR    EIK FL +++  EY  L D  WLLDL FLTD+T+ LNDLNL+LQGKDK +  M+SSV AFK+K+     KL++++L  F NL+++L 
Sbjct:  219 PVCKLVSITTDGAPAMVGRSNGFIAKCREDDAFPDFLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCD-HSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLVSELE 421          

HSP 3 Score: 101.679 bits (252), Expect = 2.844e-144
Identity = 60/174 (34.48%), Postives = 94/174 (54.02%), Query Frame = 1
Query: 1918 AAINYDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTK--------------RCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIAS 2397
            + +  D  RY  +I N  +EFD+RFQDF  L+ +  FM  P  ++          V+++ ++     + N+S  +              R       +  + K+  +RKC+  L A FGSTY CESAFS +KIIK+KYR+ +TD+HL+ CLR  I++Y P+Y  + D +QC +S
Sbjct:  426 SCVQLDNARYKEQIDNCLSEFDKRFQDFALLEPIATFMCYP--FQEDAE------VVSLASKIATLFHLNSSGVEDEILTLQADIQLKSRAHGQFWNLLTEEKYPNMRKCATSLTALFGSTYLCESAFSHMKIIKSKYRSTMTDDHLEVCLRLAISSYCPDYASLADSIQCKSS 591          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A498NXL4 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_003188 PE=4 SV=1)

HSP 1 Score: 247.284 bits (630), Expect = 1.665e-143
Identity = 130/220 (59.09%), Postives = 161/220 (73.18%), Query Frame = 1
Query:  649 MVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            M  +KC CLIC + +A+PKKGN ERHFRTVHK Y+ D+P  S+LRK ++ ELK+ L+ QQS  ++ T K KAAT AS RVS +I K KK F DG + K AF+EAADSLF DF NK EILS+I  LQLSR++VTRR   ++ DL QQL KD+ DC  FSLQ+DESTDV D +QL IFIRM+F D   KEELL ++P+K  T GEDIF SFK F+   ++PV
Sbjct:    1 MSFSKCICLICQSVIAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKGKAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSEAMAEDLTQQLWKDITDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLPV 220          

HSP 2 Score: 214.927 bits (546), Expect = 1.665e-143
Identity = 121/204 (59.31%), Postives = 149/204 (73.04%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFL-ISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLN 1912
            P  KLVSITTD APAM+GR N FI  CR DD FPD L+YHCIIHQQ LCAK++NM +IM    KIA SI ARSLQRRLF+  +E +D D ++EL +H DVRWLS  KFLQRFR    EIK FL +++  EY  L D  WLLDL FLTD+T+ LNDLNL+LQGKDK +  M+SSV AFK+K+     KL++++L  F NL+++L 
Sbjct:  219 PVCKLVSITTDGAPAMVGRSNGFIAKCREDDAFPDSLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCD-HSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLVSELE 421          

HSP 3 Score: 101.679 bits (252), Expect = 1.665e-143
Identity = 60/174 (34.48%), Postives = 94/174 (54.02%), Query Frame = 1
Query: 1918 AAINYDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTK--------------RCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIAS 2397
            + +  D  RY  +I N  +EFD+RFQDF  L+ +  FM  P  ++          V+++ ++     + N+S  +              R       +  + K+  +RKC+  L A FGSTY CESAFS +KIIK+KYR+ +TD+HL+ CLR  I++Y P+Y  + D +QC +S
Sbjct:  426 SCVQLDNARYKEQIDNCLSEFDKRFQDFALLEPIATFMCYP--FQEDAE------VVSLASKIATLFHLNSSGVEDEILTLQADIQLKSRAHGQFWNLLTEEKYPNMRKCATSLTALFGSTYLCESAFSHMKIIKSKYRSTMTDDHLEVCLRLAISSYCPDYASLADSIQCKSS 591          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A498N136 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_021180 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 2.170e-139
Identity = 123/206 (59.71%), Postives = 152/206 (73.79%), Query Frame = 1
Query:  691 LALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            +A+PKKGN ERHFRTVHK Y+ D+P  S+LRK ++ ELK+ L+ QQS  ++ T K KAAT AS RVS +I K KK F DG + K AF+EAADSLF DF NK EILS+I  LQLSR++VTRR   ++ DL QQL KD+ DC  FSLQ+DESTDV D +QL IFIRM+F D   KEELL ++P+K  T GEDIF SFK F+   ++PV
Sbjct:    9 IAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKGKAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSEAMAEDLTQQLWKDITDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLPV 214          

HSP 2 Score: 214.542 bits (545), Expect = 2.170e-139
Identity = 121/204 (59.31%), Postives = 148/204 (72.55%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFL-ISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLN 1912
            P  KLVSITTD APAM+GR N FI  CR DD FPD L+YHCIIHQQ LCAK++NM +IM    KIA SI ARSLQRRLF+  +E +D D ++EL +H DVRWLS  KFLQRFR    EIK FL +++  EY  L D  WLLDL FLTD+T+ LNDLNL+LQGKDK +  M+SSV AFK+K+     KL++++L  F NL ++L 
Sbjct:  213 PVCKLVSITTDGAPAMVGRSNGFIAKCREDDAFPDSLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCD-HSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLASELE 415          

HSP 3 Score: 102.834 bits (255), Expect = 2.170e-139
Identity = 61/168 (36.31%), Postives = 90/168 (53.57%), Query Frame = 1
Query: 1918 AAINYDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSST--------KRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIAS 2397
            + +  D  RY  +I N  +EFD+RFQDF  L+ +  FM  P  ++         + IA       +G  +   T         R       +  + K+  +RKC+  L A FGSTY CESAFS +KIIK+KYR+ +TD+HL+ CLR  I++Y P+Y  + D +QC +S
Sbjct:  420 SCVQLDNARYKEQIDNCLSEFDKRFQDFALLEPIATFMCYP--FQEDAEVVSLALKIATLFHLNSSGVEDEILTLQADIQLKSRAHGQFWNLLTEEKYPNMRKCATSLTALFGSTYLCESAFSHMKIIKSKYRSTMTDDHLEVCLRLAISSYCPDYASLADSIQCKSS 585          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1B6LJ79 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.48535 PE=4 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 2.285e-131
Identity = 135/241 (56.02%), Postives = 175/241 (72.61%), Query Frame = 1
Query:  586 NTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            ++KK KTY ++ EWE DYF   VK+KC CLICN S+++ KKGN ERHF+TVH   E DYP NS LR+ K+++LK+ L  QQS   K   K+KAAT AS RVS++IA+ +KP+ DG + K AFLEAAD+LF +F NKAEI+SAI  +QLS N+V RRV  +S D+  QLK D + CS FSLQ DESTD+VD +QL +F+RM+F DF TKEEL+ ++PL G   G D+F +FK  + S  IPV
Sbjct:    4 SSKKPKTYHFYAEWETDYFFTQVKDKCVCLICNVSVSVGKKGNVERHFKTVHSGIEKDYPLNSTLRREKVLQLKSQLNAQQSTFFKTLDKNKAATEASFRVSKVIAQHRKPYEDGELIKVAFLEAADTLFDNFKNKAEIMSAIKSVQLSANTVMRRVEAMSSDVVSQLKTDFDRCSYFSLQFDESTDIVDTAQLAVFVRMVFEDFETKEELVKVVPLTGHNTGNDVFLAFKKLIESENIPV 244          

HSP 2 Score: 163.31 bits (412), Expect = 2.285e-131
Identity = 97/198 (48.99%), Postives = 123/198 (62.12%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            P  KLV I TD APAM+G    FI LCR D + P FLSYHCIIHQQ+L  K ++M ++M T  K+ N I A +LQR LF+   EE D   Y EL +H +VRWLS  + LQRF+  +  +  F   RGE    LED  WL D  FLTD+T KLN LNL+LQGKDK I  ++S V +F +KL L    + +    +FP+L
Sbjct:  243 PVKKLVGIATDGAPAMVGVEKGFIALCRKDSDIPKFLSYHCIIHQQSLYGKFLSMNNVMKTVVKVVNKIRAHALQRLLFRELTEELDCQ-YGELLLHTEVRWLSRGRVLQRFKDLLPALVKFFKERGEHLTELEDPIWLQDFAFLTDLTEKLNGLNLQLQGKDKNIGGLISDVTSFSKKLELWEKNVIQFEYKHFPSL 439          

HSP 3 Score: 89.7373 bits (221), Expect = 2.285e-131
Identity = 56/163 (34.36%), Postives = 88/163 (53.99%), Query Frame = 1
Query: 1945 YITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIF-----------YRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIASN 2400
            Y+  + ++  +FD+RFQDFK++  V  F+ +P              +H G      + I + +       R  S+T         +  K K+  + + + +L A F STY CE++FS +K IK KYRN LTDEHLD+C+R   TTY+PN+KK++DG +   S+
Sbjct:  458 YVEILSDLREQFDQRFQDFKRIFIVAQFVNSPFVEIDAEDFSTCVVKHFGEDQA-AVEIEVVDFQNDLSLRTLSTTGNI----WPLVPKEKYPIVTRVALRLKAMFSSTYLCEASFSSMKFIKNKYRNRLTDEHLDNCIRMAATTYSPNFKKLLDGQKEFHSS 615          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Match: A0A1B6KSV1 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.48534 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.729e-130
Identity = 136/241 (56.43%), Postives = 176/241 (73.03%), Query Frame = 1
Query:  586 NTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            ++KK KTY ++ EWE DYF   VK+KC CLICN S+++ KKGN ERHF+TVH   E DYP NS LR+ K+++LK+ L  QQS   K   K+KAAT AS RVS++IA+ +KP+ DG + K AFLEAAD+LF +F NKAEI+SAI  +QLS N+V RRV  +S D+  QLK D + CS FSLQ DESTD+VD +QL +F+RM+F DF TKEEL+ ++PL G T G D+F +FK  + S  IPV
Sbjct:    4 SSKKPKTYHFYAEWETDYFFTQVKDKCVCLICNVSVSVGKKGNVERHFKTVHSGIEKDYPLNSTLRREKVLQLKSQLNAQQSTFFKTLDKNKAATEASFRVSKVIAQHRKPYEDGELIKVAFLEAADTLFDNFKNKAEIMSAIKSVQLSANTVMRRVEAMSSDVVSQLKTDFDRCSYFSLQFDESTDIVDTAQLAVFVRMVFEDFETKEELVKVVPLTGHTTGNDVFLAFKKVIESENIPV 244          

HSP 2 Score: 159.073 bits (401), Expect = 1.729e-130
Identity = 95/198 (47.98%), Postives = 121/198 (61.11%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            P  KLV I  D  PAM+G    FI LCR D + P FLSYHCIIHQQ+L  K ++M ++M T  K+ N I A +LQR LF+   EE D   Y EL +H +VRWLS  + LQRF+  +  +  F   RGE    LED  WL D  FLTD+T KLN LNL+LQGKDK I  ++S V +F +KL L    + +    +FP+L
Sbjct:  243 PVKKLVGIAMDGPPAMVGVEKGFIALCRKDSDIPKFLSYHCIIHQQSLYGKFLSMNNVMKTVVKVVNKIRAHALQRLLFRELTEELDCQ-YGELLLHTEVRWLSRGRVLQRFKDLLPALVKFFKERGEHLTELEDPIWLQDFAFLTDLTEKLNGLNLQLQGKDKNIGGLISDVTSFSKKLELWEKNVIQFEYKHFPSL 439          

HSP 3 Score: 89.7373 bits (221), Expect = 1.729e-130
Identity = 56/163 (34.36%), Postives = 88/163 (53.99%), Query Frame = 1
Query: 1945 YITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIF-----------YRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIASN 2400
            Y+  + ++  +FD+RFQDFK++  V  F+ +P              +H G      + I + +       R  S+T         +  K K+  + + + +L A F STY CE++FS +K IK KYRN LTDEHLD+C+R   TTY+PN+KK++DG +   S+
Sbjct:  458 YVEILSDLREQFDQRFQDFKRIFIVAQFVNSPFVEIDAEDFSTCVVKHFGEDQA-AVEIEVVDFQNDLSLRTLSTTGNI----WPLVPKEKYPIVTRVALRLKAMFSSTYLCEASFSSMKFIKNKYRNRLTDEHLDNCIRMAATTYSPNFKKLLDGQKEFHSS 615          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.111 bits (466), Expect = 3.310e-89
Identity = 113/204 (55.39%), Postives = 142/204 (69.61%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLNS 1915
            PF KLVSIT D APAM G +  FI LCR D  FP F+SYHC+IHQQ L +KV++ + +MT   KI NSI A++LQ RLFK  ++E D + Y +L +HADVRWLS  K LQRF   + EI  FL SR EEY+ L D+ WLLDL FLTD+TSKLN+LN +LQGKD  +  MVS+V AFK KL+L   +L+   L +F N+   LN+
Sbjct:  239 PFQKLVSITRDGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASKVVDFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAE-YGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEEYRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNN 441          

HSP 2 Score: 166.392 bits (420), Expect = 3.310e-89
Identity = 98/239 (41.00%), Postives = 142/239 (59.41%), Query Frame = 1
Query:  592 KKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLA-LPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIP 1305
            KK KTY +H+EWEN++    VK+K  CLIC          G+ +  + T  KK     P      K+++ E    ++  Q  L  +  K+ A T AS RVS ++AK KK F+DG +FK A L A+DSLF DF NK EI +AI+++ L   +V RRV  +S D+ +Q+  DL  C  FSLQ DES D+ D +QL++F+RM F D + KE+ L ++PL  +T GEDI+ +F+T+     +P
Sbjct:    9 KKAKTYNFHQEWENEFLFTTVKDKTVCLICQQCDGQCCTTGHQQGSWATEGKKKWHWVP------KLQVPESPAVISGNQRHLPLE--KANANTEASFRVSHLLAKHKKTFTDGELFKEAMLFASDSLFRDFKNKDEIRTAISNMSLGPATVVRRVELLSEDISKQVLSDLSRCEYFSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFRTYATENDLP 239          

HSP 3 Score: 78.9518 bits (193), Expect = 1.053e-14
Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 1
Query: 2194 LRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQ 2385
            L  C+ K+ A FGSTYFCE +F Q+KIIK+KYR  LTD HL  C+R  ++ YTP+YK   D +Q
Sbjct:  527 LSACALKVKAFFGSTYFCEMSFPQMKIIKSKYRTCLTDAHLTDCVRLAVSNYTPDYKAPADSVQ 590          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 124.405 bits (311), Expect = 2.924e-66
Identity = 79/198 (39.90%), Postives = 118/198 (59.60%), Query Frame = 2
Query: 1316 LVSITTD*APAMLGRYNCFINLCR-----VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKE-IKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFP 1891
            LV +TTD APAM G  N  + L +     ++ + P  ++YHCIIHQ+ LC KV+ M +I+TT  K  N I AR L  R F++ ++E D + + ++  H +VRWLS  +F     + ++E I +F+ S+G     L D KWL D   L DIT  L  LN KLQG+ + I QM   + AF++KL L + + +++NL +FP
Sbjct:  240 LVGLTTDGAPAMCGEKNGLVGLMKGKMQKMNCHMP-LITYHCIIHQEALCGKVLGMDNIVTTVMKTVNFIRARGLNHRQFQMFLQEIDSE-HGDVLYHTEVRWLSRSRF-----FELREDIALFMQSKGNPLSELSDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFP 430          

HSP 2 Score: 123.635 bits (309), Expect = 2.924e-66
Identity = 79/221 (35.75%), Postives = 122/221 (55.20%), Query Frame = 1
Query:  613 YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKI-MELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSS 1272
            + + WE +Y  ++   +  CL+C  ++++ K+ N  RHF T   K+   Y + S   K +I  ELK  L +QQ++ TK T K+ AA  AS  V+  IA+A K FS G   K   L+  + +  D       +    ++ LSRN++  RV E++ +L  QL ++    +AFSL VDESTD  D +QL IFIR +  D +  E+LL +  + G T G+DIF +
Sbjct:   14 FQQRWEGEYMFVLQGERPVCLLCCEAVSVIKEYNLRRHFDT---KHGAKYGKASLQEKQQIAQELKDKLKSQQNLFTKATAKNSAAVKASFIVAEEIARASKYFSGGAFLKQCMLKVCEQVCPD------QIQTFKNVSLSRNTIADRVKELAENLATQLAEETRSYTAFSLAVDESTDNTDTAQLAIFIRGVKSDLSVTEDLLDVAAMHGTTTGQDIFDA 225          

HSP 3 Score: 46.595 bits (109), Expect = 2.924e-66
Identity = 42/163 (25.77%), Postives = 68/163 (41.72%), Query Frame = 1
Query: 1930 YDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLF------LRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLR-NCITTYTPNYKKIVDGMQCIAS 2397
            +   +  T++  + TEFDRRF DF+          NP             +  A  +   +     + S  R  +    I    + L       LR  + ++ + FGSTY CE  FS + + K K+R+ LTD++L + LR        P+   +V G +C  S
Sbjct:  443 FSCAQLTTKLSRLKTEFDRRFSDFRGQQSGFAIFANPF---------TTDVCTAPQHLQMELIELQSDSGLRAKFQDAAIQDFYRLLPPGLMPQLRLHAARVLSMFGSTYLCEQMFSIMNLNKNKHRSCLTDDNLHAVLRIASAQDLKPDIDTLVMGKRCQTS 596          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 4.124e-65
Identity = 85/237 (35.86%), Postives = 134/237 (56.54%), Query Frame = 1
Query:  610 QYHKEWENDYFVIMVKNKC-CCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDL----RKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIP 1305
            +++ EW + YF     +    CL+C   +A+ K+ N  RH+ T H       P+ +DL    RK KI  LK  L +QQ V  K+  +S+A TIAS R++ ++AK+ +PF DG   K+  LEA D +        E   A  ++ LSR ++ RR+ ++S +   QL+  + D + FS  +DESTD  D +QL IFIR +       +EL A++PL G+T G +IF++FKT + ++ +P
Sbjct:   15 KFNPEWTSKYFFYETSSAVFSCLVCLECVAVAKEYNLRRHYETKH-------PKLADLQGEDRKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPFIDGEFVKDCMLEACDVICP------EAKDAFKNISLSRTTIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLP 238          

HSP 2 Score: 132.494 bits (332), Expect = 4.124e-65
Identity = 83/199 (41.71%), Postives = 116/199 (58.29%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCR---VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFP 1891
            P+ KL ++TTD AP+M+G  N FI   +     D   +   YHCIIHQ+ LC K +    IM       N I ARSL  R F+  +E+     Y ++  H +VRWLS    L+ F     EIK+FL  +G++   +E+  W+ DL FLTD+T  LN+LNLKLQGKD+ I  +  +V AF+ KL+L   +L+K NL +FP
Sbjct:  238 PWSKLSAVTTDGAPSMVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGKHLQFKQIMDFVVSAVNFIRARSLNHREFQSFLEDIS-AAYGDVIYHTEVRWLSRGNVLKIFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFP 435          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.487 bits (319), Expect = 9.139e-63
Identity = 78/232 (33.62%), Postives = 127/232 (54.74%), Query Frame = 1
Query:  610 QYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIP 1305
            Q+ ++WE  +F +  +    CLIC   +A+ K+ N +RH+ T H +    Y    D R  ++  LKT L  QQ    K T ++ AA  AS  VS +IAKA KPF++G   K   L+AA  +        E     +++ LS N+V  R++++S D+  QL +  +  S +S+ +DESTD+ D +QL I++R +  +F   EELL +IP+ G+T  ++IF      + +  +P
Sbjct:   70 QFQEKWEVQFFFVEHRGIPTCLICTEKVAVHKEYNLKRHYTTRHAEEYAKY--QGDERANRVANLKTCLLRQQDFFKKATKENDAAVEASYVVSEMIAKAGKPFTEGEFVKKCILQAASIVCP------EKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLP 293          

HSP 2 Score: 120.939 bits (302), Expect = 9.139e-63
Identity = 77/204 (37.75%), Postives = 116/204 (56.86%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLNS 1915
            P+ + V ITTD AP+M GR N        +++  + ++ HCIIHQQ LC+K +   ++M+   K  N I +RSL+ R F+  +EE + + Y ++    +VRWLS    L+RF     E+K F+   G     L D KWL+DL FL DIT +LN LN KLQG+ + +     +V+AF  KL L   +L + N  +FP   A +++
Sbjct:  293 PWKRFVGITTDGAPSMTGRKNGL-----EEESVEEAIALHCIIHQQALCSKCLKFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESE-YGDVLYFTEVRWLSRGNILKRFFELRAEVKAFMEKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHFPACKALMDA 490          

HSP 3 Score: 34.2686 bits (77), Expect = 9.139e-63
Identity = 31/136 (22.79%), Postives = 48/136 (35.29%), Query Frame = 1
Query: 1918 AAINYDANRYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNCRKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCS----------EKLYACFGSTYFCESAFSQLKIIKTKYRN 2295
            A   +   +Y+  I  +  EFD RF DFK          +P  +         ++ +          +   +S  R  +            FLR+            ++    FGSTY CE  FS L   K+KYR+
Sbjct:  490 AGTPFSGEKYVDAILMLQEEFDHRFADFKTHRATFQIFADPFSFDVQDAPPVLQMELI---------DLQCNSELRAKFREVSGKADKLGQFLRELPLSFPELSRMFKRTMCLFGSTYLCEKLFSTLNFNKSKYRS 616          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.970e-62
Identity = 82/199 (41.21%), Postives = 118/199 (59.30%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCR---VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFP 1891
            P+ KL ++TTD A +++G  N FI   +     D   +   YHCIIHQ+ LC K ++  +IM       N I ARSL+ R F   +E+     Y ++  H +VRWLS    L+RF     EIK+FL  +G++   +E+  W+ DL FLTD+T  LN+LNLKLQGKD+ I  +  +V AF+ KL+L   +L+K NL +FP
Sbjct:  426 PWSKLSAVTTDGALSVVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGKHLHFKEIMDFVVSAVNFIRARSLKHREFPSFLEDISA-AYGDVIYHTEVRWLSRGNVLKRFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFP 623          

HSP 2 Score: 128.257 bits (321), Expect = 3.970e-62
Identity = 80/212 (37.74%), Postives = 123/212 (58.02%), Query Frame = 1
Query:  670 CLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIP 1305
            CL+C   +A+ K+ N  RH+ T H K  +   Q  D RK KI  LK  L +QQ V  K+  +S+A TIAS R++ ++AK+ +PF DG   K+  LEA D +        E   A  ++ LSR ++  R+ ++S +   QL+  + D + FS  +DESTD  D +QL IFIR +       +EL A++PL G+T G +IF++FKT + ++ +P
Sbjct:  224 CLVCLECVAVAKEYNLRRHYETKHPK--LADLQGED-RKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPFIDGEFVKDCMLEACDVICP------EAKDAFKNISLSRTTIQLRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLP 426          

HSP 3 Score: 51.6026 bits (122), Expect = 3.774e-6
Identity = 24/61 (39.34%), Postives = 37/61 (60.66%), Query Frame = 1
Query: 2206 SEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQC 2388
            ++K  + FGSTY CE  FS +K+ K+  R  LTDE+L + LR   T+  P+  ++V   +C
Sbjct:  723 AQKWISMFGSTYICEQMFSLMKLNKSPLRTRLTDENLQAVLRLATTSLEPDINQLVSERRC 783          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.052 bits (497), Expect = 1.975e-113
Identity = 126/294 (42.86%), Postives = 177/294 (60.20%), Query Frame = 2
Query: 1298 KSPFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLNSXXXXXXXXXXXXXXXXISI----QSLIDVFRISKNSTECFNLW*IQFSTG----IRVEETAEKLSLLFEIDIEKLETEIIHLQNDVLI 2155
            K P  KLVS+TTD APAM GR+  FI  C+ D +FP FL YHCIIHQQ +CAKV     +MT   KI NSI +++ Q R+FK+ ++E   + Y +L +H ++RWLS  + LQRF   + EIK F+ S+GE+   LED +W+LDL FLTD+T  LN LN +LQGKDK +   +S+V AF+ KLS+   +L+K  + +FP++ A LN  +  +  L +   K    I    Q   D F   +    C     + F T     + V  TAE+LS LF ++   +E EI+ LQND+L+
Sbjct:  239 KVPVQKLVSVTTDGAPAMTGRHVGFIAQCKNDPDFPKFLHYHCIIHQQAICAKVTGFDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAE-YGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPC-----VSFVTNPFMQVDVTSTAEQLSALFTLNAGDVEMEILTLQNDLLL 526          

HSP 2 Score: 186.037 bits (471), Expect = 1.975e-113
Identity = 101/242 (41.74%), Postives = 152/242 (62.81%), Query Frame = 1
Query:  583 MNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            M  K+ + Y +  +WE ++F     +KC CLIC T++A+P + N ERHF+T HK ++ +YP  S LR  K   LK  L  Q++  T+   KS  AT AS R +  + K KKPFSDG + K A +  A+++F D     +++S ++D+QL  +++ RRV  +S +L ++L +DL  C  FS+Q DES D    +QL+IFIRM+F DF+TKEELL ++PLK  T G DI+++ K F    ++PV
Sbjct:    1 MTEKRKRVYHFQDDWEVEFFSTSFNDKCLCLICGTAIAVPMRHNVERHFKTCHKNFDANYPPGSALRTEKARGLKAALDMQRTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEKYAPDVISTLSDVQLGASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFFVEKKVPV 242          

HSP 3 Score: 70.4774 bits (171), Expect = 1.975e-113
Identity = 32/61 (52.46%), Postives = 40/61 (65.57%), Query Frame = 1
Query: 2221 ACF-GSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIASN 2400
            ACF GSTY CESAFS +  IK K+R  LTD HL   LR  ++ Y+P+Y  +V  MQC  S+
Sbjct:  555 ACFFGSTYLCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTSH 615          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.512 bits (493), Expect = 1.834e-112
Identity = 110/242 (45.45%), Postives = 155/242 (64.05%), Query Frame = 1
Query:  583 MNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            M  K+ KTY +H EWE ++F   VK  C CLIC T++A  K+ N ERHF T HK Y   YP  S LR  K  ELKT L  QQS  T+ T  S+ A+ AS R +  + K KK F+DG + K A L  A+++F D  N ++++S ++D+QL  +++ RRV+ +S +L  QL++DL  C  FSLQ DES D    +QL++FIRM+F DF+TKEELL ++PLK  T G DI+++ K F    ++P+
Sbjct:    1 MAEKRKKTYLFHSEWEEEFFFTTVKETCVCLICGTTVATAKRHNVERHFNTCHKSYHDKYPPASALRAEKARELKTALGKQQSFFTRPTKNSQKASEASFRATHFLIKKKKAFTDGEVVKEAMLLIANTVFKDEKNGSDLISTLSDVQLGASTMARRVSAMSSNLVDQLEQDLAKCKWFSLQCDESVDSSSTAQLLVFIRMVFNDFSTKEELLTLLPLKTTTRGVDIYNTVKEFFVQKKVPL 242          

HSP 2 Score: 183.341 bits (464), Expect = 1.834e-112
Identity = 121/303 (39.93%), Postives = 166/303 (54.79%), Query Frame = 2
Query: 1298 KSPFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLNSXXXXXXXXXXXXXXXXISIQSLID---------------VFRIS----KNSTECFNLW*IQFSTGIRVEETAEKLSLLFEIDIEKLETEIIHLQNDV 2149
            K P  KLV++TTD APAM+GR   FI  C+ D +FP FL YHCIIHQQ LCAKVI    +MT   KI N+I +++ Q R+FK+ +EE   + Y +L +H ++RWLS  + L RF   ++EIK F+ S+GE+   LED +W LDL FL DIT KLN LN +LQGK K +  M+S++ AFK K++     L++  + +FP++ + L      +        K    I  L                 VF IS       T CF                AE+LS  F +D  ++E EII LQND+
Sbjct:  239 KVPLEKLVAVTTDGAPAMVGRQTGFIAHCKRDPDFPKFLHYHCIIHQQALCAKVIGFGHVMTPVVKIINNIRSKAKQHRIFKVLLEEMSAE-YGDLLLHTEIRWLSRGRVLHRFLSLLREIKEFMQSKGEDVSLLEDTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFISNPFMNGDTTCF----------------AEQLSATFNLDAGQVEIEIITLQNDL 524          

HSP 3 Score: 72.0182 bits (175), Expect = 1.834e-112
Identity = 31/63 (49.21%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2212 KLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQCIASN 2400
            K+ + FGSTY CESAFS +  IK K+R  LTD HL   L   +++YTP+Y  +V+ MQC +S+
Sbjct:  553 KVASLFGSTYLCESAFSDMNFIKNKHRTRLTDAHLRDSLTVAVSSYTPDYNTLVNSMQCQSSH 615          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028655.1 (pep primary_assembly:ASM223467v1:8:18412528:18414615:1 gene:ENSORLG00000023148.1 transcript:ENSORLT00000028655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 1.556e-67
Identity = 85/202 (42.08%), Postives = 125/202 (61.88%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFI----NLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKE-IKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPN 1894
            P+ KLV +TTD APAM G  +  +       R ++   +  +YHCIIHQ++LC K + M  +M+T  +  N I AR L  R FK  + E D + Y EL  H +VRWLS  K LQR  + ++E I +F++++G++   L DE +L ++ FL DITS LN +NL+LQG+ + I  M S+V+ FK KLSL    + K NL++FP+
Sbjct:  245 PWEKLVGLTTDGAPAMCGHRSGLVARMRERMREENVTGELTAYHCIIHQESLCGKALKMEHVMSTITRAVNLIRARGLNHRQFKAFLGELDTE-YGELPYHTEVRWLSQGKVLQRC-FELREGICLFIVNKGKDTTELRDETFLCEMAFLCDITSHLNVMNLQLQGRGRVISDMYSTVQVFKTKLSLWETHMRKENLSHFPS 444          

HSP 2 Score: 136.732 bits (343), Expect = 1.556e-67
Identity = 83/214 (38.79%), Postives = 126/214 (58.88%), Query Frame = 1
Query:  625 WENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1266
            WE +Y    V  K  CL+C   L++ K+ N  RH  T  K  + D   +++ R  K+ ELK GL +QQ++ T    +S AA  AS  V+  + K+ +PF++G   KN  L+  D++  D   K ++ S ++   LSRN+V  R++++S +LK+QL    +D  A+SL VDESTD  DI+QL IFIR +    +  EELLA+ PL G T G+D++
Sbjct:   24 WEAEYMFTEVHGKPVCLLCGERLSVMKEYNLRRHHETSKKHTDKDKNMDTEQRLQKVEELKRGLKSQQALFTIAKSQSGAAVKASFIVAEEVEKSARPFTEGEFIKNCMLKVCDAVCPD---KRQLFSNVS---LSRNTVAERIDQLSTNLKEQLVGKGKDFIAYSLAVDESTDTSDIAQLSIFIRGVDSSLSITEELLALRPLHGTTTGQDLY 231          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 121.324 bits (303), Expect = 3.961e-63
Identity = 84/226 (37.17%), Postives = 120/226 (53.10%), Query Frame = 1
Query:  628 ENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIME-LKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            ++ YF   VK +  CLIC   +A+ K  N  RH+ T   K+E  Y   SD  + K  E L   L TQQ +LTK      AA   S  +S  IA+  KPFSDG   K   L++   +        E  SA  ++ LSR +V RR+ +I+ +L+ QLK    D   FSL +DES D+ D +QL+IF+R I  +F   EEL A+  +KG T G+D+F      L+ +++
Sbjct:    6 KDKYFFTEVKGEAVCLICGAKVAVFKDYNLNRHYTT---KHEEKYRNLSDEERAKESEALLQKLQTQQGLLTKLHAPRNAAVRTSFVISHKIARNSKPFSDGEFVKECLLDSVALIC------PETKSAFENISLSRRTVARRIEDIAGNLELQLKSRAADFDCFSLALDESCDIRDTAQLLIFLRGITAEFQITEELAAMRSMKGTTTGQDLFREVNACLDMLEL 222          

HSP 2 Score: 101.679 bits (252), Expect = 3.961e-63
Identity = 71/199 (35.68%), Postives = 109/199 (54.77%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLS----YHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            KLV +TTD  P + G+    +   R+ D   + +      HCIIHQ+ LC  V+ M  ++    K  N I AR+L  R F   +EE++ + + ++  H  VRWLS  K L+       +I+ F + +G +   L DE W+ DL F  D+T+ +N LN+KLQ K   + +M S+VKAF +KL  L  +++ NNL + P L
Sbjct:  226 KLVGVTTDGCPNLTGKNVGLLK--RMQDKMTEIVQKLTFLHCIIHQEVLCKTVLKMKHVVDVVTKTVNFIRARALNHRQFVAFLEENEIE-HGDIRYHCTVRWLSLGKVLKSVWDLRGQIQDFCVDKGHDVPELSDEDWVADLGFAVDVTALMNQLNVKLQSKGLFVHEMYSAVKAFMRKLQFLSSQVKDNNLTHLPTL 421          

HSP 3 Score: 61.2326 bits (147), Expect = 3.961e-63
Identity = 46/155 (29.68%), Postives = 76/155 (49.03%), Query Frame = 1
Query: 1942 RYITEIKNINTEFDRRFQDFKKLDGVL*FMVNPIFYRHSGRRNC---------RKIVIAI*NRY*KTGNRNNSSTKRCTY*XXXXXXXXXFLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDG 2379
            +Y T ++ ++ EF RRFQDFK L+  +  + +P         NC         +  +I + +       R  S +    Y       K  F  LR+ ++K+   FGSTY CE AFS +K  K+K+R+++TD+HL + LR   +   P++  +V  
Sbjct:  433 KYSTMLEALHAEFSRRFQDFKTLESEMHVVSSPF--------NCIVDDAPSEVQMELIELQSDM-LLAERFRSVSLLDFY---SSLKKENFPHLRRHAQKILVLFGSTYHCEQAFSVMKFNKSKHRSSVTDDHLSAVLRIATSDIQPDFCALVQA 575          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035623.1 (pep primary_assembly:ASM223467v1:9:5067000:5069708:1 gene:ENSORLG00000026230.1 transcript:ENSORLT00000035623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.568 bits (327), Expect = 2.690e-61
Identity = 86/253 (33.99%), Postives = 134/253 (52.96%), Query Frame = 1
Query:  553 LKNILENCEIMNTKKVKTYQ-YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
             +N+L   ++   KKV  Y+ + ++W +++  +       CLIC+  +A  K+ N +RHF T H  +   YP   D RK    EL + +   Q  L   T +    + AS   +  I K  KPF+DG   K+  L+ A+ L+++FS+K +I+  I D+ LS  +V  R   +S  ++    KDL     FSL +DESTDV ++SQ  +  R +  D   +EE LA++PLKG T GED+F SF  F     +P+
Sbjct:   20 FRNLLR-LKMAKRKKVDEYRTFQQDWTDEFAFVERAGSAMCLICSDKIASMKRSNIKRHFDTRHAAFASKYPA-GDSRKKACQELLSRVEASQQQLRVWTQQGDGNS-ASFAAALAIVKNGKPFTDGEFAKSFMLDVANELYANFSDKDKIIKQIKDMPLSARTVHDRTIMMSNQIEATQVKDLNAAQFFSLALDESTDVSNLSQFSVIARYVAGD-TIREESLAVLPLKGTTRGEDLFKSFNEFAKEKNLPM 268          

HSP 2 Score: 126.331 bits (316), Expect = 2.690e-61
Identity = 78/200 (39.00%), Postives = 116/200 (58.00%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNL 1897
            P  KLVS+ TD AP M+G+   F+ L R  +     LS+HCI+HQ+ LCA++    + ++M+   ++ N I AR+L  R FK  +EE   + Y  L +H++VRWLS  K L RF   + EI+ FL  +  E+  L D +WLL   +L D+T  LN LN+K+QG    IF +  +V AF+ +L L +  +E   L +F  L
Sbjct:  267 PMDKLVSVCTDGAPCMVGKNRGFVALLREHEK-RRILSFHCILHQEALCAQMCGEQLGEVMSLVVRVVNFIVARALNDRQFKALLEEVG-NSYPGLLLHSNVRWLSRGKVLSRFAACLSEIRTFLERKNVEHPELADTEWLLKFYYLVDMTGHLNHLNVKMQGVGNTIFSLQQAVFAFENRLELFIADIETGRLLHFEKL 464          

HSP 3 Score: 65.4698 bits (158), Expect = 1.595e-10
Identity = 31/67 (46.27%), Postives = 43/67 (64.18%), Query Frame = 1
Query: 2185 FLFLRKCSEKLYACFGSTYFCESAFSQLKIIKTKYRNNLTDEHLDSCLRNCITTYTPNYKKIVDGMQ 2385
            F  L++ S  +   FGSTY CE +FS LK IKT  R+ LTD  L++C++  +T+Y P+YK I   MQ
Sbjct:  601 FFTLQRVSVAVLTMFGSTYACEQSFSHLKNIKTNVRSRLTDGSLNACMKLNLTSYQPDYKSISKTMQ 667          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 130.568 bits (327), Expect = 7.108e-49
Identity = 89/250 (35.60%), Postives = 138/250 (55.20%), Query Frame = 1
Query:  559 NILENCEIMNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            NI E C   N          K+W + YF + +K    CLIC  S+A+ K+ N +RHF+T H  + I+  + ++LR+ K  +L   L  +Q++  K +   +AAT AS+ ++  I K  KPFS+G   K+  LE AD +  +   K E      ++ LSR +V RR+  I+ DL  QL   ++    FS+ +DESTD+ D +QL+IFIR I   F   EELL++  LK  T G+D+F +    L+  ++P+
Sbjct:  528 NIEEECRTFN----------KDWTSKYFFVDIKTNAVCLICRESVAVFKEYNLKRHFQTKHGNFGINLNE-TELRR-KADDLVRSLKQEQTIFLKPSSIQEAATKASLVIAHKIVKHNKPFSEGEFVKDCVLEIADIICPENKKKFE------NISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFIRGIDDKFIATEELLSMEHLKDTTTGQDLFDNLIKALDKFELPL 759          

HSP 2 Score: 84.3445 bits (207), Expect = 7.108e-49
Identity = 69/204 (33.82%), Postives = 102/204 (50.00%), Query Frame = 2
Query: 1295 FKSPFFKLVSITTD*APAMLGRYNCFINLCR--VDDNFPD--FLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXX---XXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNY 1885
            F+ P  KL S+TTD AP++ G+    I   +  V +  PD   +  HCIIHQ++LC  V++   ++T             LQ + F L+  ESDH   +++  H +VRWLS  K L+R      EI +FL  +    +     K      D  F  DI  KLN+LN+KLQGK     ++ + VK+F+ KL L    L++    Y
Sbjct:  755 FELPLDKLASVTTDGAPSLTGKNVGLITKIKDHVKNLHPDHTIIPLHCIIHQESLCKSVLDFNTLLTL------------LQFKSF-LEDLESDH---SDVLYHTNVRWLSLGKVLKRVWNLKDEIVLFLEMKDITVEFTTQMKTSEWLSDFSFAVDILDKLNELNVKLQGKGVFAHELFAEVKSFQVKLQLFSRHLKEQKDRY 942          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 99.7525 bits (247), Expect = 6.685e-40
Identity = 75/230 (32.61%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  613 YHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFRTVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQI 1302
            +++EW + YF      K  CLI N S+A+ K+ N +RH+   H++   D     ++RK K   LK  L  QQS+  K                       +PF+D    K   +  A+ L        E  +   D+ LS  +  RRV EI  +L +QLK   +    +SL +DES D+ D +QLIIFIR I  DF   EEL ++  LK    G D+F   K  LNS+++
Sbjct:   15 FNEEWNSKYFFTENGGKPLCLIFNKSVAVMKEYNVKRHYEKEHERQYKDL--TGEIRKNKFRTLKASLTAQQSIFMK-----------------------RPFTDLEFVKRCLVAVAEKLC------PETKTLFQDISLSARTCARRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFIRGIDGDFNVHEELTSLCSLKDAITGNDLFIKVKETLNSLEL 213          

HSP 2 Score: 85.1149 bits (209), Expect = 6.685e-40
Identity = 63/196 (32.14%), Postives = 96/196 (48.98%), Query Frame = 2
Query: 1313 KLVSITTD*APAMLGRYNCFIN-LCRVDDNFP--DFLSYHCIIHQQTLCAKVIN-MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYF 1888
            KL  +TTD    M G     +  +C    N    + + +HCIIHQ++LC  +++ M DIM T     N I    L+ R FK  ++E D + + ++  ++ VRWLS    L+R        K +L + G                F+ DIT+ LN+LNL LQGK K +  +   + AF+ KL LL   + + NL +F
Sbjct:  217 KLKCVTTDGGRNMCGSKTGVVGRICAELQNIACDNPMVFHCIIHQESLCCTILSSMKDIMNTLISTVNYIRRHGLKHRQFKKFLKEIDSE-FNDVIYYSAVRWLSRGAVLRR--------KYYLTAIGSL-------------AFMVDITTYLNELNLNLQGKGKLLADLFCDINAFEAKLCLLKKHMIEENLTHF 390          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000060595.1 (SMESG000060595.1)

HSP 1 Score: 126.331 bits (316), Expect = 1.936e-33
Identity = 75/142 (52.82%), Postives = 94/142 (66.20%), Query Frame = 1
Query:  784 KVKIMELKTGLATQQSVLTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATK 1209
            K KI +LK  L  +Q+V T+    SK ATIAS ++S ++AK KKPF DG +FK  FL   D LF  FSNK EI+SAI DLQLS N+VT R++ IS D++ QLK DLE C  F LQ DESTD+ D  QL + + M+F  F  K
Sbjct:    7 KEKICKLKASLTVKQTVFTRHVEYSKKATIASFKISHMLAKKKKPFIDGELFKELFLTGVDCLFDRFSNKHEIVSAIQDLQLSNNTVTIRIHAISTDIQTQLKTDLEICDWFWLQFDESTDISDTEQLEVMMIMVFSQFTVK 148          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000011945.1 (SMESG000011945.1)

HSP 1 Score: 96.2857 bits (238), Expect = 5.176e-31
Identity = 64/190 (33.68%), Postives = 102/190 (53.68%), Query Frame = 2
Query: 1304 PFFKLVSITTD*APAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSWRKFLQRFRYSIKEIKVFLISRGXXXXXXXXXXXXXXXVFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLE 1867
            P  ++VSI+TD A +M+G    F+ + +   N   F+ YHCI +Q+TLCA+     +  +M     I NSI A++L  R  K  + E + + Y +  +H  ++WLS    L+R    ++EI+VFL+ +G  Y  L D + + +  F+ D+   +N LN K Q     IF M+  V +FK KLS+     E
Sbjct:  130 PLDEIVSISTDGAKSMIGVSKGFVAILKEKINHEIFV-YHCIFNQETLCAQTFPEEICKVMRLVITIINSIVAKALNHRQLKECLVEMESE-YADPLLHNKIQWLSRGNALKRLASLLQEIEVFLLEKGVHYPELTDNQRIQNFHFVVDVMYHINQLNRKPQRNGNTIFSMLEKVDSFKNKLSVFAEDFE 317          

HSP 2 Score: 58.9214 bits (141), Expect = 5.176e-31
Identity = 47/151 (31.13%), Postives = 73/151 (48.34%), Query Frame = 1
Query:  856 SKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLSRNSVTRRVNEISXXXXXXXXXXXEDCSAFSLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPV 1308
            S    I+   VS+ I+K KKP++D    K+ F+ A++ LF DF NKA+ L  I +L LS  ++  R  ++  ++  Q  +DL+  S  S  VD+S D+ D  Q+ +F R                       GEDI SS    ++   IP+
Sbjct:    4 SSNVNISGFVVSQEISKRKKPYTDKEYIKSCFINASEELFRDFKNKADNLKKIKELSLSAKTMKDRTIKMCSNITIQQIEDLKLVSGLSTAVDKSCDIKDTMQVSLFTR-----------------------GEDIASSVVECMDKYDIPL 131          
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Match: SMESG000020950.1 (SMESG000020950.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.286e-28
Identity = 56/62 (90.32%), Postives = 57/62 (91.94%), Query Frame = 2
Query: 1730 VFLTDITSKLNDLNLKLQGKDKAIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMAQLNS 1915
             FLTD  SKLNDLNL+LQGKDK IFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLM QLNS
Sbjct:   60 AFLTDFRSKLNDLNLELQGKDKTIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMTQLNS 121          
The following BLAST results are available for this feature:
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2IRD26.769e-3734.98GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD29.993e-3734.98GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B4.632e-3634.48GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
GTF2IRD2B6.892e-3634.48GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
ZBED51.309e-2830.58zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL928808.16.093e-8236.56pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.31.657e-5136.36pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000016563.13.572e-6533.61pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag11.116e-5633.61sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000028445.13.798e-3131.11general transcription factor II-I repeat domain-co... [more]
ENSXETT00000010836.18.354e-2642.34pep primary_assembly:Xenopus_tropicalis_v9.1:7:638... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtf2ird22.388e-3735.18GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Zbed52.237e-1631.78zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym61.707e-1425.64zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym62.250e-1425.64zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Epm2aip11.247e-625.71EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IFA3|GT2D2_BOVIN2.241e-4434.98General transcription factor II-I repeat domain-co... [more]
sp|Q99NI3|GT2D2_MOUSE1.454e-3635.18General transcription factor II-I repeat domain-co... [more]
sp|Q86UP8|GTD2A_HUMAN2.987e-3634.98General transcription factor II-I repeat domain-co... [more]
sp|Q6EKJ0|GTD2B_HUMAN2.044e-3534.48General transcription factor II-I repeat domain-co... [more]
sp|A4Z944|ZBED5_CANLF1.422e-2831.07Zinc finger BED domain-containing protein 5 OS=Can... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498MQH62.844e-14458.64General transcription factor II-I repeat domain-co... [more]
A0A498NXL41.665e-14359.09General transcription factor II-I repeat domain-co... [more]
A0A498N1362.170e-13959.71General transcription factor II-I repeat domain-co... [more]
A0A1B6LJ792.285e-13156.02Uncharacterized protein OS=Graphocephala atropunct... [more]
A0A1B6KSV11.729e-13056.43Uncharacterized protein OS=Graphocephala atropunct... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039226.13.310e-8955.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035253.12.924e-6639.90general transcription factor II-I repeat domain-co... [more]
ENSAMXT00000052542.14.124e-6535.86pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.19.139e-6333.62pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000037725.13.970e-6241.21pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033470.11.975e-11342.86pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.11.834e-11245.45pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000028655.11.556e-6742.08pep primary_assembly:ASM223467v1:8:18412528:184146... [more]
ENSORLT00000027093.13.961e-6337.17general transcription factor II-I repeat domain-co... [more]
ENSORLT00000035623.12.690e-6133.99pep primary_assembly:ASM223467v1:9:5067000:5069708... [more]
back to top
BLAST of Dimer_Tnp_hAT domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037770.17.108e-4935.60SMESG000037770.1[more]
SMESG000045419.16.685e-4032.61SMESG000045419.1[more]
SMESG000060595.11.936e-3352.82SMESG000060595.1[more]
SMESG000011945.15.176e-3133.68SMESG000011945.1[more]
SMESG000020950.11.286e-2890.32SMESG000020950.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033409 ID=SMED30033409|Name=Dimer_Tnp_hAT domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2598bp
ATATTTTTAAGTTTTAATTATAGATAAAATCGTTACTTAGTTGATTTTAT
TATCTACTAAACGCCTTGTTTATATTTTCAATTTTATAAGAATTCCATTT
TACGGGAATTCTATTTTACGGGAATTCCATTTTACGGGAATTCCATTTAA
AATTGATATTTTTTTAAATTTTGTATTTTCAAACTATATTTTAAAATCGT
TATGTCGAAAATATTTTTGTTTTGCTAAGAACTATTTAAAAATTCAAGTA
TACTGTTTGAATCAGCTGAACAATACTATTTTTGGATATGAAATATTTAT
ATTTTCATTTGAAATAAGTTCTGCATTTGGAATTTTTGTTATTAATTAAT
AAATACATCGTCCGTTAAGGTAAAATTAGTTATTATTTATAATTTGCTAG
TTTTTTGAGTGAAGGCTGCAAAAATTAACAGCAGTTTAATTTTTTTTTCA
TTTATACTTTGTTATCTTCAGTGAATTTAAAATTATTAAGGTTATTAATA
AGTTGATTAAACAAATTTTTGAATATTTTATTAAAAATTAAATTGCATCA
TTTTAAAAAATATTTTAGAAAACTGTGAAATAATGAATACAAAAAAAGTT
AAAACGTATCAATATCATAAAGAGTGGGAAAATGATTATTTCGTCATAAT
GGTTAAAAACAAGTGTTGTTGCTTAATTTGCAACACTAGTCTAGCTCTGC
CAAAAAAAGGAAATTCTGAAAGACACTTTAGAACAGTACACAAGAAATAT
GAAATTGACTACCCACAAAACAGTGATTTGCGGAAAGTAAAGATTATGGA
ATTAAAAACAGGTCTTGCAACCCAGCAGTCAGTTTTAACAAAACAAACAT
TAAAATCAAAAGCAGCTACCATTGCATCTGTTCGAGTAAGTAGAATTATA
GCCAAAGCCAAAAAACCTTTTAGTGATGGTGTAATTTTTAAAAACGCATT
TCTTGAGGCTGCTGATTCTTTGTTTAGTGATTTTAGTAATAAAGCGGAAA
TTCTTTCTGCTATTAATGATTTACAGTTATCGCGAAATAGTGTTACACGG
AGAGTAAATGAAATTAGCTTAGATTTAAAACAACAGTTAAAAAAAGATCT
TGAAGACTGTTCAGCTTTTTCTTTACAAGTAGATGAATCTACTGATGTAG
TTGACATATCACAGCTGATCATATTCATTAGAATGATTTTCATAGATTTT
GCAACCAAAGAGGAATTATTAGCAATTATACCTCTCAAAGGAAAAACCTG
CGGAGAGGATATATTTTCCAGTTTTAAGACATTCTTGAATAGCGTTCAAA
TCCCCGTTTTTTAAATTAGTATCAATAACCACAGATTGAGCACCTGCAAT
GTTAGGCCGGTATAACTGTTTTATTAATCTTTGTCGAGTTGATGATAATT
TTCCCGATTTTCTGTCATACCATTGCATCATTCATCAACAAACCTTGTGT
GCTAAAGTTATTAATATGGCTGATATTATGACCACAACCTTTAAAATTGC
AAACTCAATTTGAGCAAGAAGTTTACAAAGGAGACTTTTTAAATTACAAG
TCGAAGAAAGTGATCATGATGGGTATACCGAACTATTTATGCACGCAGAT
GTCAGGTGGTTAAGCTGGAGAAAATTTCTTCAACGATTCAGATACTCGAT
AAAAGAAATTAAGGTTTTTTTAATTTCTAGAGGGGAAGAATACAAATAAT
TGGAGGATGAAAAATGGCTATTAGATCTAGTATTTTTGACAGATATCACA
TCCAAACTAAACGATCTAAACCTTAAATTGCAAGGTAAGGATAAAGCAAT
ATTTCAAATGGTGAGTTCCGTAAAAGCCTTTAAACAGAAGCTCAGCCTCT
TAGTGGGTAAGCTTGAAAAAAACAACTTGAATTATTTTCCCAATTTGATG
GCACAACTTAACAGTCTGCTGCTATAAACTACGATGCTAACAGATACATA
ACTGAAATAAAAAATATCAATACAGAGTTTGATAGACGTTTTCAGGATTT
CAAAAAACTCGACGGAGTGCTTTAATTTATGGTAAATCCAATTTTCTACA
GGCATTCGGGTAGAAGAAACTGCAGAAAAATTGTCATTGCTATTTGAAAT
AGATATTGAAAAACTGGAAACAGAAATAATTCATCTACAAAACGATGTAC
TTATTAAATCAAGATCATCTGAGGAAAATAAAAGTTCCTATTCTTGAGAA
AATGTTCTGAAAAATTGTATGCATGTTTTGGATCCACTTATTTTTGCGAA
TCAGCATTTTCGCAGCTAAAAATAATCAAAACAAAATATCGCAATAACTT
AACGGATGAACACTTGGATTCATGTTTAAGAAATTGTATTACTACATATA
CTCCAAATTACAAAAAAATAGTAGATGGAATGCAATGTATAGCATCAAAC
GCTGCTGAATTTAAAAAATAAATCTAATCTTTTAATTGATTTCTTTTTTT
GTATTTTTATAGCTAAAATAACAAAATAAATTAGAACAATTTTGTTTTTT
ATTATTATTATGACACATACCGTTAATTTATCCTAATCGATCGCAATATA
TCATACATTTCAAAAGTAGATCTGCTGAAAAAAATAGTGGGCACCACT
back to top

protein sequence of SMED30033409-orf-1

>SMED30033409-orf-1 ID=SMED30033409-orf-1|Name=SMED30033409-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MNTKKVKTYQYHKEWENDYFVIMVKNKCCCLICNTSLALPKKGNSERHFR
TVHKKYEIDYPQNSDLRKVKIMELKTGLATQQSVLTKQTLKSKAATIASV
RVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS
RNSVTRRVNEISLDLKQQLKKDLEDCSAFSLQVDESTDVVDISQLIIFIR
MIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNSVQIPVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007275multicellular organism development