Beta-hexosaminidase

Overview
NameBeta-hexosaminidase
Smed IDSMED30033380
Length (bp)1762
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Beta-hexosaminidase (SMED30033380) t-SNE clustered cells

Violin plots show distribution of expression levels for Beta-hexosaminidase (SMED30033380) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Beta-hexosaminidase (SMED30033380) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Beta-hexosaminidase (SMED30033380) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033380

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033380h1SMcG0003178 Contig843GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30033380h1SMcG0003178 Contig5533newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30033380h1SMcG0003178 Contig5533uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30033380h1SMcG0003178 Contig5533newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033380h1SMcG0003178 Contig5533uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30033380h1SMcG0020866 Contig843GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30033380h1SMcG0003178 Contig40286newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033380h1SMcG0003178 Contig40286uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30033380h1SMcG0003178 dd_Smed_v4_576_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033380h1SMcG0003178 dd_Smed_v4_576_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033380h1SMcG0003178 dd_Smed_v4_576_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033380h1SMcG0003178 dd_Smed_v4_576_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033380h1SMcG0003178 dd_Smed_v4_576_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXB (hexosaminidase subunit beta [Source:HGNC Symbol;Acc:HGNC:4879])

HSP 1 Score: 471.085 bits (1211), Expect = 2.613e-160
Identity = 232/506 (45.85%), Postives = 329/506 (65.02%), Query Frame = 1
Query:  133 PKPFYIYSGGNVFNLV-ENIKIQN-----PYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            P P  +    N+ +L  EN  I +       P C LL +A +R+  Y++     ++E    Q+ +++   ++ + T       +P  +  ESY + V +    + +  VWG LR L+T  Q+ Y+ S G   INE+ + D  RF  RG+++DTSRH+LPV+ IL  ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  ++++AR RGIRV+PEFD+PGH+LSWGKGQK+LLTPCYS      SFGPI+PTL+ TY+FL   FKE+ E+FPD  +HLGGDEV F CW+SNP+I +F  + GF  DF KL+ +Y+ K+ +++  +     +  ++VWQEVFD+K ++    TI+ VWK +  + +E++ VT S +  +LS+ WYL+ ISYG DW KYY  +P +F G   +K L IGGEAC+WGEYVDATN+  R WPRAS V ERLWS++ V D++D  +RL   RCR+V  G  A+ +  G  YCN
Sbjct:   58 PLPLLVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQAKTQVQ-QLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSY-SLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATI-----NKGSIVWQEVFDDKAKLAPG-TIVEVWK-DSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAAQPLYAG--YCN 552          
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 456.062 bits (1172), Expect = 9.095e-155
Identity = 228/477 (47.80%), Postives = 319/477 (66.88%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIY--INYEGPINQSISK--ISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGED---KWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGG 1608
            P C++L++A +R+   L+ S      Y      ++ K  + +S+VT   +       PT   +E+Y + +  D   ++S+ VWG LR L+T  Q+ ++ + G   IN+T + D  RF  RGL+LDTSRH+LP+ +ILD +++M+ +KLNVFHWH+VDD SFPY+S TFP+L  KGS++  +H+YT +DV  ++++AR RGIRV+ EFD+PGH+LSWG G   LLTPCYSGS+PSG+FGP++P+L+ TY F++  F EV  +FPD  LHLGGDEV+F CWKSNP I +F  K GF  DF +L+ +Y+  L ++V       K +  +VWQEVFDNK ++ Q  TII VW+ ED    + +E+  VTK+ + A+LS+ WYLN ISYG DW  +Y  +P  F+G   +K LVIGGEACMWGEYVD TN++ R WPRA  VAERLWSN+  +DL     RL  FRC L+  G  A+ +N G
Sbjct:   56 PGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQ-----LPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYG---KGY--VVWQEVFDNKVKI-QPDTIIQVWR-EDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVG 520          
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 454.907 bits (1169), Expect = 3.347e-154
Identity = 225/490 (45.92%), Postives = 320/490 (65.31%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNS-----------------IYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGED---KWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGG 1608
            P C++L++A +R+   L+ S                 +++     + +++  +S+ +   C         PT   +E+Y + +  D   ++S+ VWG LR L+T  Q+ ++ + G   IN+T + D  RF  RGL+LDTSRH+LP+ +ILD +++M+ +KLNVFHWH+VDD SFPY+S TFP+L  KGS++  +H+YT +DV  ++++AR RGIRV+ EFD+PGH+LSWG G   LLTPCYSGS+PSG+FGP++P+L+ TY F++  F EV  +FPD  LHLGGDEV+F CWKSNP I +F  K GF  DF +L+ +Y+  L ++V       K +  +VWQEVFDNK ++ Q  TII VW+ ED    + +E+  VTK+ + A+LS+ WYLN ISYG DW  +Y  +P  F+G   +K LVIGGEACMWGEYVD TN++ R WPRA  VAERLWSN+  +DL     RL  FRC L+  G  A+ +N G
Sbjct:   56 PGCSVLDEAFQRYRDLLFGSGSWPRPYLTGWPHQAYPVFLGKRHTLEKNVLVVSV-VTPGCNQ------LPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYG---KGY--VVWQEVFDNKVKI-QPDTIIQVWR-EDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNVG 531          
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXA (hexosaminidase subunit alpha [Source:HGNC Symbol;Acc:HGNC:4878])

HSP 1 Score: 448.358 bits (1152), Expect = 4.466e-152
Identity = 224/465 (48.17%), Postives = 313/465 (67.31%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIYIN--YEGPINQSISK--ISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGED---KWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLV 1572
            P C++L++A +R+   L+ S      Y      ++ K  + +S+VT   +       PT   +E+Y + +  D   ++S+ VWG LR L+T  Q+ ++ + G   IN+T + D  RF  RGL+LDTSRH+LP+ +ILD +++M+ +KLNVFHWH+VDD SFPY+S TFP+L  KGS++  +H+YT +DV  ++++AR RGIRV+ EFD+PGH+LSWG G   LLTPCYSGS+PSG+FGP++P+L+ TY F++  F EV  +FPD  LHLGGDEV+F CWKSNP I +F  K GF  DF +L+ +Y+  L ++V       K +  +VWQEVFDNK ++ Q  TII VW+ ED    + +E+  VTK+ + A+LS+ WYLN ISYG DW  +Y  +P  F+G   +K LVIGGEACMWGEYVD TN++ R WPRA  VAERLWSN+  +DL     RL  FRC L+
Sbjct:   56 PGCSVLDEAFQRYRDLLFGSGSWPRPYLTGKRHTLEKNVLVVSVVTPGCNQ-----LPTLESVENYTLTINDDQCLLLSETVWGALRGLETFSQLVWKSAEGTFFINKTEIEDFPRFPHRGLLLDTSRHYLPLSSILDTLDVMAYNKLNVFHWHLVDDPSFPYESFTFPELMRKGSYNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGIPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYG---KGY--VVWQEVFDNKVKI-QPDTIIQVWR-EDIPVNYMKELELVTKAGFRALLSAPWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELL 508          
BLAST of Beta-hexosaminidase vs. Ensembl Human
Match: HEXB (hexosaminidase subunit beta [Source:HGNC Symbol;Acc:HGNC:4879])

HSP 1 Score: 382.489 bits (981), Expect = 7.192e-129
Identity = 181/337 (53.71%), Postives = 242/337 (71.81%), Query Frame = 1
Query:  622 MSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  ++++AR RGIRV+PEFD+PGH+LSWGKGQK+LLTPCYS      SFGPI+PTL+ TY+FL   FKE+ E+FPD  +HLGGDEV F CW+SNP+I +F  + GF  DF KL+ +Y+ K+ +++  +     +  ++VWQEVFD+K ++    TI+ VWK +  + +E++ VT S +  +LS+ WYL+ ISYG DW KYY  +P +F G   +K L IGGEAC+WGEYVDATN+  R WPRAS V ERLWS++ V D++D  +RL   RCR+V  G  A+ +  G  YCN
Sbjct:    1 MAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYS-LSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATI-----NKGSIVWQEVFDDKAKLAPG-TIVEVWK-DSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAAQPLYAG--YCN 327          
BLAST of Beta-hexosaminidase vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 351.288 bits (900), Expect = 4.243e-114
Identity = 190/467 (40.69%), Postives = 269/467 (57.60%), Query Frame = 1
Query:  289 PINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMA-YRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGP--IDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVN---FNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG--EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWH-----------KYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTD-LNDMANRLHEFRCRLVINGFNAETMNGGGTYC 1620
            P+          ++T    DE     P     E Y + V+     I ++ VWG LRA+++L  +  Y   S    I    ++D+ RF  RG+M+D+SRHFL V  I   +E+MS++KLNV HWH+VD ESFPY S  FP+L   G++    HVY+++D+  ++ FAR RGIRV+PEFD PGH+ SW +G+K  LT C+   K   +F P  +DP  +  + F+++  +EV E FPD  LHLGGDEV+     CW+ N +I  F  + GF ND   L+ Y+  KL  +V+ L +K+   K + WQEVFDN   +     +I++WKG   ++  +++  +T  N+  ++S+CWYLNYI YG DW            +YY CDP NF+G   +K+LV GG A +WGE VD TN+ +R WPRAS  AERLWS    T    D   R+HE RCRLV  G+  +  N    YC
Sbjct:   84 PVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSP-RHVYSREDIADVIAFARLRGIRVIPEFDLPGHTSSW-RGRKGFLTECFD-EKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKGFGNDTVLLENYFFEKLYKIVENLKLKR---KPIFWQEVFDNN--IPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQKELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRGYRIQP-NNNPDYC 541          
BLAST of Beta-hexosaminidase vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 351.288 bits (900), Expect = 4.243e-114
Identity = 190/467 (40.69%), Postives = 269/467 (57.60%), Query Frame = 1
Query:  289 PINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMA-YRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGP--IDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVN---FNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG--EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWH-----------KYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTD-LNDMANRLHEFRCRLVINGFNAETMNGGGTYC 1620
            P+          ++T    DE     P     E Y + V+     I ++ VWG LRA+++L  +  Y   S    I    ++D+ RF  RG+M+D+SRHFL V  I   +E+MS++KLNV HWH+VD ESFPY S  FP+L   G++    HVY+++D+  ++ FAR RGIRV+PEFD PGH+ SW +G+K  LT C+   K   +F P  +DP  +  + F+++  +EV E FPD  LHLGGDEV+     CW+ N +I  F  + GF ND   L+ Y+  KL  +V+ L +K+   K + WQEVFDN   +     +I++WKG   ++  +++  +T  N+  ++S+CWYLNYI YG DW            +YY CDP NF+G   +K+LV GG A +WGE VD TN+ +R WPRAS  AERLWS    T    D   R+HE RCRLV  G+  +  N    YC
Sbjct:   84 PVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSP-RHVYSREDIADVIAFARLRGIRVIPEFDLPGHTSSW-RGRKGFLTECFD-EKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKGFGNDTVLLENYFFEKLYKIVENLKLKR---KPIFWQEVFDNN--IPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQKELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRGYRIQP-NNNPDYC 541          
BLAST of Beta-hexosaminidase vs. Ensembl Celegans
Match: hex-1 (Beta-hexosaminidase A [Source:UniProtKB/Swiss-Prot;Acc:Q22492])

HSP 1 Score: 351.288 bits (900), Expect = 4.243e-114
Identity = 190/467 (40.69%), Postives = 269/467 (57.60%), Query Frame = 1
Query:  289 PINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMA-YRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGP--IDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVN---FNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG--EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWH-----------KYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTD-LNDMANRLHEFRCRLVINGFNAETMNGGGTYC 1620
            P+          ++T    DE     P     E Y + V+     I ++ VWG LRA+++L  +  Y   S    I    ++D+ RF  RG+M+D+SRHFL V  I   +E+MS++KLNV HWH+VD ESFPY S  FP+L   G++    HVY+++D+  ++ FAR RGIRV+PEFD PGH+ SW +G+K  LT C+   K   +F P  +DP  +  + F+++  +EV E FPD  LHLGGDEV+     CW+ N +I  F  + GF ND   L+ Y+  KL  +V+ L +K+   K + WQEVFDN   +     +I++WKG   ++  +++  +T  N+  ++S+CWYLNYI YG DW            +YY CDP NF+G   +K+LV GG A +WGE VD TN+ +R WPRAS  AERLWS    T    D   R+HE RCRLV  G+  +  N    YC
Sbjct:   84 PVEMKTGGTEDFIITVTVKDECPSGPPVHGASEEYLLRVSLTEAVINAQTVWGALRAMESLSHLVFYDHKSQEYQIRTVEIFDKPRFPVRGIMIDSSRHFLSVNVIKRQLEIMSMNKLNVLHWHLVDSESFPYTSVKFPELHGVGAYSP-RHVYSREDIADVIAFARLRGIRVIPEFDLPGHTSSW-RGRKGFLTECFD-EKGVETFLPNLVDPMNEANFDFISEFLEEVTETFPDQFLHLGGDEVSDYIVECWERNKKIRKFMEEKGFGNDTVLLENYFFEKLYKIVENLKLKR---KPIFWQEVFDNN--IPDPNAVIHIWKGNTHEEIYEQVKNITSQNFPVIVSACWYLNYIKYGADWRDEIRGTAPSNSRYYYCDPTNFNGTVAQKELVWGGIAAIWGELVDNTNIEARLWPRASAAAERLWSPAEKTQRAEDAWPRMHELRCRLVSRGYRIQP-NNNPDYC 541          
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Match: Hexo1 (gene:FBgn0041630 transcript:FBtr0300774)

HSP 1 Score: 212.231 bits (539), Expect = 1.650e-60
Identity = 148/472 (31.36%), Postives = 236/472 (50.00%), Query Frame = 1
Query:  289 PINQSISKISISMVTNC-TDDENTKLWPTENMIESYQMEVTKDG-----IFIMSKEVWGILRALQTLFQMAY--RISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKG-QKNLLTPCYSGSKPSGSF------GPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF---PNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLT----IINVW-KGEDKWQQEMAE----VTKSNYTAVLSSCWYLNYISYG-------IDWHKYYTCDPQNFDGK-KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            P  + +++    M  N  T DE T    T +  ESY +++  D        I +   +G    L+TL Q+     I           + D   +++RGL+LDTSR++  V++I   +E M++ KLN FHWHI D  SFP + K  P+L   G++ +   VYT++DV  ++++ R RGIRV+PEFD+P H    G+G Q   +T C++ ++P  SF      G +DPT+++ Y  L  ++  + + F   + H+GGDEV+ +CW S+  I  +  K G+     DF +L G++  +    V  +A        ++W      +  +D+ L     II +W  G D   +++ E    +  SNY A+   C    +++ G       I W K Y    ++  G  +  V+G E  +W E +D   + +R WPRAS +AERLWSN +        +RL   R RLV NG  AE M
Sbjct:  121 PDRKVLARGGYRMSVNINTPDEPTPARLTLDTDESYTLDIDTDASGHVLANITASNFFGARHGLETLAQLIVYDDIRREVQVTANATINDAPVYKWRGLLLDTSRNYYSVKSIKRTLEGMALVKLNTFHWHITDSHSFPLEVKKRPELHKLGAYSQ-RQVYTRRDVAEVVEYGRVRGIRVMPEFDAPAHV---GEGWQHKNMTACFN-AQPWKSFCVEPPCGQLDPTVNEMYDVLEDIYGTMFDQFNPDIFHMGGDEVSTSCWNSSQPIQQWMKKQGWGLETADFMRLWGHFQTEALGRVDKVA-NGTHTPIILWTSGLTEEPFIDEYLNPERYIIQIWTTGVDPKVKKILERGYKIIVSNYDALYLDCGGAGWVTDGNNWCSPYIGWQKVYDNSLKSIAGDYEHHVLGAEGAIWSEQIDEHTLDNRFWPRASALAERLWSNPA-EGWRQAESRLLLHRQRLVDNGLGAEAM 585          
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Match: Hexo1 (gene:FBgn0041630 transcript:FBtr0333567)

HSP 1 Score: 212.231 bits (539), Expect = 1.650e-60
Identity = 148/472 (31.36%), Postives = 236/472 (50.00%), Query Frame = 1
Query:  289 PINQSISKISISMVTNC-TDDENTKLWPTENMIESYQMEVTKDG-----IFIMSKEVWGILRALQTLFQMAY--RISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKG-QKNLLTPCYSGSKPSGSF------GPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF---PNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLT----IINVW-KGEDKWQQEMAE----VTKSNYTAVLSSCWYLNYISYG-------IDWHKYYTCDPQNFDGK-KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            P  + +++    M  N  T DE T    T +  ESY +++  D        I +   +G    L+TL Q+     I           + D   +++RGL+LDTSR++  V++I   +E M++ KLN FHWHI D  SFP + K  P+L   G++ +   VYT++DV  ++++ R RGIRV+PEFD+P H    G+G Q   +T C++ ++P  SF      G +DPT+++ Y  L  ++  + + F   + H+GGDEV+ +CW S+  I  +  K G+     DF +L G++  +    V  +A        ++W      +  +D+ L     II +W  G D   +++ E    +  SNY A+   C    +++ G       I W K Y    ++  G  +  V+G E  +W E +D   + +R WPRAS +AERLWSN +        +RL   R RLV NG  AE M
Sbjct:  121 PDRKVLARGGYRMSVNINTPDEPTPARLTLDTDESYTLDIDTDASGHVLANITASNFFGARHGLETLAQLIVYDDIRREVQVTANATINDAPVYKWRGLLLDTSRNYYSVKSIKRTLEGMALVKLNTFHWHITDSHSFPLEVKKRPELHKLGAYSQ-RQVYTRRDVAEVVEYGRVRGIRVMPEFDAPAHV---GEGWQHKNMTACFN-AQPWKSFCVEPPCGQLDPTVNEMYDVLEDIYGTMFDQFNPDIFHMGGDEVSTSCWNSSQPIQQWMKKQGWGLETADFMRLWGHFQTEALGRVDKVA-NGTHTPIILWTSGLTEEPFIDEYLNPERYIIQIWTTGVDPKVKKILERGYKIIVSNYDALYLDCGGAGWVTDGNNWCSPYIGWQKVYDNSLKSIAGDYEHHVLGAEGAIWSEQIDEHTLDNRFWPRASALAERLWSNPA-EGWRQAESRLLLHRQRLVDNGLGAEAM 585          
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Match: Hexo1 (gene:FBgn0041630 transcript:FBtr0073237)

HSP 1 Score: 212.231 bits (539), Expect = 1.650e-60
Identity = 148/472 (31.36%), Postives = 236/472 (50.00%), Query Frame = 1
Query:  289 PINQSISKISISMVTNC-TDDENTKLWPTENMIESYQMEVTKDG-----IFIMSKEVWGILRALQTLFQMAY--RISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKG-QKNLLTPCYSGSKPSGSF------GPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF---PNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLT----IINVW-KGEDKWQQEMAE----VTKSNYTAVLSSCWYLNYISYG-------IDWHKYYTCDPQNFDGK-KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            P  + +++    M  N  T DE T    T +  ESY +++  D        I +   +G    L+TL Q+     I           + D   +++RGL+LDTSR++  V++I   +E M++ KLN FHWHI D  SFP + K  P+L   G++ +   VYT++DV  ++++ R RGIRV+PEFD+P H    G+G Q   +T C++ ++P  SF      G +DPT+++ Y  L  ++  + + F   + H+GGDEV+ +CW S+  I  +  K G+     DF +L G++  +    V  +A        ++W      +  +D+ L     II +W  G D   +++ E    +  SNY A+   C    +++ G       I W K Y    ++  G  +  V+G E  +W E +D   + +R WPRAS +AERLWSN +        +RL   R RLV NG  AE M
Sbjct:  121 PDRKVLARGGYRMSVNINTPDEPTPARLTLDTDESYTLDIDTDASGHVLANITASNFFGARHGLETLAQLIVYDDIRREVQVTANATINDAPVYKWRGLLLDTSRNYYSVKSIKRTLEGMALVKLNTFHWHITDSHSFPLEVKKRPELHKLGAYSQ-RQVYTRRDVAEVVEYGRVRGIRVMPEFDAPAHV---GEGWQHKNMTACFN-AQPWKSFCVEPPCGQLDPTVNEMYDVLEDIYGTMFDQFNPDIFHMGGDEVSTSCWNSSQPIQQWMKKQGWGLETADFMRLWGHFQTEALGRVDKVA-NGTHTPIILWTSGLTEEPFIDEYLNPERYIIQIWTTGVDPKVKKILERGYKIIVSNYDALYLDCGGAGWVTDGNNWCSPYIGWQKVYDNSLKSIAGDYEHHVLGAEGAIWSEQIDEHTLDNRFWPRASALAERLWSNPA-EGWRQAESRLLLHRQRLVDNGLGAEAM 585          
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Match: Hexo1 (gene:FBgn0041630 transcript:FBtr0073235)

HSP 1 Score: 211.846 bits (538), Expect = 2.726e-60
Identity = 148/472 (31.36%), Postives = 236/472 (50.00%), Query Frame = 1
Query:  289 PINQSISKISISMVTNC-TDDENTKLWPTENMIESYQMEVTKDG-----IFIMSKEVWGILRALQTLFQMAY--RISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKG-QKNLLTPCYSGSKPSGSF------GPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF---PNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLT----IINVW-KGEDKWQQEMAE----VTKSNYTAVLSSCWYLNYISYG-------IDWHKYYTCDPQNFDGK-KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            P  + +++    M  N  T DE T    T +  ESY +++  D        I +   +G    L+TL Q+     I           + D   +++RGL+LDTSR++  V++I   +E M++ KLN FHWHI D  SFP + K  P+L   G++ +   VYT++DV  ++++ R RGIRV+PEFD+P H    G+G Q   +T C++ ++P  SF      G +DPT+++ Y  L  ++  + + F   + H+GGDEV+ +CW S+  I  +  K G+     DF +L G++  +    V  +A        ++W      +  +D+ L     II +W  G D   +++ E    +  SNY A+   C    +++ G       I W K Y    ++  G  +  V+G E  +W E +D   + +R WPRAS +AERLWSN +        +RL   R RLV NG  AE M
Sbjct:  121 PDRKVLARGGYRMSVNINTPDEPTPARLTLDTDESYTLDIDTDASGHVLANITASNFFGARHGLETLAQLIVYDDIRREVQVTANATINDAPVYKWRGLLLDTSRNYYSVKSIKRTLEGMALVKLNTFHWHITDSHSFPLEVKKRPELHKLGAYSQ-RQVYTRRDVAEVVEYGRVRGIRVMPEFDAPAHV---GEGWQHKNMTACFN-AQPWKSFCVEPPCGQLDPTVNEMYDVLEDIYGTMFDQFNPDIFHMGGDEVSTSCWNSSQPIQQWMKKQGWGLETADFMRLWGHFQTEALGRVDKVA-NGTHTPIILWTSGLTEEPFIDEYLNPERYIIQIWTTGVDPKVKKILERGYKIIVSNYDALYLDCGGAGWVTDGNNWCSPYIGWQKVYDNSLKSIAGDYEHHVLGAEGAIWSEQIDEHTLDNRFWPRASALAERLWSNPA-EGWRQAESRLLLHRQRLVDNGLGAEAM 585          
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Match: Hexo2 (gene:FBgn0041629 transcript:FBtr0071249)

HSP 1 Score: 201.83 bits (512), Expect = 1.266e-56
Identity = 138/450 (30.67%), Postives = 224/450 (49.78%), Query Frame = 1
Query:  364 WPTENMIESYQMEV--TKDGIF--IMSKEVWGILRALQTLFQMAY-RISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHS---LSWG--KGQKNLLTPCYSGS--------KPSGSFGPIDPTLDQTYTFLNKLFKEVIEI-FPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF---PNDFAKLQGYYMIKLTNLVQGLAVK-----KKDFKTMVWQEVFDNKNEVDQKLT----IINVW-KGEDKWQQEMAEVTKSNYTAVLSS--CWYLNYISYG----IDWHKYYTCDPQNFDGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            WPT+   ESY + V  T+   F  I +  V+G   A +TL  +    +S+G L +    + D+  F  RG++LDT+R+F+P++ I   ++ M+ SKLNV HWH+VD  SFP +    P++   G++   S  Y+++D L ++ +AR RGIR++ E D P H+     WG   G  N ++ C + S         P G   P++   D  Y  L ++F++V E+  P+  LH+GGDEV   CW +   I +     G+      F +L   +  +  N    +  +     K+    ++W     N   ++  L     II  W + +D   +E+    +  Y  ++S+   WYL++  +G     +W   Y+         KD V+GGE CMW EYVD  ++ SR WPRA   AER+WSN   + L     R + +R RL+  G +A+ +
Sbjct:  173 WPTD---ESYALVVRTTETATFVDIQATTVYGARHAFETLSNLVTGSLSNGLLMVTTANITDRPAFSHRGVLLDTARNFVPLKFIRSTLDAMAASKLNVLHWHVVDTHSFPLEITRVPEMQRYGAYSS-SQTYSRQDALNLVKYARLRGIRILIEIDGPSHAGNGWQWGPAAGLGN-MSVCLNQSPWRRFCVQPPCGQLNPLN---DHMYAVLKEIFEDVAEVGAPEETLHMGGDEVFLPCWNNTDEIRDGMRARGYDLSEQSFLRLWSQFHQRNLNAWDEINERMYPGIKEPKSVIIWSSHLTNPRYIETYLPKERFIIQTWVESQDALNREL---LQRGYRLIVSTKNAWYLDHGFWGSTSYYNWRTVYSSG-MPVGRSKDQVLGGEVCMWSEYVDQNSLESRIWPRAGAAAERMWSNPKSSALL-AQRRFYRYRERLLARGIHADAV 609          
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 482.256 bits (1240), Expect = 3.787e-165
Identity = 237/477 (49.69%), Postives = 318/477 (66.67%), Query Frame = 1
Query:  214 CNLLNDAIKR--------FTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMA-NRLHEFRCRLVINGFNAETMNGG 1608
            C++L+ A KR        FTK   + +++  +  +      +S+S+ T   D      +P E+  ESY + V++    + S  VWG LR L++  Q+ YR   GA  +N+T + D  RF FRGL+LDTSRH+LP+  IL  ++ M+ SK NVFHWHIVDD SFPYQS+TFPDLS KG+FH F+H+YTQ DV+R+++ AR RGIRVVPEFDSPGH+ SWGKGQ +LLTPCY GSKPSG++GP+DPT+D TY F+ +L KEV  +FPD+ +HLGGDEV+F CW+SNP +  F  K GF  DF KL+ +YM  + N+   L     +  ++VWQ+VFD    + Q  T++ +WKGE  +Q E++++TK+ +  +LS+ WY+N+I+YG DW   Y   PQNF G   +K LVIGGE  MWGEYVDATN+  R WPRA   AERLWSN+  T   D+A  RL EFRC LV  G  AE +  G
Sbjct:   65 CSVLDTAFKRYFSIIFPDFTKDALHDMWLEPKAFV------LSVSVKTRGCDG-----YPDEDSDESYNLSVSEGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIVDFPRFAFRGLLLDTSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYTQSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYKGSKPSGTYGPVDPTVDTTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWQSNPSVGKFMEKMGFGRDFTKLESFYMESIMNITAAL-----NKTSIVWQDVFDYHERIPQG-TVLEIWKGE-TYQTELSKMTKAGHRVLLSAPWYINHITYGQDWRNSYAVQPQNFSGTEEQKKLVIGGEVAMWGEYVDATNLNPRLWPRACAAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQAEPLFVG 523          
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 460.299 bits (1183), Expect = 1.805e-156
Identity = 239/503 (47.51%), Postives = 330/503 (65.61%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNF---DGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGG 1608
            PLP+ +   S    F L      + + K     P C+LL +A +R+ +Y++  +    +       S +S   V   + D     +P+    ESY + V +    + +  VWG LR L+T  Q+ Y    G   IN+T + D  RF  RG++LD+SRHFLP++ IL N+E M+++K NVFHWHIVDD SFP+ S+TFP+LS KG++H F+HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWG G K+LLTPCYSGS PSGSFGP++P L+ +Y F+ +LFKE+  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D++KL+ +Y+ +L ++V   A  KK +  MVWQEVFDN  ++    T++ VWKG D  ++E+  VT + +T +LS+ WYL+YISYG DW +YY  +P +F   D +K LVIGGEAC+WGEYVDATN+  R WPRAS VAERLWS+ SVTD+ +   RL + RCR+V  G  AE +  G
Sbjct:   39 PLPQKYQ--SSAVAFKLSAASFQIVHAKQSTAGPSCSLLENAFRRYFEYMFGELKRQEKSRKKAFDSDLSELQVWITSADPECDGYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFPRFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKGAYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSPSGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQGFGTDYSKLESFYIQRLLDIV---AATKKGY--MVWQEVFDNGVKLKDD-TVVEVWKGNDM-KEELQNVTGAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTGTDAQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPAEPLFVG 532          
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 449.129 bits (1154), Expect = 2.591e-152
Identity = 229/477 (48.01%), Postives = 307/477 (64.36%), Query Frame = 1
Query:  214 CNLLNDAIKR--------FTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMA-NRLHEFRCRLVINGFNAETMNGG 1608
            C++L+ A KR        FTK   + +++  +  +      +S+S+ T   D      +P E+  ESY + V++    + S  VWG LR L++  Q+ YR   GA  +N+T + D  RF FRGL+LDTSRH+LP+  IL  ++ M+ SK NVFHWHIVDD SFPYQS+TFPDLS KG+FH F+H+YTQ DV+R+++ AR RGIRVVPEFDSPGH+ SWGKGQ +LLTPCY GSKPSG++GP+DPT+D TY F+ +L KEV  +FPD+ +HLGGDEV+F CW SNP +  F  K GF  DF KL+ +YM  + N+   L     +  ++VWQ+VFD  +E  +   ++ VWK +  +  EM  VTK+    +L++ +YL+      +W +YY   P  F G   +K LVIGGE  MWGEYVDATN+  R WPRA   AERLWSN+  T   D+A  RL EFRC LV  G  AE +  G
Sbjct:   65 CSVLDTAFKRYFSIIFPDFTKDALHDMWLEPKAFV------LSVSVKTRGCDG-----YPDEDSDESYNLSVSEGQAVLRSVTVWGALRGLESFSQLVYRDDYGAYFVNKTEIVDFPRFAFRGLLLDTSRHYLPLHAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSRTFPDLSKKGAFHPFTHIYTQSDVMRVIEHARMRGIRVVPEFDSPGHTQSWGKGQPDLLTPCYKGSKPSGTYGPVDPTVDTTYRFMERLLKEVKFVFPDSYVHLGGDEVSFACWYSNPSVGKFMEKMGFGRDFTKLESFYMESIMNITAAL-----NKTSIVWQDVFDY-HERPRSQYVVEVWK-QGCYLCEMRRVTKAGLKVILAAPFYLDLPIPTQNWARYYGVRPLAFRGTEEQKKLVIGGEVAMWGEYVDATNLNPRLWPRACAAAERLWSNEEKTLNADLAFPRLEEFRCELVRRGIQAEPLFVG 523          
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 369.392 bits (947), Expect = 4.529e-122
Identity = 194/428 (45.33%), Postives = 277/428 (64.72%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGK 1392
            PLP+ +   S    F L      + + K     P C+LL +A +R+ +Y++  +    +       S +S   V   + D     +P+    ESY + V +    + +  VWG LR L+T  Q+ Y    G   IN+T + D  RF  RG++LD+SRHFLP++ IL N+E M+++K NVFHWHIVDD SFP+ S+TFP+LS KG++H F+HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWG G K+LLTPCYSGS PSGSFGP++P L+ +Y F+ +LFKE+  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D++KL+ +Y+ +L ++V   A  KK +  MVWQEVFDN  ++    T++ VWKG D  ++E+  VT + +T +LS+ WYL+YISYG DW +YY  +P +F G+
Sbjct:   39 PLPQKYQ--SSAVAFKLSAASFQIVHAKQSTAGPSCSLLENAFRRYFEYMFGELKRQEKSRKKAFDSDLSELQVWITSADPECDGYPSLRTDESYSLSVDETSAVLKAANVWGALRGLETFSQLVYEDDYGVRNINKTDISDFPRFAHRGILLDSSRHFLPLKVILANLEAMAMNKFNVFHWHIVDDPSFPFMSRTFPELSQKGAYHPFTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSPSGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQGFGTDYSKLESFYIQRLLDIV---AATKKGY--MVWQEVFDNGVKLKDD-TVVEVWKGNDM-KEELQNVTGAGFTTILSAPWYLDYISYGQDWQRYYKVEPLDFTGQ 457          
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 298.13 bits (762), Expect = 5.245e-97
Identity = 154/272 (56.62%), Postives = 200/272 (73.53%), Query Frame = 1
Query:  793 GIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            GIRVV EFD+PGH+ SWG G K+LLTPCYSGS PSGSFGP++P L+ +Y F+ +LFKE+  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D++KL+ +Y+ +L ++V   A  KK +  MVWQEVFDN  ++    T I+VWKG  ++Q EMA+VT + ++A+LS+ WYLN +SYG DW   Y  DPQNF+G   +K LVIGGEAC+WGEYVDATN+  R WPRAS VAERLWS+ SVTD+ +   RL + RCR+V  G  AE +
Sbjct:    2 GIRVVAEFDTPGHTQSWGNGIKDLLTPCYSGSSPSGSFGPVNPILNSSYEFMAQLFKEISTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMNQQGFGTDYSKLESFYIQRLLDIV---AATKKGY--MVWQEVFDNGVKLKAD-TQIHVWKGRPQYQDEMAKVTAAGFSALLSTPWYLNRVSYGQDWVDIYKADPQNFNGTDAQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSDASVTDVGNAYTRLAQHRCRMVRRGIPAEPL 267          
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 481.1 bits (1237), Expect = 2.694e-164
Identity = 235/473 (49.68%), Postives = 319/473 (67.44%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            C LL  A +R+  Y++             +  ++    V   + D     +PT    ESY++ V ++   + + +VWG LR L+T  Q+ Y    GA  IN++ + D  RF  RG++LDTSRH+LP++TI  N++ M+ +K NVFHWHIVDD SFPYQS TFPDLSDKGS+H ++HVYT  DV  ++++AR RGIRVVPEFDSPGH+ SWGKGQ+NLLTPC++  + SG++GP++P L+ TY F+   F+E+  +FPD  +HLGGDEV+F+CWKSNP +  F   +GF  D+ KL+ YY+ ++  +V  L   KK +  MVWQEVFDN  +++   TII VWK E  +Q+EMA VT + + A+LSS WYLN ISYG DW + Y  +P NF+G   +K LVIGGEACMWGE+VDATN+  R WPRAS VAERLWSNQ+VT + D  NRL + RCR++  G  AE +  G  YC+
Sbjct:   87 CVLLQSAFRRYYDYMFGYSKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFNKGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHGFGTDYCKLESYYIQQVLGIVSSL---KKGY--MVWQEVFDNNVKLNPD-TIIEVWK-EQLYQEEMAAVTAAGFQALLSSPWYLNRISYGQDWIQVYKVEPANFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAAEPLYVG--YCD 550          
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 477.633 bits (1228), Expect = 7.457e-163
Identity = 228/473 (48.20%), Postives = 321/473 (67.86%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            C LL  A +R+  Y++             +  ++    V   + D     +PT    ESY++ V ++   + + +VWG LR L+T  Q+ Y    GA  IN++ + D  RF  RG++LDTSRH+LP++TI  N++ M+ +K NVFHWHIVDD SFPYQS TFPDLSDKGS+H ++HVYT  DV  ++++AR RGIRVVPEFDSPGH+ SWGKGQ+NLLTPC++  + SG++GP++P L+ TY F+   F+E+  +FPD  +HLGGDEV+F+CWKSNP +  F   +GF  D+ KL+ YY+ ++  +V  L   KK +  MVWQEVFDN  +++   TI+ VW G++ + +E+ +VT + + A++++ WYL+YISYG DW KYY  +P +F+G   +K LVIGGEACMWGE+VDATN+  R WPRAS VAERLWSNQ+VT + D  NRL + RCR++  G  AE +  G  YC+
Sbjct:   87 CVLLQSAFRRYYDYMFGYSKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFNKGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHGFGTDYCKLESYYIQQVLGIVSSL---KKGY--MVWQEVFDNNVKINPD-TIVEVWMGQNCY-EELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLSFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAAEPLYVG--YCD 550          
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 468.003 bits (1203), Expect = 1.320e-160
Identity = 223/436 (51.15%), Postives = 308/436 (70.64%), Query Frame = 1
Query:  328 VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDP-QNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            V   + D     +PT    ESY++ V ++   + + +VWG LR L+T  Q+ Y    GA  IN++ + D  RF  RG++LDTSRH+LP++TI  N++ M+ +K NVFHWHIVDD SFPYQS TFPDLSDKGS+H ++HVYT  DV  ++++AR RGIRVVPEFDSPGH+ SWGKGQ+NLLTPC++  + SG++GP++P L+ TY F+   F+E+  +FPD  +HLGGDEV+F+CWKSNP +  F   +GF  D+ KL+ YY+ ++  +V  L   KK +  MVWQEVFDN  +++   TI+ VW G++ + +E+ +VT + + A++++ WYL+YISYG DW KYY  +P  NF+G   +K LVIGGEACMWGE+VDATN+  R WPRAS VAERLWSNQ+VT + D  NRL + RCR++  G  AE +  G  YC+
Sbjct:   25 VVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGLETFSQLIYEDRFGAFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFNKGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHGFGTDYCKLESYYIQQVLGIVSSL---KKGY--MVWQEVFDNNVKINPD-TIVEVWMGQNCY-EELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLTNFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAAEPLYVG--YCD 451          
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 460.299 bits (1183), Expect = 1.443e-156
Identity = 223/473 (47.15%), Postives = 315/473 (66.60%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            C LL  A +R+  Y++             +  ++    V   + D     +PT    ESY++ V ++   + + +VWG LR    +       S     IN++ + D  RF  RG++LDTSRH+LP++TI  N++ M+ +K NVFHWHIVDD SFPYQS TFPDLSDKGS+H ++HVYT  DV  ++++AR RGIRVVPEFDSPGH+ SWGKGQ+NLLTPC++  + SG++GP++P L+ TY F+   F+E+  +FPD  +HLGGDEV+F+CWKSNP +  F   +GF  D+ KL+ YY+ ++  +V  L   KK +  MVWQEVFDN  +++   TI+ VW G++ + +E+ +VT + + A++++ WYL+YISYG DW KYY  +P +F+G   +K LVIGGEACMWGE+VDATN+  R WPRAS VAERLWSNQ+VT + D  NRL + RCR++  G  AE +  G  YC+
Sbjct:   62 CVLLQSAFRRYYDYMFGYSKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGYFFIPPKFILCSVKQFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFNKGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHGFGTDYCKLESYYIQQVLGIVSSL---KKGY--MVWQEVFDNNVKINPD-TIVEVWMGQNCY-EELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLSFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAAEPLYVG--YCD 525          
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Match: hexb (hexosaminidase B (beta polypeptide) [Source:NCBI gene;Acc:100145770])

HSP 1 Score: 460.685 bits (1184), Expect = 2.601e-156
Identity = 223/473 (47.15%), Postives = 315/473 (66.60%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            C LL  A +R+  Y++             +  ++    V   + D     +PT    ESY++ V ++   + + +VWG LR    +       S     IN++ + D  RF  RG++LDTSRH+LP++TI  N++ M+ +K NVFHWHIVDD SFPYQS TFPDLSDKGS+H ++HVYT  DV  ++++AR RGIRVVPEFDSPGH+ SWGKGQ+NLLTPC++  + SG++GP++P L+ TY F+   F+E+  +FPD  +HLGGDEV+F+CWKSNP +  F   +GF  D+ KL+ YY+ ++  +V  L   KK +  MVWQEVFDN  +++   TI+ VW G++ + +E+ +VT + + A++++ WYL+YISYG DW KYY  +P +F+G   +K LVIGGEACMWGE+VDATN+  R WPRAS VAERLWSNQ+VT + D  NRL + RCR++  G  AE +  G  YC+
Sbjct:   87 CVLLQSAFRRYYDYMFGYSKWKRASAKPSNAGQLLQLQVVILSKDHQCHRYPTVQSDESYELSVGENVAVLKANQVWGALRGYFFIPPKFILCSVKQFLINKSYIEDFPRFAHRGILLDTSRHYLPLKTIFLNLDAMAFNKFNVFHWHIVDDPSFPYQSVTFPDLSDKGSYHPYTHVYTPVDVRLVIEYARMRGIRVVPEFDSPGHTDSWGKGQQNLLTPCFNKGQLSGAYGPVNPILNDTYNFMYTFFQEISNVFPDQYIHLGGDEVDFSCWKSNPDVTKFMTDHGFGTDYCKLESYYIQQVLGIVSSL---KKGY--MVWQEVFDNNVKINPD-TIVEVWMGQNCY-EELYKVTAAGFPAIMAAPWYLDYISYGQDWQKYYKVEPLSFNGTAEQKQLVIGGEACMWGEFVDATNLTPRLWPRASAVAERLWSNQNVTSVGDAYNRLVKHRCRMLRRGIAAEPLYVG--YCD 550          
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Match: Hexb (hexosaminidase B [Source:MGI Symbol;Acc:MGI:96074])

HSP 1 Score: 478.789 bits (1231), Expect = 1.076e-163
Identity = 231/480 (48.12%), Postives = 318/480 (66.25%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGEI 1638
            P C+LL +A +R+  Y++   Y  + GP           ++ + T +   + +P+ +  E+Y + V +    + +  VWG LR L+T  Q+ Y+ S G   INE+ + D  RF  RG+++DTSRHFLPV+TIL  ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  +L++AR RGIRV+PEFD+PGH+ SWGKGQKNLLTPCY+    +  FGP+DPT++ TY F N  FKE+  +FPD  +HLGGDEV F CW SNP I  F  + GF +DF +L+ +Y+ K+  ++  L   KK+  ++VWQEVFD+K E+ Q  T++ VWK E  +  E+ +VT S + A+LS+ WYL+ ISYG DW  YY  +P NF+G   +K LVIGGEAC+WGE+VDATN+  R WPRAS V ERLWS ++VTDL +   RL   RCR+V  G  A+ +  G  YCN   +I
Sbjct:   68 PSCSLLQEAFRRYYNYVFG-FYKRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSY-SLSHVYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVNTTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESFYIKKILEIISSL---KKN--SIVWQEVFDDKVEL-QPGTVVEVWKSE-HYSYELKQVTGSGFPAILSAPWYLDLISYGQDWKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAAQPLYTG--YCNYENKI 536          
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Match: Hexa (hexosaminidase A [Source:MGI Symbol;Acc:MGI:96073])

HSP 1 Score: 441.81 bits (1135), Expect = 1.747e-149
Identity = 219/480 (45.62%), Postives = 314/480 (65.42%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNS------IYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGED--KWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYC 1620
            C +L++A +R+   L+ S       + N +  + ++I  +S+ +   C +      +P    +E+Y + +  D   + S+ VWG LR L+T  Q+ ++ + G   IN+T + D  RF  RG++LDTSRH+LP+ +ILD +++M+ +K NVFHWH+VDD SFPY+S TFP+L+ KGSF+  +H+YT +DV  ++++AR RGIRV+ EFD+PGH+LSWG G   LLTPCYSGS  SG+FGP++P+L+ TY F++ LF E+  +FPD  LHLGGDEV+F CWKSNP I  F  K GF  DF +L+ +Y+  L ++V        D   +VWQEVFDNK +V    TII VW+ E   ++  EM ++T++ + A+LS+ WYLN + YG DW   Y  +P  F G   +K LVIGGEACMWGEYVD+TN++ R WPRA  VAERLWS+   T+++    RL  FRC LV  G  A+ ++ G  YC
Sbjct:   58 CVVLDEAFRRYRNLLFGSGSWPRPSFSNKQQTLGKNILVVSV-VTAECNE------FPNLESVENYTLTINDDQCLLASETVWGALRGLETFSQLVWKSAEGTFFINKTKIKDFPRFPHRGVLLDTSRHYLPLSSILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTRKGSFNPVTHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGAPGLLTPCYSGSHLSGTFGPVNPSLNSTYDFMSTLFLEISSVFPDFYLHLGGDEVDFTCWKSNPNIQAFMKKKGF-TDFKQLESFYIQTLLDIVSDY-----DKGYVVWQEVFDNKVKVRPD-TIIQVWREEMPVEYMLEMQDITRAGFRALLSAPWYLNRVKYGPDWKDMYKVEPLAFHGTPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSSNLTTNIDFAFKRLSHFRCELVRRGIQAQPISVG--YC 521          
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|P20060|HEXB_MOUSE (Beta-hexosaminidase subunit beta OS=Mus musculus OX=10090 GN=Hexb PE=1 SV=2)

HSP 1 Score: 478.789 bits (1231), Expect = 7.527e-163
Identity = 231/480 (48.12%), Postives = 318/480 (66.25%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGEI 1638
            P C+LL +A +R+  Y++   Y  + GP           ++ + T +   + +P+ +  E+Y + V +    + +  VWG LR L+T  Q+ Y+ S G   INE+ + D  RF  RG+++DTSRHFLPV+TIL  ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  +L++AR RGIRV+PEFD+PGH+ SWGKGQKNLLTPCY+    +  FGP+DPT++ TY F N  FKE+  +FPD  +HLGGDEV F CW SNP I  F  + GF +DF +L+ +Y+ K+  ++  L   KK+  ++VWQEVFD+K E+ Q  T++ VWK E  +  E+ +VT S + A+LS+ WYL+ ISYG DW  YY  +P NF+G   +K LVIGGEAC+WGE+VDATN+  R WPRAS V ERLWS ++VTDL +   RL   RCR+V  G  A+ +  G  YCN   +I
Sbjct:   68 PSCSLLQEAFRRYYNYVFG-FYKRHHGPARFRAEPQLQKLLVSITLESECESFPSLSSDETYSLLVQEPVAVLKANSVWGALRGLETFSQLVYQDSFGTFTINESSIADSPRFPHRGILIDTSRHFLPVKTILKTLDAMAFNKFNVLHWHIVDDQSFPYQSTTFPELSNKGSY-SLSHVYTPNDVRMVLEYARLRGIRVIPEFDTPGHTQSWGKGQKNLLTPCYNQKTKTQVFGPVDPTVNTTYAFFNTFFKEISSVFPDQFIHLGGDEVEFQCWASNPNIQGFMKRKGFGSDFRRLESFYIKKILEIISSL---KKN--SIVWQEVFDDKVEL-QPGTVVEVWKSE-HYSYELKQVTGSGFPAILSAPWYLDLISYGQDWKNYYKVEPLNFEGSEKQKQLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPKTVTDLENAYKRLAVHRCRMVSRGIAAQPLYTG--YCNYENKI 536          
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|P07686|HEXB_HUMAN (Beta-hexosaminidase subunit beta OS=Homo sapiens OX=9606 GN=HEXB PE=1 SV=3)

HSP 1 Score: 471.085 bits (1211), Expect = 1.215e-159
Identity = 232/506 (45.85%), Postives = 329/506 (65.02%), Query Frame = 1
Query:  133 PKPFYIYSGGNVFNLV-ENIKIQN-----PYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            P P  +    N+ +L  EN  I +       P C LL +A +R+  Y++     ++E    Q+ +++   ++ + T       +P  +  ESY + V +    + +  VWG LR L+T  Q+ Y+ S G   INE+ + D  RF  RG+++DTSRH+LPV+ IL  ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  ++++AR RGIRV+PEFD+PGH+LSWGKGQK+LLTPCYS      SFGPI+PTL+ TY+FL   FKE+ E+FPD  +HLGGDEV F CW+SNP+I +F  + GF  DF KL+ +Y+ K+ +++  +     +  ++VWQEVFD+K ++    TI+ VWK +  + +E++ VT S +  +LS+ WYL+ ISYG DW KYY  +P +F G   +K L IGGEAC+WGEYVDATN+  R WPRAS V ERLWS++ V D++D  +RL   RCR+V  G  A+ +  G  YCN
Sbjct:   58 PLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYIFGFYKWHHEPAEFQAKTQVQ-QLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVWGALRGLETFSQLVYQDSYGTFTINESTIIDSPRFSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSY-SLSHVYTPNDVRMVIEYARLRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFPDQFIHLGGDEVEFKCWESNPKIQDFMRQKGFGTDFKKLESFYIQKVLDIIATI-----NKGSIVWQEVFDDKAKLAPG-TIVEVWK-DSAYPEELSRVTASGFPVILSAPWYLDLISYGQDWRKYYKVEPLDFGGTQKQKQLFIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVRDMDDAYDRLTRHRCRMVERGIAAQPLYAG--YCN 552          
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|P49614|HEXB_FELCA (Beta-hexosaminidase subunit beta OS=Felis catus OX=9685 GN=HEXB PE=2 SV=2)

HSP 1 Score: 468.774 bits (1205), Expect = 5.216e-159
Identity = 231/475 (48.63%), Postives = 318/475 (66.95%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            P C+LL +A +R+ +Y++             S  ++   +VT   D E   L+P     ESY + V +   F+ +  VWG+LR L+T  Q+ Y+ S G   +NE+ + D  RF  RG+++DT+RHFLPV++IL  ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  DV  ++++AR RGIRV+PEFDSPGH+ SWGKGQK+LLTPCY+  K SG+FGPI+P L+ TY FL++ FKEV  +FPD  +HLGGDEV F CW+SNP I  F  + GF  DF +L+ +Y+ KL  +V    VKK    ++VWQEVFD+  ++    TI+ VWK +  + +E+ EVT + +  +LS+ WYL++ISYG DW  YY  DP +FDG   +K LVIGGEAC+WGE+VDATN+  R WPRAS V ERLWS + +T + +  NRL   RCR+V  G +AE +  G  YC+
Sbjct:   63 PTCSLLQEAFRRYHEYIFGFDKRQRRPAKPNSAIELQQLLVTVVLDSE-CDLFPNITSDESYTLLVKEPVAFLKANRVWGVLRGLETFSQLIYQDSYGTFTVNESDIIDSPRFPHRGILIDTARHFLPVKSILKTLDAMAFNKFNVLHWHIVDDQSFPYQSVTFPELSNKGSY-SLSHVYTPNDVHTVIEYARLRGIRVIPEFDSPGHTQSWGKGQKDLLTPCYNEHKQSGTFGPINPILNSTYNFLSQFFKEVSMVFPDHFVHLGGDEVEFQCWESNPEIQGFMKQKGFGKDFRRLESFYLQKLLGIVS--TVKK---GSIVWQEVFDDHVKLLPG-TIVQVWKNQ-VYTEELREVTAAGFPVILSAPWYLDWISYGQDWRNYYKVDPLHFDGSQEQKKLVIGGEACLWGEFVDATNLTPRLWPRASAVGERLWSPEDITSVGNAYNRLTVHRCRMVRRGISAEPLFTG--YCD 526          
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|Q6AXR4|HEXB_RAT (Beta-hexosaminidase subunit beta OS=Rattus norvegicus OX=10116 GN=Hexb PE=2 SV=1)

HSP 1 Score: 467.233 bits (1201), Expect = 2.337e-158
Identity = 230/489 (47.03%), Postives = 319/489 (65.24%), Query Frame = 1
Query:  181 ENIKIQNPY-----PQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            EN +I N       P C+LL +A +R+  Y++   Y  + GP           ++     +     +P+ +  ESY + V +    + + EVWG LR L+T  Q+ Y+ + G   INE+ + D  RF  RG+++DTSRH+LPV+TI   ++ M+ +K NV HWHIVDD+SFPYQS TFP+LS+KGS+   SHVYT  D+  +L++AR RGIRV+PEFDSPGH+ SWGKGQKNLLTPC+     +   GP+DP+L+ TY F +  FKE+  +FPD  +HLGGDEV F CW SNP I NF  K GF N+F +L+ +Y+ K+ +++  L   KK   ++VWQ+VFD++ E+ Q  T++ VWK E+ +  E+A+VT S + A+LS+ WYL+ ISYG DW  YY  +P NF+G   +K LVIGGEAC+WGEYVDATN+I R WPRAS V ERLWS + +T+L +   RL   RCR+V  G  A+ +  G  YCN
Sbjct:   53 ENFQIDNSPNSTAGPSCSLLLEAFRRYYNYIFG-FYKRHHGPAKFQDKPQLEKLLVFINLEPQCDAFPSMSSDESYSLLVQEPVALLKANEVWGALRGLETFSQLVYQDAYGTFTINESTIADSPRFPHRGILIDTSRHYLPVKTIFKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYS-LSHVYTPNDIHMVLEYARLRGIRVIPEFDSPGHTQSWGKGQKNLLTPCFIQKIRTQKVGPVDPSLNTTYVFFDTFFKEISRVFPDQFIHLGGDEVEFECWASNPNIQNFMKKKGFGNNFRRLESFYIKKILDIITSL---KKS--SIVWQDVFDDQVEL-QPGTVVEVWKSEN-YLNELAQVTASGFPAILSAPWYLDLISYGQDWRNYYKAEPLNFEGSEKQKQLVIGGEACLWGEYVDATNLIPRLWPRASAVGERLWSPRIITNLENAYRRLAVHRCRMVSRGIAAQPLFTG--YCN 530          
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Match: sp|Q0V8R6|HEXA_BOVIN (Beta-hexosaminidase subunit alpha OS=Bos taurus OX=9913 GN=HEXA PE=2 SV=1)

HSP 1 Score: 464.922 bits (1195), Expect = 1.148e-157
Identity = 224/479 (46.76%), Postives = 323/479 (67.43%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGE--DKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGE 1635
            C++L++A +R+   L+ S+   +  PI +  +    S+V           +P+   +E+Y + +  +   ++S+ VWG LR L+T  Q+ +R   G   +N+T + D  RF  RGL+LDTSRH+LP+ +ILD +++M+ +K NVFHWH+VDD SFPY+S TFP+L+ KGS++  +H+YT +DV  ++++AR RGIRV+ EFD+PGH+LSWG G   LLTPCYSGS PSG+FGP++P L+ TY F++  F E+  +FPD  LHLGGDEV+F CWKSNP I  F  K GF +DF KL+ +Y+  L ++V       K +  +VWQEVFDNK +V    TII VW+ E   K+ +E+A VT++ + A+LS+ WYLN+I+YG DW + Y  +P  F+G   +K LVIGGEACMWGEYVD+TN++ R WPRA  VAERLWSN+ V++L+    RL  FRC L+  G  A+ ++ G  YC++  E
Sbjct:   58 CSVLDEAFQRYRDLLFGSVAFRFPHPIEKRHTSEKNSLVVLVVT-PGCDQFPSLGSVENYTLTINDEQSLLLSETVWGALRGLETFSQLIWRSPEGTFYVNKTDIEDFPRFPHRGLLLDTSRHYLPLASILDTLDVMAYNKFNVFHWHLVDDSSFPYESFTFPELTKKGSYNPATHIYTAQDVKEVIEYARLRGIRVLAEFDTPGHTLSWGPGVPGLLTPCYSGSHPSGTFGPVNPALNNTYEFMSTFFLEISTVFPDFYLHLGGDEVDFTCWKSNPDIQAFMKKKGFGDDFKKLESFYIQTLLDIVSAYG---KGY--VVWQEVFDNKVKVRPD-TIIQVWREEIPVKYVKELALVTRAGFRALLSAPWYLNHITYGPDWKEIYLVEPLAFEGSPEQKALVIGGEACMWGEYVDSTNLVPRLWPRAGAVAERLWSNKMVSNLDFAFKRLAHFRCELLRRGVQAQPLSVG--YCDMEFE 527          
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: H3AAJ1 (Beta-hexosaminidase OS=Latimeria chalumnae OX=7897 GN=HEXB PE=3 SV=1)

HSP 1 Score: 501.901 bits (1291), Expect = 2.993e-169
Identity = 242/510 (47.45%), Postives = 348/510 (68.24%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNV------FNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINY--EGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            PLP+    +SG  V      F +V +    +  P C +L DA +R+ +Y++     N+  EG +N       + ++   +D E  K +P+    E+YQ+ V++ G  + +++VWG LR L+T  Q+ Y    G   IN + + D  RF  RG++LDTSRH++PV+ IL N++ M+ +K NVFHWHIVDD SFPYQS T+PDLS+KG++H  +HVYT  DV R++ FAR RGIRV+PEFD+PGH+ SWG GQK+LLTPCY+G+KPSG++GP++P L+ TY F+ KLFKE+  +FPD  +HLGGDEVNF+CW+SNP +  F  ++G   D+ KL+ +Y+ +L ++V  L    K +  M+WQEVFDNK ++  + T++ VW     +++E+ +VT + +TA+LS+ WYL+YISYG DW KYY  +P  F+G   +K LVIGGEAC+WGEYVDATN+  R WPRAS VAERLWS+++VT++ D  +RLH+ RCR+V  G  AE +  G  YC+
Sbjct:   49 PLPQSV-KFSGAEVQLSRSRFQIVHSAG-SSAGPSCFILQDAFRRYYEYIFGFSKWNHQAEGFLNNGAELTELQVLITSSDPECDK-YPSIKSNEAYQLSVSQSGAVLKAEKVWGALRGLETFSQLVYENGYGTYLINASEIKDFPRFSHRGVLLDTSRHYVPVKVILANLDAMAFNKFNVFHWHIVDDPSFPYQSTTYPDLSNKGAYHPATHVYTATDVHRVIQFARSRGIRVIPEFDTPGHTQSWGNGQKDLLTPCYNGAKPSGTYGPVNPILNSTYEFMGKLFKEISNVFPDEYVHLGGDEVNFHCWQSNPYVTKFMTEHGLGKDYRKLESFYIQRLLDIVSSL---NKGY--MIWQEVFDNKVKIKPE-TVVGVWIA-STYREELKKVTSAGFTAILSAPWYLDYISYGQDWQKYYRVEPLAFNGTDAQKRLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSSETVTNIGDAYSRLHKHRCRMVRRGIPAEPLFIG--YCD 546          
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: H2VDU0 (Beta-hexosaminidase OS=Takifugu rubripes OX=31033 GN=hexb PE=3 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 4.241e-169
Identity = 254/506 (50.20%), Postives = 340/506 (67.19%), Query Frame = 1
Query:  127 PLPKPFYIYS-----GGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYE------GPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG-EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNF---DGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I        G  FN+V+  K  +  P C LL DA +R+ +Y++ +   + +      GP + +  ++ I+     + D +   +P+    ESY++ V +    + + +VWG L  L+T  Q+ Y    GA  IN T + D  RF  RG++LDTSRHFLPV+ IL N+E M+++K+NVFHWHIVD+ SFPY SKTFP LS +G+FH ++HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWGKGQK+LLTPCYSGSK SGSFGP++P L+ TYTF+ + FKEV  +FPD  +HLGGDEV+FNCWKSNP I  F  + GF  D++KL+ +Y+ +L ++V   A   K +  MVWQEVFDN  ++    TII+VWKG ++++Q EMA VT S Y  +LS+ WYLN ISYG DW  +Y  DPQ+F   D +K LVIGGEAC+WGEYVD+TNV  R WPRAS VAERLWS++ V D+ND  NRL   RCR+V  G  AE +
Sbjct:   48 PLPQKVQISQVSFKLTGFSFNIVD-AKQSSAGPSCALLQDAYRRYYEYMFGNAKRSGKNKSRRTGPTDLTELQVWIT-----SADSDCDAYPSVKSDESYELTVDQPFAVLKAPKVWGALHGLETFSQLIYEDDYGAKSINATSISDFPRFPHRGILLDTSRHFLPVKVILANLETMAMNKINVFHWHIVDEPSFPYMSKTFPQLSQQGAFHPYTHVYTPADVKMVIEFARLRGIRVVAEFDTPGHTQSWGKGQKDLLTPCYSGSKLSGSFGPVNPILNTTYTFMTQFFKEVSTVFPDGYVHLGGDEVDFNCWKSNPNITKFMDQQGFGRDYSKLESFYIQRLLDIV---ATTNKGY--MVWQEVFDNGVKLKPD-TIIHVWKGNQEQYQNEMANVTASGYQTLLSTPWYLNRISYGQDWQGHYKADPQDFKGTDAQKKLVIGGEACLWGEYVDSTNVTPRLWPRASAVAERLWSSKDVRDVNDAYNRLSGHRCRMVERGIPAEPL 541          
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A3Q3G324 (Beta-hexosaminidase OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 501.516 bits (1290), Expect = 4.786e-169
Identity = 238/472 (50.42%), Postives = 329/472 (69.70%), Query Frame = 1
Query:  208 PQCNLLNDAIKRFTKYLYNSIYINYEGPINQ----SISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGED-KWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            P C+LL DA +R+ +Y++ S   +    +N+      S+++   V   + D +   +P+    ESY++ V +    + + +VWG LR L+T  Q+ +    GA  +N T + D  RF  RG++LDTSRH+LP++ IL N+E M+++K+NVFHWHIVDD+SFPY S+TFP LS +G++H ++HVYT  DV  +++FAR RGIRV+PEFD+PGH+ SWGKGQK+LLTPCYSG+ PSG+FGP++P L+ TY F+++ FKE+  +FPD  +HLGGDEV+FNCWKSNP I  F  + GF  DF+KL+ +Y+ +L N+V      KK +  M+WQEVFDN  ++    TII+VWKG   ++Q EMA VT + Y  +LS+ WYLN ISYG DW  +Y  DPQ+F+G   +K LV+GGEAC+WGEYVDATN+  R WPRAS VAERLWS + VTD+ND  NRL   RCR+V  G  AE +
Sbjct:   79 PSCSLLKDAYRRYYEYMFGS---SKRQQLNKRRRTGPSELTELQVLITSPDSDCDGYPSVTSDESYELSVDQPYAVLRAPKVWGALRGLETFSQLVFEDDYGAKSVNATQISDFPRFAHRGILLDTSRHYLPIKVILANLETMAMNKINVFHWHIVDDQSFPYLSRTFPQLSQQGAYHPYTHVYTPADVKMVIEFARLRGIRVIPEFDTPGHTQSWGKGQKDLLTPCYSGATPSGTFGPVNPILNTTYDFMSQFFKEISTVFPDAYVHLGGDEVDFNCWKSNPDIQKFMAQQGFGQDFSKLESFYIQRLLNIVTS---TKKGY--MIWQEVFDNGVKLKPD-TIIHVWKGTQLQYQNEMANVTSAGYQTLLSTPWYLNRISYGQDWRGHYKADPQDFNGTDEQKKLVVGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAKDVTDINDAFNRLSVHRCRMVERGIPAEPL 541          
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: G3PTM9 (Beta-hexosaminidase OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 499.975 bits (1286), Expect = 1.512e-168
Identity = 238/474 (50.21%), Postives = 325/474 (68.57%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISM-VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG-EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYC 1620
            C+LL +A +R+ +Y++    + +     ++   +   + V   + D   + +P     ESY++ V +    + + +VWG LR L+T  Q+ Y    GA  IN T + D  RF  RG++LDTSRHFLP++ IL N+E M+++K NVFHWHIVDD+SFPY S+TFP +S +G++H ++HVYT  DV  +++F R RGIRVVPEFD+PGH+ SWGKGQK+LLTPCYSG KPSGSFGP++P L+ TY F++K FKE+  +FPD  +HLGGDEV+FNCWKSNP I  F  + GF  DF+KL+ +Y+ KL ++V   A  +K +  M+WQEVFDN  ++   + II+VWKG ++++Q EMA VT S +  +LS+ WYLN ISYG DW  +Y  DPQ+F G   +K LVIGGEAC+WGEYVDATN+  R WPRAS V ERLWS   VTD+ND  +RL   RCR+V  G  AE +    +YC
Sbjct:   81 CSLLQNAYRRYYEYIFGGSRVQHGAEGRRAGPSVLTELQVLIVSADSECERFPAVTSDESYELTVDQPYAVLKAPKVWGALRGLETFSQLVYEDEYGAKSINSTTISDFPRFAHRGILLDTSRHFLPIKVILANLEAMAMNKFNVFHWHIVDDQSFPYMSRTFPHISQQGAYHPYTHVYTPADVKMVIEFGRLRGIRVVPEFDTPGHTQSWGKGQKDLLTPCYSGDKPSGSFGPVNPILNTTYDFMSKFFKEISGVFPDAYVHLGGDEVDFNCWKSNPDIQKFMEQQGFGQDFSKLESFYIQKLLDIV---ATTQKGY--MIWQEVFDNGVKLKADM-IIHVWKGNQEQYQSEMANVTSSGFQTLLSTPWYLNRISYGQDWQGHYKADPQDFKGTEAQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSAVDVTDINDAFSRLSVHRCRMVERGIPAEPLF--SSYC 546          
BLAST of Beta-hexosaminidase vs. TrEMBL
Match: A0A3B5AMC6 (Beta-hexosaminidase OS=Stegastes partitus OX=144197 PE=3 SV=1)

HSP 1 Score: 500.36 bits (1287), Expect = 4.039e-168
Identity = 246/511 (48.14%), Postives = 339/511 (66.34%), Query Frame = 1
Query:  133 PKPFYIYSGGNVFNL----VENIKIQNPYPQCNLLNDAIKRFTKYLYNS------IYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG-EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCN 1623
            P P  + S  + F L    + + K  +  P CN+L +A +R+ +Y++ +        +   GP + +  ++ I+     + D     +P+    ESY++ V +    + + +VWG L  L+T  Q+ Y    GA  +N T++ D  RF+ RG++LDTSRHFLP++ IL N+E M+++K NVFHWHIVDD+SFPY S+TFP LS +GS+H ++HVYT  DV  +++FAR RGIRVVPEFD+PGH+ SWGKGQ +LLTPCYSG KPSG+FGP++P L+ TY F+ + FKE+  +FPD  +HLGGDEV+F CWKSNP I  F    GF  D++KL+ +Y+ KL ++V      KK +  M+WQEVFDN  ++    TII+VWKG + ++Q EMA VT S Y  +LS+ WYLN ISYG DW+ +Y  DPQ+F G   +K LVIGGEAC+WGEYVDATN+  R WPRAS V ERLWS++ VTD+ND  NRL   RCR+V  G  AE +    +YC 
Sbjct:   84 PLPQKLKSTQDAFKLTSFRIVDAKDSSAGPSCNILQNAYRRYYEYMFGAGQKQGVFKLRRSGPSDLTGLQVWIT-----SADSECDGYPSVKSDESYELSVIQPFAVLKAPKVWGALHGLETFSQLVYEDEYGAKSVNATIITDFPRFKHRGILLDTSRHFLPIKVILANLETMAMNKFNVFHWHIVDDQSFPYLSRTFPQLSQQGSYHPYTHVYTPADVKMVIEFARLRGIRVVPEFDTPGHTQSWGKGQPDLLTPCYSGPKPSGAFGPVNPILNTTYDFMTQFFKEISTVFPDGYVHLGGDEVDFTCWKSNPDIQRFMDAQGFGQDYSKLESFYIQKLLDIV---TTTKKGY--MIWQEVFDNGVKLKPD-TIIHVWKGNQQQYQSEMANVTSSGYQTLLSTPWYLNRISYGQDWNVFYKADPQDFKGTEKQKALVIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKDVTDINDAFNRLSAHRCRMVERGIPAEPLF--SSYCQ 581          
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 482.256 bits (1240), Expect = 1.975e-164
Identity = 241/503 (47.91%), Postives = 326/503 (64.81%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSI--SKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSD-KGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I   G  F L      + +       P C+LL +A +R+  Y++ +     +G   Q +  S++    V     D     +P     ESYQ+EV +    + +  VWG LR L+T  Q+ Y    GA  IN+T + D  RF  RG++LDTSRH+LP++ IL N+E M+++K NVFHWHIVDD SFP+ S+TFPDLS  KG+FH ++HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWGKGQ +LLTPC+SGS P+G+FGP++P L+ TY F+ + FKEV  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D+ KL+ YY+ +L ++V   +   K +  MVWQEVFDN  ++    T ++VWK   ++Q EMA +T + +  +LSS WYLN ISYG DW   Y  DPQNF+G   +K LVIGGEAC+WGEYVD TN+  R WPRAS V ERLWS+++V D+N   NRL + RCR+V  G  AE +
Sbjct:   86 PLPQKIQI--SGAAFQLSSAGFQITHANGSTAGPSCSLLQNAFRRYFDYIFGNA--RKQGKNQQKVFDSELQELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSPTGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQGFGQDYKKLESYYIQRLLDIV---SATNKGY--MVWQEVFDNGVKLKAD-TQLHVWKENPQYQDEMARITAAGFYTLLSSPWYLNRISYGQDWQAVYKADPQNFNGTAEQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPAEPL 578          
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 473.396 bits (1217), Expect = 3.405e-161
Identity = 238/503 (47.32%), Postives = 325/503 (64.61%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSI--SKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSD-KGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I   G  F L      + +       P C+LL +A +R+  Y++ +     +G   Q +  S++    V     D     +P     ESYQ+EV +    + +  VWG LR L+T  Q+ Y    GA  IN+T + D  RF  RG++LDTSRH+LP++ IL N+E M+++K NVFHWHIVDD SFP+ S+TFPDLS  KG+FH ++HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWGKGQ +LLTPC+SGS P+G+FGP++P L+ TY F+ + FKEV  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D+ KL+ YY+ +L ++V   +   K +  MVWQEVFDN  ++    T++ VW   +    E+ +VT S +T +LS+ WYL+YISYG DW KYY  +P +F G   +K LVIGGEAC+WGEYVD TN+  R WPRAS V ERLWS+++V D+N   NRL + RCR+V  G  AE +
Sbjct:   68 PLPQKIQI--SGAAFQLSSAGFQITHANGSTAGPSCSLLQNAFRRYFDYIFGNA--RKQGKNQQKVFDSELQELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSPTGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQGFGQDYKKLESYYIQRLLDIV---SATNKGY--MVWQEVFDNGVKLKGD-TVVEVWMNNNV-DGELQKVTGSGFTTILSAPWYLDYISYGQDWQKYYKVEPLSFQGTAEQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPAEPL 559          
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 473.011 bits (1216), Expect = 8.253e-161
Identity = 238/503 (47.32%), Postives = 325/503 (64.61%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSI--SKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSD-KGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I   G  F L      + +       P C+LL +A +R+  Y++ +     +G   Q +  S++    V     D     +P     ESYQ+EV +    + +  VWG LR L+T  Q+ Y    GA  IN+T + D  RF  RG++LDTSRH+LP++ IL N+E M+++K NVFHWHIVDD SFP+ S+TFPDLS  KG+FH ++HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWGKGQ +LLTPC+SGS P+G+FGP++P L+ TY F+ + FKEV  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D+ KL+ YY+ +L ++V   +   K +  MVWQEVFDN  ++    T++ VW   +    E+ +VT S +T +LS+ WYL+YISYG DW KYY  +P +F G   +K LVIGGEAC+WGEYVD TN+  R WPRAS V ERLWS+++V D+N   NRL + RCR+V  G  AE +
Sbjct:   86 PLPQKIQI--SGAAFQLSSAGFQITHANGSTAGPSCSLLQNAFRRYFDYIFGNA--RKQGKNQQKVFDSELQELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGAHKINKTSISDFPRFAHRGILLDTSRHYLPLKAILTNLEAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRKGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSPTGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQGFGQDYKKLESYYIQRLLDIV---SATNKGY--MVWQEVFDNGVKLKGD-TVVEVWMNNNV-DGELQKVTGSGFTTILSAPWYLDYISYGQDWQKYYKVEPLSFQGTAEQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPAEPL 577          
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexa (beta-hexosaminidase subunit alpha-like [Source:NCBI gene;Acc:103046771])

HSP 1 Score: 460.685 bits (1184), Expect = 7.794e-157
Identity = 226/477 (47.38%), Postives = 309/477 (64.78%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGP---INQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG-EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMA-NRLHEFRCRLVINGFNAETMNGGGTYC 1620
            C++L+ A KR+   ++             ++ +   +S+S+ +   D      +P E   ESY + V      + ++ VWG LR L++  Q+ Y+       +N+T + D  RF+FRGL+LDTSRH+LP+  IL  ++ M+ SK NVFHWHIVDD SFPYQS ++PDLS KG+FH  +H+YTQ DV R++  AR RGIRV+PEFD+PGH+ SWGKGQ NLLTPCY G  PSG+FGP++P LD TY F++ LFKE+  +FPD+ +HLGGDEVNF CWKSNP +  F  K GF +D+ KL+ YY+  + N+   L     +   +VWQ+VFD +  +  K T++ +WKG    ++ E+A++T + Y  +LS+ WY+N+ISYG DW   YT  PQNF G   +K LVIGGE CMWGEYVDATN+  R WPRA   AERLWSN+ +T   D A  RL +FRC L+  G  AE +  G  YC
Sbjct:   63 CSVLDSAFKRYYSLIFPDAADGARFSNIWMDPTPFTVSVSVKSGECDG-----YPDEGSDESYNLSVAAGAAALKAQSVWGALRGLESFSQLVYQDKYNMYFVNKTEIQDFPRFEFRGLLLDTSRHYLPLNAILKTLDAMAYSKFNVFHWHIVDDPSFPYQSYSYPDLSSKGAFHPMTHIYTQSDVKRVISHARMRGIRVIPEFDTPGHTQSWGKGQPNLLTPCYKGDVPSGTFGPVNPILDSTYQFMSGLFKEMKSVFPDSYVHLGGDEVNFACWKSNPNVRAFMTKMGFGHDYTKLESYYIENIVNISSAL-----NKTPIVWQDVFDYRERI-PKDTVLEIWKGVPADYRTELAKITHAGYRVLLSAPWYINHISYGQDWRNSYTVQPQNFSGTDQQKALVIGGEVCMWGEYVDATNLHPRLWPRACAAAERLWSNEEMTSNVDQAFPRLEKFRCSLIRRGIQAEPLFVG--YC 526          
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Match: hexb (hexosaminidase B (beta polypeptide) [Source:ZFIN;Acc:ZDB-GENE-030131-2333])

HSP 1 Score: 428.328 bits (1100), Expect = 7.649e-144
Identity = 221/502 (44.02%), Postives = 299/502 (59.56%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNL------VENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSI--SKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I   G  F L      + +       P C+LL +A +R+  Y++ +     +G   Q +  S++    V     D     +P     ESYQ+EV +    + +  VWG LR L+T  Q+ Y    GA                                     E M+++K NVFHWHIVDD SFP+ S+TFPDLS +G+FH ++HVYT  DV  +++FAR RGIRVV EFD+PGH+ SWGKGQ +LLTPC+SGS P+G+FGP++P L+ TY F+ + FKEV  +FPD  +HLGGDEV+F+CWKSNP I  F  + GF  D+ KL+ YY+ +L ++V   +   K +  MVWQEVFDN  ++    T ++VWK   ++Q EMA +T + +  +LSS WYLN ISYG DW   Y  DPQNF+G   +K LVIGGEAC+WGEYVD TN+  R WPRAS V ERLWS+++V D+N   NRL + RCR+V  G  AE +
Sbjct:   86 PLPQKIQI--SGAAFQLSSAGFQITHANGSTAGPSCSLLQNAFRRYFDYIFGNA--RKQGKNQQKVFDSELQELQVLLTAKDPECDGYPNLKTDESYQLEVDQPTSVLKAANVWGALRGLETFSQLVYEDDYGA-------------------------------------EAMAMNKFNVFHWHIVDDHSFPFLSRTFPDLSQRGAFHPYTHVYTPSDVKMVIEFARMRGIRVVAEFDTPGHTQSWGKGQPDLLTPCFSGSSPTGTFGPVNPILNSTYDFMTRFFKEVSTVFPDAYIHLGGDEVDFSCWKSNPDIQKFMDQQGFGQDYKKLESYYIQRLLDIV---SATNKGY--MVWQEVFDNGVKLKAD-TQLHVWKENPQYQDEMARITAAGFYTLLSSPWYLNRISYGQDWQAVYKADPQNFNGTAEQKKLVIGGEACLWGEYVDGTNLTPRLWPRASAVGERLWSDENVKDINSAYNRLAKHRCRMVQRGIPAEPL 540          
BLAST of Beta-hexosaminidase vs. Ensembl Sea Lamprey
Match: hexa (hexosaminidase A (alpha polypeptide) [Source:ZFIN;Acc:ZDB-GENE-050417-283])

HSP 1 Score: 445.277 bits (1144), Expect = 6.291e-152
Identity = 221/487 (45.38%), Postives = 329/487 (67.56%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYN-SIYINYEGPINQ-------SISKISISMVTNCTDDENTKLWPTENMIE--SYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGA--LCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWK-GEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNI 1626
            C +L+DA +R+   +++ S Y      +++       ++ ++S+  V   +   +   +P    +   + ++ V      + +  VWG LR L+T  Q+AYR  +    + +N+T + D  RF+ RGL+LDTSRH+LP+  IL+ ++ M+ +KLNVFHWHIVDD+SFPYQS+TFP+LS+KG+++    +YT+ DV  ++ +AR RGIRV+PEFD+PGH+ SWGKG+ NLLTPCY+G +PSG FGP+ P  + TY F+ KLF E+   FPD  +HLGGDEV+F+CW+SNP I +F  K  F  D+ KL+ YY+ ++ ++V   A  KK +  MVWQEVFDN  ++    T+++VWK   + ++QEMA+VT + ++ +LS+ WY+N I+YG DW KYY  +P +F G   +K+LV+GGEAC+WGEYVD TN+  R WPRAS VAERLWS++SVTD+ND  +RL + RCR+V  G  A+ +  G  +C+I
Sbjct:   24 CQVLDDAFRRYYNIIFSGSPYPGASSKLHRKPTTKTRAVGEVSLLSVLVQSSHNDCNDFPGLKCLSVLTDELSVQAGESLLQAPSVWGALRGLETFSQLAYRDDNDGNKILMNKTEVVDFPRFRHRGLLLDTSRHYLPLIVILETLDAMAYNKLNVFHWHIVDDQSFPYQSQTFPELSEKGAYNPSRAIYTETDVGAVIWYARERGIRVIPEFDTPGHTQSWGKGEPNLLTPCYNGKEPSGLFGPVHPVTNSTYDFMKKLFNEISNAFPDHYIHLGGDEVSFSCWQSNPDITSFMEKMSFGKDYKKLESYYIQQILDIV---ASYKKGY--MVWQEVFDNGVKLKPD-TVVHVWKFMAEHYKQEMADVTAAGFSTLLSAPWYINSIAYGQDWTKYYAVEPLDFHGTDKQKELVVGGEACLWGEYVDGTNLTPRLWPRASAVAERLWSDKSVTDVNDAYSRLAKHRCRMV-RGIAAQPLFVG--FCDI 501          
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO49845 (Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:A7RET7])

HSP 1 Score: 409.838 bits (1052), Expect = 2.526e-137
Identity = 202/408 (49.51%), Postives = 267/408 (65.44%), Query Frame = 1
Query:  385 ESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSG-SKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKS-NYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAE 1593
            ESY + VT     I +  VWG LR L+T  Q+ ++   G        + D  RF  R  M+DTSRH+L +  I   ++ MS +K NV HWH+VDD+SFP+QS+TFP LSD+GSF+  +HVY+  DV  I+D+AR RGIRV+PEFD+PGH+ SW +   NLLT C     KP+GS GPIDPT+D  Y FL   F EV + FPD  +HLGGDEV F CW+SNP I  +  K  F  +++KL+ YY  KL N++ GL       + ++WQEV DN  +V    T++NVWKG   W  E+A+VT +    A+LSS WYLNYISYGIDW  YY  +P +F+G   +K+LVIGG  CMWGE+VD TN+++RTWPRA  +AERLWS++S TD+     R+ E RCR ++ G  AE
Sbjct:  130 ESYTLTVTAPQSSIYAYTVWGALRGLETFSQIVHQSEDGMYYAKGNKIEDYPRFHHRAFMIDTSRHYLKLSIIKKFLDAMSYAKFNVLHWHVVDDQSFPFQSQTFPSLSDQGSFNNKTHVYSPADVADIIDYARMRGIRVIPEFDTPGHTYSW-RSIPNLLTKCCDAKGKPTGSLGPIDPTIDSNYDFLKAFFGEVAKRFPDQYIHLGGDEVGFGCWQSNPNITAWMEKMRFGTNYSKLEEYYETKLLNIIGGLGK-----QYIIWQEVVDNDVKVLPD-TVVNVWKG--GWPAELAKVTGAKKLKAILSSPWYLNYISYGIDWPNYYKVEPTDFEGTDQEKELVIGGTGCMWGEFVDGTNILARTWPRALAIAERLWSSKSTTDMTSAYARIWEHRCRYLLRGIPAE 528          
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO26761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB56])

HSP 1 Score: 216.853 bits (551), Expect = 1.505e-65
Identity = 122/349 (34.96%), Postives = 189/349 (54.15%), Query Frame = 1
Query:  520 TVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTP---CYSGSKPSGSFGP-IDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQE--MAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDP----QNFDGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDM 1536
            T + D  RF +RGL++D +RHF PV  I  N+E ++  K+NVFHWH+ DD+ F  +SK +P L +  S   +   YTQ  +  ++ +A R GIRV+PE D PGH+ +       L +     Y+  + +G F P ++PT+D+TY FL  LF EV  +FPD   H+GGDE     W  N ++  F  K+    +   LQ Y+ IKL  ++          K M W E+   KN       +I+ W+G  +  +E  + E  K  Y +VLS+ +Y++ +   +    +Y  DP    +    ++  V+GGEA MWGE V    + SR WPR + +AER WS +++TD++ +
Sbjct:    1 TKISDTPRFLWRGLLIDAARHFQPVDVIKRNLEALAAVKMNVFHWHLTDDQGFRIESKVYPKLHELASDGLY---YTQHQIKDVVKYAARLGIRVIPEIDVPGHATAILTAYPELGSKDKYTYTLQRNAGIFDPTLNPTIDKTYEFLENLFAEVTSLFPDEYFHIGGDENEGKHWSENKKMTAFKKKHNLKTNH-DLQTYFNIKLEKILSKFGK-----KLMGWDEIM-TKNM--PTTAVIHSWRGTTEGLKESTLIEAAKKGYQSVLSNGYYIDRMQSVV---HHYKVDPIGNAKLTPAQRARVLGGEATMWGELVTPLTIDSRIWPRTAAIAERFWSPKNITDIDHL 334          
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO29436 (Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:A7T3N0])

HSP 1 Score: 127.487 bits (319), Expect = 2.315e-31
Identity = 132/519 (25.43%), Postives = 217/519 (41.81%), Query Frame = 1
Query:  127 PLPKPFYIYSGGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDG---IFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLS-WGKGQKNLLTPCYSG-----SKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAV--LSSCWYLNYISYGIDWHKYYTCDPQNFDGKK-DLVIGGEACMWGE---YV---------------------DAT---NVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCR 1566
            PLP+      G    +L   I+  +   +  +L   I R+ + +   ++      +N S  ++ +  ++  +DDE+       N   SY+  ++ D      + +   +G L  ++T  Q+   +  G+L      + D+  F  RGLMLDT R F P+  + + ++ MS  KLNV H+H+ D   F  +SK FPDL +       S +YTQ DV  ++ +AR RGIRV+PE +   H+    G   K L    +SG     + P G+          T   +  +  E++ +FP+ + HLG DEV             FT KN        LQ + +    +L+Q   +         W+E   +   V  + T+I  WK E      +  +      A+  LSS +YLNY+  G+   + +T      +  +   ++GGE  MW +   Y+                     D T   +V    WPRA V A   W+  S     D++    EF  R
Sbjct:   36 PLPRELEASGGPLPLSLAFTIQTSS---ESEILARGITRYLEIITTHLHTAARSRVNGS-KELEVLRISVKSDDESL------NEGTSYEYSLSFDSGPQATLTALTPYGALYGMETFSQL---VVDGSLVYTSVSISDKPSFVHRGLMLDTGRRFFPMDLLYNTLDAMSYVKLNVLHFHLSDLCRFSVESKLFPDLRNNE-----SEIYTQDDVRNLVAYARDRGIRVMPEVEGAAHANGLLGLKNKGLQFCNHSGYTQLYNDPQGN----------TLKTMKAILSEMVPLFPEQIFHLGLDEV-------------FTDKN---CTLQSLQSFELALQEHLLQLGKIPA------AWEEALSSTKSVTNR-TVIQAWKAEG-----IKTIVDLKQFAINSLSSHFYLNYM--GVTPLQLWTDIAVGLNETEVQYLLGGEMAMWTDNYCYILECAYPLSAKPSAYWMYDPLHDGTFTQSVAGIIWPRAVVGAGSFWNYNS-----DLSADSAEFNMR 491          
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO46502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ54])

HSP 1 Score: 107.842 bits (268), Expect = 1.774e-24
Identity = 107/483 (22.15%), Postives = 188/483 (38.92%), Query Frame = 1
Query:  376 NMIESYQMEVTKD-GIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFH---------------------RFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSW-----------------GKGQKNLLT----PCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPD----TLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFA----KLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFD--NKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNY--------ISYGIDWHKYYT-------------------------------------CDPQNFDGKKDLVIGGEACMWGEYV-DATNVISRTWPRASVVAERLWSNQSVTDL 1527
            N +E+Y+++V +D  + I+ K   G+   +QTL  +   I +     +   + D  R+++RG+ LD  R+F   +T+   ++ M+  KLN FH+H+ +DE +  +     +L+  GS                       +    Y+  D   IL++A +R I V+PE D P HS +                   K QK LLT    P    S    +   I+P ++ TYTF+  + KE++ +        + H GGDEV    W ++    NF  + G     A    KL+ Y++ ++ N+ +  ++    ++  +    F   ++  +         W+G     Q    +  + Y  +LS   +L +           G  W   +T                                     C P N   K + ++G    +W E V  A  + S  +PR   +AER W   S  D+
Sbjct:   29 NSLEAYKLDVNEDPSVVIIGKGNAGVFYGIQTLLGI---IDTNNSIPSILTIRDSPRYEYRGMHLDVGRNFKTKETVKRLLDAMATYKLNKFHFHLTEDEGWRLEIPGLEELTSVGSKRCHDLKEQECLLPQLGSDPNGSKVKQFYSVLDYKEILEYAEKRHIEVIPEIDMPAHSRAAIKAMEARYQRFKKIGDDNKAQKYLLTEPGDPSRYISVQWFTDNAINPCMESTYTFVKHVVKEIVRMHQHFQKLKMFHFGGDEVAHGAWTNSTACKNFARRLGLKFSSADIVDKLKEYFVQRVANITKDESLDLGGWEDGMLGPKFVPYDRESIKSSQVFAYAWRGGG---QRAYNLANAGYKVILSQATHLYFDHPYEPEPEERGYYWAARFTDTRKTFGYLPEDLYANVKVTKWGEPLDRTALCKEPNSCPPLN---KTENILGMTGALWTETVRTADQMDSMVFPRLLALAERAWHKASWEDV 502          
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Match: EDO42823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E8])

HSP 1 Score: 101.679 bits (252), Expect = 1.866e-22
Identity = 112/516 (21.71%), Postives = 193/516 (37.40%), Query Frame = 1
Query:  289 PINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRF---------------------SHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSF---------------------GPIDPTLDQTYTFLNKLFKEV----IEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGF----PNDFAKLQGYYMIKLTNLV--QGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKW--QQEMAEVTKSNYTAVLSSCWYLNY--------ISYGIDWHKYYTCDPQNF----------------------------DG------KKDLVIGGEACMWGEYV-DATNVISRTWPRASVVAERLWSNQSVTDLNDMANR 1545
            P NQS       ++     D N       +   S +++V +  I +      G+   +QTL  +A + ++  +      + D  R+ +RG+ LD  R+F+    +L  ++ M+  K+N FH+H+ DDE +  +     +L+  GS   +                     +  Y+  D   IL  A    I+V+PEFD PGH  +  K  +         S PS +                        I+P ++ TY F+ K+  EV     +I P T+ H GGDEV    W  +        + G+     +   KL+GY++ ++ N+    GL++   +   +   EV  N+        +   W    +W   +    +  + Y  V++   +L +           G  W   +T   + F                            +G      KK+ +IG    +W E V  A  + S  +PR   VAER W   S  D++D   R
Sbjct:  225 PFNQS------KLIRLVKGDPNVTRGVASSEAYSLEIKVAEKEIKLTGSHASGVFYGVQTLIALADKENTVPMV----TIKDAPRYGYRGMHLDVGRNFMEKAAVLKLLDAMATYKMNKFHFHLTDDEGWRLEIPGLEELTTVGSKRCYDINTTRCILSQLGSGPSPSTSAQYYSVSDYKEILKRANDLHIQVIPEFDMPGHGYAAIKSMEARFKRL-KDSNPSEASKYILSDFNDTSKYLSIQYFTDNAINPCIESTYAFIEKVLTEVKSMHKDIQPLTVYHFGGDEVAHGAWTKSSACEQLAQRMGYNLTGSDIVDKLKGYFVERVANITVNDGLSLAGWEDGLLGHGEVPYNRKSFRNSNVMAYAWNNIWEWGSGKRAYLLANAGYKVVMTQATHLYFDFPYEPDPQERGYYWATRFTDTRKTFGFMPDNLFNNVEQKVTGEPLTREELCKTEGMCVELVKKENIIGMAGALWTETVRTADQMDSMIFPRLLAVAERAWHKASWEDISDKTER 729          
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Match: hexb (hexosaminidase subunit beta [Source:NCBI gene;Acc:101158618])

HSP 1 Score: 491.886 bits (1265), Expect = 7.868e-169
Identity = 243/508 (47.83%), Postives = 331/508 (65.16%), Query Frame = 1
Query:  127 PLPKPFYIYS-----GGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISK--------ISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKG-EDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I        G  F    + K     P C+LL  A +R+  Y++        GP  Q +S+        ++   V+  + D     +P+    ESY++ V      + +  VWG L  L+T  Q+ Y    GA  IN T + D  RF  RG++LD+SRHFLP++ +L N+E M+++K NVFHWHIVDD+SFPY S+TFP LS +G++H +SHVYT  DV  +++FAR RGIRV+PEFD+PGH+ SWGKGQ +LLTPC+SG+ PSGSFGP++P L+ TY F+++ FKEV ++FPD  +HLGGDEV+F CWKSNP I  F  + GF  D++KL+ +Y+ KL ++V      KK +  ++WQEVFDN  ++    T+I+VWKG ++++Q EMA++T + Y  +LSS WYLN ISYG DW   Y  DPQ+F G   +K LVIGGEAC+WGEYVDATN+  R WPRAS VAERLWS + VTD+ND  NRL   RCR+V  G  AE +
Sbjct:   44 PLPQKVQISEVPLKLSGATFEFT-DAKGSTAGPSCSLLQSAYRRYYDYIFG-------GPKKQKMSRNRRAGPLELTELQVSITSPDSQCDGYPSVTSDESYELSVDVPVAVLKAPTVWGALHGLETFSQLVYEDDYGAKTINSTKVSDFPRFAHRGILLDSSRHFLPIKVLLANLETMAMNKFNVFHWHIVDDQSFPYLSRTFPQLSQQGAYHPYSHVYTPSDVKMVIEFARLRGIRVIPEFDTPGHTQSWGKGQMDLLTPCFSGATPSGSFGPVNPILNTTYDFMSRFFKEVSDVFPDGYVHLGGDEVDFTCWKSNPDIKKFMDRQGFGQDYSKLESFYIQKLLDIV---TTTKKGY--IIWQEVFDNGVKLKPD-TLIHVWKGNQEQYQNEMAKITSAGYQTLLSSPWYLNRISYGQDWQSTYKADPQDFKGTEEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAKDVTDINDAYNRLSAHRCRMVERGIPAEPL 537          
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Match: hexb (hexosaminidase subunit beta [Source:NCBI gene;Acc:101158618])

HSP 1 Score: 485.337 bits (1248), Expect = 2.985e-166
Identity = 240/507 (47.34%), Postives = 327/507 (64.50%), Query Frame = 1
Query:  127 PLPKPFYIYS-----GGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISK--------ISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETM 1599
            PLP+   I        G  F    + K     P C+LL  A +R+  Y++        GP  Q +S+        ++   V+  + D     +P+    ESY++ V      + +  VWG L  L+T  Q+ Y    GA  IN T + D  RF  RG++LD+SRHFLP++ +L N+E M+++K NVFHWHIVDD+SFPY S+TFP LS +G++H +SHVYT  DV  +++FAR RGIRV+PEFD+PGH+ SWGKGQ +LLTPC+SG+ PSGSFGP++P L+ TY F+++ FKEV ++FPD  +HLGGDEV+F CWKSNP I  F  + GF  D++KL+ +Y+ KL ++V      KK +  ++WQEVFDN  ++    T+++VW G      EM +VT + YT +LS+ WYL+YISY  DW KYY  +P NF+G   +K LVIGGEAC+WGEYVDATN+  R WPRAS VAERLWS + VTD+ND  NRL   RCR+V  G  AE +
Sbjct:   44 PLPQKVQISEVPLKLSGATFEFT-DAKGSTAGPSCSLLQSAYRRYYDYIFG-------GPKKQKMSRNRRAGPLELTELQVSITSPDSQCDGYPSVTSDESYELSVDVPVAVLKAPTVWGALHGLETFSQLVYEDDYGAKTINSTKVSDFPRFAHRGILLDSSRHFLPIKVLLANLETMAMNKFNVFHWHIVDDQSFPYLSRTFPQLSQQGAYHPYSHVYTPSDVKMVIEFARLRGIRVIPEFDTPGHTQSWGKGQMDLLTPCFSGATPSGSFGPVNPILNTTYDFMSRFFKEVSDVFPDGYVHLGGDEVDFTCWKSNPDIKKFMDRQGFGQDYSKLESFYIQKLLDIV---TTTKKGY--IIWQEVFDNGVKLKPD-TVVHVWMGSGS-DAEMNKVTTAGYTTILSAPWYLDYISYAQDWQKYYKVEPLNFNGTEEQKKLVIGGEACLWGEYVDATNLTPRLWPRASAVAERLWSAKDVTDINDAYNRLSAHRCRMVERGIPAEPL 535          
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Match: hexa (beta-hexosaminidase subunit alpha [Source:NCBI gene;Acc:101172329])

HSP 1 Score: 438.343 bits (1126), Expect = 2.583e-147
Identity = 215/458 (46.94%), Postives = 300/458 (65.50%), Query Frame = 1
Query:  214 CNLLNDAIKRFTKYLYNSIYINYEGPINQSIS-KISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDG---KKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMA-NRLHEFRCRLV 1572
            C+LL+ A +R+   ++   Y    G +  + +   S+ + T+  D EN   +P ++  E Y + V+     + +  VWGILR L+T  Q+ Y+   G+  +NET + D  RFQFRG++LDTSRH+LPV  IL  ++ MS SK NVFHWHIVDD SFPYQS++FP+LS KG+FH  +H+YTQ DV R++ +AR RGIRV+PEFDSPGH+ SWGKGQ +LLTPCY G  PSG+FGP++P L  TY F+   FKEV  +FPD+ +HLGGDEV+F+CW+SNP +  F  K GF  DF KL+ +Y+  + N+         +  ++VWQ+VFD  +E    L+++ VWK    +  ++ +VTK+    +L+S WYL+      +W +YYT  P  F G   +K LVIGGE CMWGEYVDATN+  + WPRAS  AERLWS++  T   + A  RL +FRC+L+
Sbjct:   70 CSLLDAAFRRYFLLIFPD-YTAENGQLEVAANNSFSLYISTDHNDCEN---YPNDDSSERYNLSVSAGQASLNAATVWGILRGLETFSQLVYQDDLGSYFVNETFIEDFPRFQFRGVLLDTSRHYLPVHAILKTLDAMSYSKFNVFHWHIVDDPSFPYQSRSFPELSKKGAFHPATHIYTQSDVRRVISYARMRGIRVLPEFDSPGHTGSWGKGQSHLLTPCYKGGAPSGTFGPVNPALQSTYQFMASFFKEVTSVFPDSYIHLGGDEVDFSCWRSNPHVRAFMQKMGFGGDFPKLEAFYIENIVNITSA-----NNKTSIVWQDVFD-YHERRSALSVVEVWK-HGCYLCKVRQVTKAGLRVILASPWYLDLPGPTHNWARYYTVWPLAFPGSEKQKRLVIGGEVCMWGEYVDATNLFPKLWPRASAAAERLWSDEKQTSSVEKAFPRLEDFRCKLL 516          
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000037355.1 (SMESG000037355.1)

HSP 1 Score: 1090.49 bits (2819), Expect = 0.000e+0
Identity = 522/522 (100.00%), Postives = 522/522 (100.00%), Query Frame = 1
Query:   73 MLRYFIGVCILLYVNAYDPLPKPFYIYSGGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGEI 1638
            MLRYFIGVCILLYVNAYDPLPKPFYIYSGGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGEI
Sbjct:    1 MLRYFIGVCILLYVNAYDPLPKPFYIYSGGNVFNLVENIKIQNPYPQCNLLNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKLTNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGKKDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGGTYCNIPGEI 522          
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 344.354 bits (882), Expect = 6.625e-109
Identity = 177/448 (39.51%), Postives = 259/448 (57.81%), Query Frame = 1
Query:  328 VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYS-GSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNG-FPNDFAKLQGYYMIKLTNLVQ--GLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGK----------------KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGG 1611
            + N   + ++  WP+  M E+YQ+ V+  GIFI +KE WG LR L++L QM +R  +G + INET + DQ RF+ RG+MLDT+RHF+P   I+ N++ M ++K+NVFHWH+ DD+SFP  ++   + +  G++     VY  + V  I+++AR RGIRV+PE DSP H+LSW K    ++T C     K SG +GP++     TY  L  L+K++I +FPD  +HLG DEV  +C  SN  I ++    G F  D   L  +Y  KL N++   GL+   K    +VWQE ++ +N V +K TI+ +WK +     E A + K N   + S+CWYL+ + YG  W  +Y CDP +  G                 ++ ++GGEA MW E++DA NVI R WP AS  AERLWS   + +    A+RL E RCR+      A   +G G
Sbjct:  234 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYE-RNSVLKKGTIVQLWKSQST--AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAG 676          
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 343.969 bits (881), Expect = 6.627e-109
Identity = 177/448 (39.51%), Postives = 259/448 (57.81%), Query Frame = 1
Query:  328 VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYS-GSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNG-FPNDFAKLQGYYMIKLTNLVQ--GLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGK----------------KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGG 1611
            + N   + ++  WP+  M E+YQ+ V+  GIFI +KE WG LR L++L QM +R  +G + INET + DQ RF+ RG+MLDT+RHF+P   I+ N++ M ++K+NVFHWH+ DD+SFP  ++   + +  G++     VY  + V  I+++AR RGIRV+PE DSP H+LSW K    ++T C     K SG +GP++     TY  L  L+K++I +FPD  +HLG DEV  +C  SN  I ++    G F  D   L  +Y  KL N++   GL+   K    +VWQE ++ +N V +K TI+ +WK +     E A + K N   + S+CWYL+ + YG  W  +Y CDP +  G                 ++ ++GGEA MW E++DA NVI R WP AS  AERLWS   + +    A+RL E RCR+      A   +G G
Sbjct:  218 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYE-RNSVLKKGTIVQLWKSQST--AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAG 660          
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 343.969 bits (881), Expect = 7.026e-109
Identity = 177/448 (39.51%), Postives = 259/448 (57.81%), Query Frame = 1
Query:  328 VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYS-GSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNG-FPNDFAKLQGYYMIKLTNLVQ--GLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGK----------------KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGG 1611
            + N   + ++  WP+  M E+YQ+ V+  GIFI +KE WG LR L++L QM +R  +G + INET + DQ RF+ RG+MLDT+RHF+P   I+ N++ M ++K+NVFHWH+ DD+SFP  ++   + +  G++     VY  + V  I+++AR RGIRV+PE DSP H+LSW K    ++T C     K SG +GP++     TY  L  L+K++I +FPD  +HLG DEV  +C  SN  I ++    G F  D   L  +Y  KL N++   GL+   K    +VWQE ++ +N V +K TI+ +WK +     E A + K N   + S+CWYL+ + YG  W  +Y CDP +  G                 ++ ++GGEA MW E++DA NVI R WP AS  AERLWS   + +    A+RL E RCR+      A   +G G
Sbjct:  220 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYE-RNSVLKKGTIVQLWKSQST--AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAG 662          
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Match: SMESG000002681.1 (SMESG000002681.1)

HSP 1 Score: 344.354 bits (882), Expect = 8.062e-109
Identity = 177/448 (39.51%), Postives = 259/448 (57.81%), Query Frame = 1
Query:  328 VTNCTDDENTKLWPTENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINETVLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDESFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDSPGHSLSWGKGQKNLLTPCYS-GSKPSGSFGPIDPTLDQTYTFLNKLFKEVIEIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNG-FPNDFAKLQGYYMIKLTNLVQ--GLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMAEVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGK----------------KDLVIGGEACMWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLVINGFNAETMNGGG 1611
            + N   + ++  WP+  M E+YQ+ V+  GIFI +KE WG LR L++L QM +R  +G + INET + DQ RF+ RG+MLDT+RHF+P   I+ N++ M ++K+NVFHWH+ DD+SFP  ++   + +  G++     VY  + V  I+++AR RGIRV+PE DSP H+LSW K    ++T C     K SG +GP++     TY  L  L+K++I +FPD  +HLG DEV  +C  SN  I ++    G F  D   L  +Y  KL N++   GL+   K    +VWQE ++ +N V +K TI+ +WK +     E A + K N   + S+CWYL+ + YG  W  +Y CDP +  G                 ++ ++GGEA MW E++DA NVI R WP AS  AERLWS   + +    A+RL E RCR+      A   +G G
Sbjct:  232 IVNIYVESDSHQWPSLYMNETYQISVSLKGIFISAKETWGALRGLESLSQMMWRTRAGRIFINETKVQDQPRFKHRGVMLDTARHFIPKDIIMKNLDAMVMNKMNVFHWHLTDDQSFPLITENHAEFALHGAYDPEHKVYRPEVVKEIIEYARVRGIRVIPEIDSPSHTLSWRKSHPEVMTRCIDMNGKWSGHYGPVNMAAASTYRLLTSLYKDIINLFPDQWIHLGSDEVATSCLSSNQAIQSWMRSRGMFSVD--SLIDFYTRKLQNIITQLGLSNNNKQRGFIVWQEAYE-RNSVLKKGTIVQLWKSQST--AEAATLAKQNIQVIYSACWYLDRLEYGAQWLNHYQCDPGDEYGNQMVMNDYVNVPVNDNWRENILGGEAAMWLEFLDADNVIPRIWPLASAAAERLWSPNFINNAEKAASRLEEMRCRMFSRSIPAGVASGAG 674          
The following BLAST results are available for this feature:
BLAST of Beta-hexosaminidase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HEXB2.613e-16045.85hexosaminidase subunit beta [Source:HGNC Symbol;Ac... [more]
HEXA9.095e-15547.80hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXA3.347e-15445.92hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXA4.466e-15248.17hexosaminidase subunit alpha [Source:HGNC Symbol;A... [more]
HEXB7.192e-12953.71hexosaminidase subunit beta [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hex-14.243e-11440.69Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
hex-14.243e-11440.69Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
hex-14.243e-11440.69Beta-hexosaminidase A [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hexo11.650e-6031.36gene:FBgn0041630 transcript:FBtr0300774[more]
Hexo11.650e-6031.36gene:FBgn0041630 transcript:FBtr0333567[more]
Hexo11.650e-6031.36gene:FBgn0041630 transcript:FBtr0073237[more]
Hexo12.726e-6031.36gene:FBgn0041630 transcript:FBtr0073235[more]
Hexo21.266e-5630.67gene:FBgn0041629 transcript:FBtr0071249[more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexa3.787e-16549.69hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
hexb1.805e-15647.51hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexa2.591e-15248.01hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
hexb4.529e-12245.33hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb5.245e-9756.62hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexb2.694e-16449.68hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb7.457e-16348.20hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb1.320e-16051.15hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb1.443e-15647.15hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
hexb2.601e-15647.15hexosaminidase B (beta polypeptide) [Source:NCBI g... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hexb1.076e-16348.13hexosaminidase B [Source:MGI Symbol;Acc:MGI:96074][more]
Hexa1.747e-14945.63hexosaminidase A [Source:MGI Symbol;Acc:MGI:96073][more]
back to top
BLAST of Beta-hexosaminidase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20060|HEXB_MOUSE7.527e-16348.13Beta-hexosaminidase subunit beta OS=Mus musculus O... [more]
sp|P07686|HEXB_HUMAN1.215e-15945.85Beta-hexosaminidase subunit beta OS=Homo sapiens O... [more]
sp|P49614|HEXB_FELCA5.216e-15948.63Beta-hexosaminidase subunit beta OS=Felis catus OX... [more]
sp|Q6AXR4|HEXB_RAT2.337e-15847.03Beta-hexosaminidase subunit beta OS=Rattus norvegi... [more]
sp|Q0V8R6|HEXA_BOVIN1.148e-15746.76Beta-hexosaminidase subunit alpha OS=Bos taurus OX... [more]
back to top
BLAST of Beta-hexosaminidase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H3AAJ12.993e-16947.45Beta-hexosaminidase OS=Latimeria chalumnae OX=7897... [more]
H2VDU04.241e-16950.20Beta-hexosaminidase OS=Takifugu rubripes OX=31033 ... [more]
A0A3Q3G3244.786e-16950.42Beta-hexosaminidase OS=Labrus bergylta OX=56723 PE... [more]
G3PTM91.512e-16850.21Beta-hexosaminidase OS=Gasterosteus aculeatus OX=6... [more]
A0A3B5AMC64.039e-16848.14Beta-hexosaminidase OS=Stegastes partitus OX=14419... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hexb1.975e-16447.91hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb3.405e-16147.32hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexb8.253e-16147.32hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
hexa7.794e-15747.38beta-hexosaminidase subunit alpha-like [Source:NCB... [more]
hexb7.649e-14444.02hexosaminidase B (beta polypeptide) [Source:ZFIN;A... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hexa6.291e-15245.38hexosaminidase A (alpha polypeptide) [Source:ZFIN;... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO498452.526e-13749.51Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO267611.505e-6534.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO294362.315e-3125.43Beta-hexosaminidase [Source:UniProtKB/TrEMBL;Acc:... [more]
EDO465021.774e-2422.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428231.866e-2221.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Beta-hexosaminidase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hexb7.868e-16947.83hexosaminidase subunit beta [Source:NCBI gene;Acc:... [more]
hexb2.985e-16647.34hexosaminidase subunit beta [Source:NCBI gene;Acc:... [more]
hexa2.583e-14746.94beta-hexosaminidase subunit alpha [Source:NCBI gen... [more]
back to top
BLAST of Beta-hexosaminidase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037355.10.000e+0100.00SMESG000037355.1[more]
SMESG000002681.16.625e-10939.51SMESG000002681.1[more]
SMESG000002681.16.627e-10939.51SMESG000002681.1[more]
SMESG000002681.17.026e-10939.51SMESG000002681.1[more]
SMESG000002681.18.062e-10939.51SMESG000002681.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033380 ID=SMED30033380|Name=Beta-hexosaminidase|organism=Schmidtea mediterranea sexual|type=transcript|length=1762bp
AAATAAATCAACTTCGATTTAAATTGATAATTTTTCGATTTCCATTTATA
CAAATCTTAAGGTTTTTAAATTATGCTTAGATATTTTATTGGAGTTTGCA
TATTATTATATGTGAACGCATATGACCCTCTTCCCAAGCCTTTTTACATC
TATTCAGGTGGCAATGTTTTCAATTTGGTTGAAAATATTAAAATTCAAAA
TCCATATCCACAATGCAATTTATTGAATGATGCAATAAAAAGATTTACAA
AATATCTTTACAATTCAATTTATATCAATTATGAGGGGCCCATAAATCAA
TCCATTAGCAAGATTTCAATATCAATGGTTACCAATTGCACCGACGACGA
AAACACAAAACTTTGGCCAACTGAAAACATGATTGAATCTTATCAAATGG
AAGTAACGAAAGATGGAATTTTTATCATGTCAAAAGAGGTTTGGGGAATT
TTAAGAGCCTTACAAACCCTATTCCAAATGGCTTATCGAATTAGTAGTGG
AGCTCTATGTATTAACGAAACGGTTTTATATGATCAAGCAAGATTTCAAT
TTCGAGGACTTATGTTGGATACGTCTCGTCATTTTCTGCCTGTCCAGACG
ATTTTAGACAATATAGAATTAATGTCTATTAGCAAACTCAATGTTTTTCA
TTGGCATATTGTTGATGATGAAAGCTTTCCTTACCAATCCAAGACCTTTC
CAGATCTTTCAGATAAAGGTTCGTTTCATCGTTTTAGTCATGTTTATACA
CAAAAGGATGTTTTACGTATTCTCGACTTTGCTCGCCGACGGGGCATAAG
AGTAGTTCCAGAATTCGATTCACCAGGTCACTCGCTATCTTGGGGCAAAG
GTCAAAAAAACTTATTAACACCGTGTTACAGTGGAAGCAAACCTAGTGGC
TCTTTTGGACCAATAGATCCAACTTTAGACCAAACTTACACCTTTCTTAA
CAAATTATTTAAAGAAGTTATCGAAATTTTTCCAGATACTTTGTTACACT
TGGGGGGAGATGAAGTAAATTTCAACTGCTGGAAAAGTAACCCAAGAATT
GTTAATTTTACAGTAAAAAATGGTTTTCCTAATGATTTTGCTAAACTTCA
AGGTTATTACATGATAAAATTAACTAATTTGGTCCAAGGTTTGGCTGTTA
AGAAGAAAGACTTCAAAACAATGGTCTGGCAAGAAGTATTTGATAACAAA
AATGAAGTTGATCAGAAATTAACTATTATAAATGTTTGGAAAGGAGAAGA
CAAGTGGCAGCAAGAGATGGCCGAAGTTACAAAATCTAATTACACTGCCG
TTTTGTCATCCTGTTGGTATCTTAATTACATATCTTATGGAATTGACTGG
CATAAATATTACACATGCGATCCTCAAAACTTTGACGGTAAAAAAGATTT
AGTCATTGGAGGAGAAGCGTGCATGTGGGGAGAATATGTTGATGCAACCA
ATGTCATTTCTCGGACATGGCCCAGAGCGTCTGTGGTCGCTGAACGTTTA
TGGAGCAACCAGTCTGTTACGGATTTAAATGACATGGCTAACAGATTACA
TGAGTTCCGCTGTAGACTTGTTATAAATGGTTTCAACGCAGAAACTATGA
ACGGGGGTGGTACTTATTGCAATATTCCTGGAGAAATTTAATGCCAATGA
TTTCATTTCTTTAATTTAAATACTATATTGTTATAATTTTGATTATATTT
GATGACTGTTTATGTGAAATATATATAAACTTTGAAGCACATGATTTTTG
TAAACATATAAG
back to top

protein sequence of SMED30033380-orf-1

>SMED30033380-orf-1 ID=SMED30033380-orf-1|Name=SMED30033380-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=523bp
MLRYFIGVCILLYVNAYDPLPKPFYIYSGGNVFNLVENIKIQNPYPQCNL
LNDAIKRFTKYLYNSIYINYEGPINQSISKISISMVTNCTDDENTKLWPT
ENMIESYQMEVTKDGIFIMSKEVWGILRALQTLFQMAYRISSGALCINET
VLYDQARFQFRGLMLDTSRHFLPVQTILDNIELMSISKLNVFHWHIVDDE
SFPYQSKTFPDLSDKGSFHRFSHVYTQKDVLRILDFARRRGIRVVPEFDS
PGHSLSWGKGQKNLLTPCYSGSKPSGSFGPIDPTLDQTYTFLNKLFKEVI
EIFPDTLLHLGGDEVNFNCWKSNPRIVNFTVKNGFPNDFAKLQGYYMIKL
TNLVQGLAVKKKDFKTMVWQEVFDNKNEVDQKLTIINVWKGEDKWQQEMA
EVTKSNYTAVLSSCWYLNYISYGIDWHKYYTCDPQNFDGKKDLVIGGEAC
MWGEYVDATNVISRTWPRASVVAERLWSNQSVTDLNDMANRLHEFRCRLV
INGFNAETMNGGGTYCNIPGEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR025705Beta_hexosaminidase_sua/sub
IPR013781Glyco_hydro_catalytic_dom
IPR029019HEX_eukaryotic_N
IPR015883Glyco_hydro_20_cat
IPR029018Hex-like_dom2
IPR017853Glycoside_hydrolase_SF
Vocabulary: molecular function
TermDefinition
GO:0004563beta-N-acetylhexosaminidase activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0001525angiogenesis
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025705Beta-hexosaminidasePRINTSPR00738GLHYDRLASE20coord: 303..316
score: 55.84
coord: 444..460
score: 56.15
coord: 181..202
score: 50.0
coord: 281..299
score: 35.17
coord: 152..169
score: 46.46
coord: 116..136
score: 34.2
coord: 461..478
score: 49.24
coord: 236..253
score: 60.35
IPR025705Beta-hexosaminidasePIRSFPIRSF001093B-hxosamndse_ab_euk_coord: 4..520
e-value: 1.2E-152
score: 507.0
NoneNo IPR availableGENE3DG3DSA:3.20.20.80coord: 157..519
e-value: 3.3E-131
score: 439.7
NoneNo IPR availablePANTHERPTHR22600BETA-HEXOSAMINIDASEcoord: 46..512
NoneNo IPR availablePANTHERPTHR22600:SF39BETA-HEXOSAMINIDASE SUBUNIT ALPHAcoord: 46..512
NoneNo IPR availableCDDcd06562GH20_HexA_HexB-likecoord: 158..503
e-value: 1.31727E-166
score: 473.623
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..16
score: 0.639
IPR015883Glycoside hydrolase family 20, catalytic domainPFAMPF00728Glyco_hydro_20coord: 158..479
e-value: 4.2E-82
score: 276.4
IPR029018Beta-hexosaminidase-like, domain 2GENE3DG3DSA:3.30.379.10coord: 16..155
e-value: 9.8E-25
score: 89.5
IPR029018Beta-hexosaminidase-like, domain 2SUPERFAMILYSSF55545beta-N-acetylhexosaminidase-like domaincoord: 20..156
IPR029019Beta-hexosaminidase, eukaryotic type, N-terminalPFAMPF14845Glycohydro_20b2coord: 31..136
e-value: 9.8E-10
score: 39.2
IPR017853Glycoside hydrolase superfamilySUPERFAMILYSSF51445(Trans)glycosidasescoord: 158..510