1-acyl-sn-glycerol-3-phosphate acyltransferase delta

Overview
Name1-acyl-sn-glycerol-3-phosphate acyltransferase delta
Smed IDSMED30033378
Length (bp)1228
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (SMED30033378) t-SNE clustered cells

Violin plots show distribution of expression levels for 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (SMED30033378) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (SMED30033378) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (SMED30033378) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033378

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033378h1SMcG0004068 dd_Smed_v4_9745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033378h1SMcG0004068 dd_Smed_v4_9745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033378h1SMcG0004068 dd_Smed_v4_9745_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30033378h1SMcG0004068 dd_Smed_v6_9745_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033378h1SMcG0004068 dd_Smed_v4_9745_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Match: AGPAT4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:20885])

HSP 1 Score: 212.616 bits (540), Expect = 1.637e-64
Identity = 126/378 (33.33%), Postives = 207/378 (54.76%), Query Frame = 1
Query:   55 LPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFT--DMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            L  +LK  FL H++    F+ SG  +  + + T   LW  N+ L+ KI   L Y I  Q   + +WW   +  ++ +       G ENA++++NHK++ID+L GW ++E++G LGG+    K+ L ++PI+GW+W +   +F  R W +D+ T++ S   L D+P  Y    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +ED+P   D+E + WL+ L+ +KD+    + + G F ++     ++ +T  + +   SL   V+   F F+ + + + S   +  FI    +  + V  MI +T+ + GSAYG
Sbjct:    3 LAGLLKSQFLCHLVFCYVFIASGLIINTIQLFT-LLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKY--FFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADLYVRRIPLEDIP-EDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASL---VLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Match: AGPAT3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:326])

HSP 1 Score: 206.453 bits (524), Expect = 3.752e-62
Identity = 122/372 (32.80%), Postives = 200/372 (53.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++  + + +  LW  ++ LY ++   L Y +W Q   + +WW   +  L+ +   V+  G E+A+II+NH ++ID+L GW M E++G LG +    K+ L ++P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A +K +  L   LLPR KGF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +ED+PL  ++E AQWL+ L+ +KD+    + Q G F     F   +R   ++   S    ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVLHLLVGFVFVVSGL-VINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYM--WFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL-DEKEAAQWLHKLYQEKDALQEIYNQKGMF-PGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Match: AGPAT3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:326])

HSP 1 Score: 206.453 bits (524), Expect = 3.752e-62
Identity = 122/372 (32.80%), Postives = 200/372 (53.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++  + + +  LW  ++ LY ++   L Y +W Q   + +WW   +  L+ +   V+  G E+A+II+NH ++ID+L GW M E++G LG +    K+ L ++P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A +K +  L   LLPR KGF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +ED+PL  ++E AQWL+ L+ +KD+    + Q G F     F   +R   ++   S    ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVLHLLVGFVFVVSGL-VINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYM--WFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL-DEKEAAQWLHKLYQEKDALQEIYNQKGMF-PGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Match: AGPAT3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:326])

HSP 1 Score: 206.453 bits (524), Expect = 3.752e-62
Identity = 122/372 (32.80%), Postives = 200/372 (53.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++  + + +  LW  ++ LY ++   L Y +W Q   + +WW   +  L+ +   V+  G E+A+II+NH ++ID+L GW M E++G LG +    K+ L ++P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A +K +  L   LLPR KGF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +ED+PL  ++E AQWL+ L+ +KD+    + Q G F     F   +R   ++   S    ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVLHLLVGFVFVVSGL-VINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYM--WFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL-DEKEAAQWLHKLYQEKDALQEIYNQKGMF-PGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Match: AGPAT3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:326])

HSP 1 Score: 206.453 bits (524), Expect = 3.752e-62
Identity = 122/372 (32.80%), Postives = 200/372 (53.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++  + + +  LW  ++ LY ++   L Y +W Q   + +WW   +  L+ +   V+  G E+A+II+NH ++ID+L GW M E++G LG +    K+ L ++P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A +K +  L   LLPR KGF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +ED+PL  ++E AQWL+ L+ +KD+    + Q G F     F   +R   ++   S    ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVLHLLVGFVFVVSGL-VINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYM--WFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL-DEKEAAQWLHKLYQEKDALQEIYNQKGMF-PGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Match: acl-9 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q23087])

HSP 1 Score: 97.0561 bits (240), Expect = 6.537e-22
Identity = 78/236 (33.05%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  277 YIEDENVKYLG-----SENALIIMNHKYDIDWLIGWQM---AEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVN---CLLPRAKGFIEIVHAIR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQ 945
            YI   N++  G      E ALIIMNH+  +DWL  W      + + C    I  +K  LK++P  GW  +    IFL R +  DK  + N  N   +  + YQ  LLL+PEG   TD+  K++ +  +    K LV+    L PR  GF+ IV A+R  NN+K IYD+++ F  +      +     V  C  E  + +  +Y IE +P  +DE L QWL  L+  K+     F +
Sbjct:   76 YIFGANIRIKGDFINHEEPALIIMNHRTRLDWLFFWNALYKMDPWLCTTEKIS-LKGMLKYVPGAGWAMQAASYIFLDRSFDTDKTKLDNILNYYAETEYKYQ--LLLFPEG---TDKCPKATERSRIHSEKKGLVHYQYVLHPRVTGFVHIVQAMRRANNIKYIYDVSIGFGDAIVQSELDIFAHGV--CPKEVFYQVI-KYPIEAIP-QTDEALGQWLVNLWRNKEEKLKRFYE 301          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Match: acl-9 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q23087])

HSP 1 Score: 97.0561 bits (240), Expect = 6.537e-22
Identity = 78/236 (33.05%), Postives = 115/236 (48.73%), Query Frame = 1
Query:  277 YIEDENVKYLG-----SENALIIMNHKYDIDWLIGWQM---AEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVN---CLLPRAKGFIEIVHAIR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQ 945
            YI   N++  G      E ALIIMNH+  +DWL  W      + + C    I  +K  LK++P  GW  +    IFL R +  DK  + N  N   +  + YQ  LLL+PEG   TD+  K++ +  +    K LV+    L PR  GF+ IV A+R  NN+K IYD+++ F  +      +     V  C  E  + +  +Y IE +P  +DE L QWL  L+  K+     F +
Sbjct:   76 YIFGANIRIKGDFINHEEPALIIMNHRTRLDWLFFWNALYKMDPWLCTTEKIS-LKGMLKYVPGAGWAMQAASYIFLDRSFDTDKTKLDNILNYYAETEYKYQ--LLLFPEG---TDKCPKATERSRIHSEKKGLVHYQYVLHPRVTGFVHIVQAMRRANNIKYIYDVSIGFGDAIVQSELDIFAHGV--CPKEVFYQVI-KYPIEAIP-QTDEALGQWLVNLWRNKEEKLKRFYE 301          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Match: bus-18 (pep chromosome:WBcel235:V:11773720:11776631:1 gene:WBGene00044631.1 transcript:F55A11.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:bus-18)

HSP 1 Score: 76.6406 bits (187), Expect = 4.066e-15
Identity = 52/216 (24.07%), Postives = 105/216 (48.61%), Query Frame = 1
Query:  262 LKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYG--CLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNN--VKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWL 897
            + +R+ +  + +++     A+I+MNH+  +DW+  W    Q     +      +K  LK +P  G+       +FL+R+   DK +  ++ +   +    YQ  +LL+PEGT  ++     S + A    ++ L   L PR  GF+ +++ +R    V+ IYD+T+A+P +      +  +      +  E H   R+  I  +PL ++++ ++WL
Sbjct:   68 MGVRIRVSGDEIEF--GSPAMIVMNHRTRLDWMYMWCALYQINPWLITSNKISLKAQLKKLPGAGFGMAAAQFVFLERNAEVDKRSFDDAIDYFKNIDKKYQ--ILLFPEGTDKSEWTTLKSREFAKKNGLRHLDYVLYPRTTGFLHLLNKMREQEYVEYIYDITIAYPYNIVQSEIDLVLK---GASPREVHFHIRKIPISQVPL-NEQDASRWL 275          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Match: acl-11 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q95R12])

HSP 1 Score: 74.7146 bits (182), Expect = 1.716e-14
Identity = 74/296 (25.00%), Postives = 137/296 (46.28%), Query Frame = 1
Query:   94 LLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKI--IYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV--KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPF---VKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEK---LKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNC----NLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
            LL L+ V   +C + +  ++    W   R +  ++  + +  Y+  C F F  +    ++I L+  +E V  K    ENA++I NH+ ++DW+I   +A ++G  G    F   VK S+  +P+ GW    +G I+++R        +      L++    Y   LL++PEGTR + +K   L+SSN+       +P+ N L PR+ G +++     + +  IYD+T+ +      E           C      ++ H+   R  I+++P  +  EL  W    F +K+   + F
Sbjct:   20 LLSLSMVPFASCAIVIGGVS----WIVPRHVAQQLDNMLYKSYMRLCLFVF--ENLSGVEIYLHGTNEEVVNKTGKPENAVMISNHQSNVDWIIPVMLAARHGDQGNEQAFRVMVKNSIHLVPMFGWYIFQHGYIYVRRFGEFIGAPVLRQLKWLNESDPPY--WLLIFPEGTRNSAKKKHLLESSNRFLEKSGRQPMQNVLCPRSGG-LQLALDNLSTLDAIYDVTVMYGQMRMAERRGLAPGMFDFCCGSQQFKQLHIHLDRIPIDEVP-KAKLELRTWTIERFTKKERIIDEF 305          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Match: acl-11 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q95R12])

HSP 1 Score: 74.7146 bits (182), Expect = 1.716e-14
Identity = 74/296 (25.00%), Postives = 137/296 (46.28%), Query Frame = 1
Query:   94 LLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKI--IYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV--KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPF---VKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEK---LKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNC----NLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
            LL L+ V   +C + +  ++    W   R +  ++  + +  Y+  C F F  +    ++I L+  +E V  K    ENA++I NH+ ++DW+I   +A ++G  G    F   VK S+  +P+ GW    +G I+++R        +      L++    Y   LL++PEGTR + +K   L+SSN+       +P+ N L PR+ G +++     + +  IYD+T+ +      E           C      ++ H+   R  I+++P  +  EL  W    F +K+   + F
Sbjct:   20 LLSLSMVPFASCAIVIGGVS----WIVPRHVAQQLDNMLYKSYMRLCLFVF--ENLSGVEIYLHGTNEEVVNKTGKPENAVMISNHQSNVDWIIPVMLAARHGDQGNEQAFRVMVKNSIHLVPMFGWYIFQHGYIYVRRFGEFIGAPVLRQLKWLNESDPPY--WLLIFPEGTRNSAKKKHLLESSNRFLEKSGRQPMQNVLCPRSGG-LQLALDNLSTLDAIYDVTVMYGQMRMAERRGLAPGMFDFCCGSQQFKQLHIHLDRIPIDEVP-KAKLELRTWTIERFTKKERIIDEF 305          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0075417)

HSP 1 Score: 207.608 bits (527), Expect = 7.909e-63
Identity = 126/381 (33.07%), Postives = 209/381 (54.86%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV-KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSS------SFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            E LK+  L H+ + LTF  SG C+  + ++    +   ++ L+ K++Y+ CY ++ Q  F++ W+   K+ +Y++ E+  K+ G E+ L+IMNHKY+IDWL GW + E+ G LG    + K++++++PI+GW W     +FL R++ +DK  I+     +  +P      LLL  EGTRFT  K ++S K A  + M  L + L+PR KGF   +  IR    VIYD+ LA+      +   ATM ++L+    E HLL RR  +E +P   ++E A WL  LF +KD   + FL+ G+F ++S      ++V K+R   +V      +  +S +FY++   +L  +W   I  +  +GL   ++   I  T+    S YG
Sbjct:    5 EKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPD--PTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDINLAY---RPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVP-EDEKEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYG 379          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0075419)

HSP 1 Score: 207.608 bits (527), Expect = 7.909e-63
Identity = 126/381 (33.07%), Postives = 209/381 (54.86%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV-KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSS------SFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            E LK+  L H+ + LTF  SG C+  + ++    +   ++ L+ K++Y+ CY ++ Q  F++ W+   K+ +Y++ E+  K+ G E+ L+IMNHKY+IDWL GW + E+ G LG    + K++++++PI+GW W     +FL R++ +DK  I+     +  +P      LLL  EGTRFT  K ++S K A  + M  L + L+PR KGF   +  IR    VIYD+ LA+      +   ATM ++L+    E HLL RR  +E +P   ++E A WL  LF +KD   + FL+ G+F ++S      ++V K+R   +V      +  +S +FY++   +L  +W   I  +  +GL   ++   I  T+    S YG
Sbjct:    5 EKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPD--PTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDINLAY---RPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVP-EDEKEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYG 379          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0075418)

HSP 1 Score: 207.608 bits (527), Expect = 7.909e-63
Identity = 126/381 (33.07%), Postives = 209/381 (54.86%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV-KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSS------SFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            E LK+  L H+ + LTF  SG C+  + ++    +   ++ L+ K++Y+ CY ++ Q  F++ W+   K+ +Y++ E+  K+ G E+ L+IMNHKY+IDWL GW + E+ G LG    + K++++++PI+GW W     +FL R++ +DK  I+     +  +P      LLL  EGTRFT  K ++S K A  + M  L + L+PR KGF   +  IR    VIYD+ LA+      +   ATM ++L+    E HLL RR  +E +P   ++E A WL  LF +KD   + FL+ G+F ++S      ++V K+R   +V      +  +S +FY++   +L  +W   I  +  +GL   ++   I  T+    S YG
Sbjct:    5 EKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPD--PTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDINLAY---RPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVP-EDEKEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYG 379          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Match: Agpat3 (gene:FBgn0036623 transcript:FBtr0308819)

HSP 1 Score: 207.608 bits (527), Expect = 9.995e-63
Identity = 126/381 (33.07%), Postives = 209/381 (54.86%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENV-KYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSS------SFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            E LK+  L H+ + LTF  SG C+  + ++    +   ++ L+ K++Y+ CY ++ Q  F++ W+   K+ +Y++ E+  K+ G E+ L+IMNHKY+IDWL GW + E+ G LG    + K++++++PI+GW W     +FL R++ +DK  I+     +  +P      LLL  EGTRFT  K ++S K A  + M  L + L+PR KGF   +  IR    VIYD+ LA+      +   ATM ++L+    E HLL RR  +E +P   ++E A WL  LF +KD   + FL+ G+F ++S      ++V K+R   +V      +  +S +FY++   +L  +W   I  +  +GL   ++   I  T+    S YG
Sbjct:   16 EKLKQLRLIHLCIALTFFTSGLCINFIQLLMHVFIKPIDKRLFRKLMYYACYSLYSQLIFVSDWYAGSKMTVYMDKEDFEKHAGKEHVLLIMNHKYEIDWLNGWMICEKLGVLGNCKAYAKKAIRYVPIIGWGWWLAEFVFLNRNFDQDKTIITEQLKVVFSYPD--PTWLLLNAEGTRFTPAKHEASVKFAQERGMTVLKHHLIPRTKGFTASLAPIRGLCPVIYDINLAY---RPTDKTPATMLSLLHGKSVEPHLLMRRIPLEQVP-EDEKEAAAWLQNLFVEKDKIIDSFLETGSFFKTSGIKEVPAYVNKRRLCSLVNFVCWAVFSLSCIFYYVITSLLAANWTAFITALSVLGLFYWLMGQAINKTQISKASNYG 390          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Match: Agpat4 (gene:FBgn0036622 transcript:FBtr0331172)

HSP 1 Score: 171.014 bits (432), Expect = 5.315e-49
Identity = 96/298 (32.21%), Postives = 163/298 (54.70%), Query Frame = 1
Query:   82 LFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDEN-VKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSS 972
            L  +L+ +TF   G  +    ++    +  +++ L   + Y+L Y  +C    +A+W+   K+R+YI+ ++  K+ G E+ L++MNH Y+IDWL  W + ++ G LGGT  + K+ L+++P+LGW+W     IFL R++ KDK+ I     ++  +P      LLL  EGTRFT  K + S K A  + +  L + L+PR KGF   +  +R     IYD+ LAF   + N   + TM + LN    E ++  RR  ++ +P   ++E A W+   F +KD   + F + G+F ++S 
Sbjct:    7 LGRLLIAVTFFTCGFFVNIGQLLLILLVRPFDKKLSRSLAYYLHYSFYCILVCVAEWYAGSKLRVYIDPQDEQKFFGKEHGLLLMNHTYEIDWLTAWMITDKLGNLGGTKAYAKKMLRYVPVLGWVWWMAEFIFLDRNFEKDKVVIKTQLKEVFSYPDPVW--LLLNAEGTRFTPAKHELSVKFAEERGLPLLKHHLIPRTKGFTTSLPTMRGICPAIYDINLAF---KKNAEPKPTMLSQLNGEPVEPYMYIRRVPLDVVP-DDEKEAAAWMQDFFAEKDKIIDSFHETGSFFKNSG 298          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2765])

HSP 1 Score: 193.741 bits (491), Expect = 1.925e-57
Identity = 102/308 (33.12%), Postives = 171/308 (55.52%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKR 990
            LK  F+  +L+   FV+SG  ++    + +  LW +++ LY +I   L Y +W Q   + +WW   +  LY +   V   G E+ +II+NH +++D+L GW + E+YG LG +    K  L  +P++GW W +   +F KR W +D+ T+ +  + L D+P       LLY EGTRFT++K + S ++A SK +  L   LLPR KGF   +  ++  VK +YD+TL F   +N      T+  ++N    +A L  RR+ +E++P   ++E A WL+ L+ +KD+   Y+ + G +   +  +I KR
Sbjct:    7 LKSLFVLQLLIGFVFVVSGL-IINFTQLCTCVLWPFDKQLYRRINTRLSYSLWSQLVMLLEWWSGTECTLYTDQATVDKFGKEHVIIILNHNFEVDFLCGWTICERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRKWEEDRDTVFSGLSRLRDYPEYM--WFLLYCEGTRFTEKKHQISMQVAESKGLPKLKYHLLPRTKGFTTTLQCLKGTVKAVYDVTLNFKDKQN-----PTLLGIVNGKKYKADLSVRRFSVEEIP-DDEKECADWLHKLYQEKDALQEYYEKEGCYPGPT--IIPKR 303          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 191.815 bits (486), Expect = 4.348e-57
Identity = 107/306 (34.97%), Postives = 168/306 (54.90%), Query Frame = 1
Query:   40 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNF 957
            MI   L ++LK   L H+++   F++SG  ++ L+ + +  LW  N+ L  KI   L Y I  Q   + +WW   +  LY + E+ +  G ENA++++NH ++ID++ GW   E++G LG +    K+ L  +P++GW+W +   +F KR W +D+ T+  S  +L D+P  +    LL+ EGTRFT++K K S ++A  K +  L   LLPR KGF   V  +R  V  +YD TL F    NNE    T+  VLN     A L  RR  ++ +P   + E A WL+ L+ +KD    ++ Q G F
Sbjct:    1 MIRMGLLKVLKTQLLCHLIICYVFLVSGI-IINLLQLCTLPLWPINKQLARKINCRLGYSIASQLVALLEWWSGTECTLYTDPESFRLYGKENAIVVLNHNFEIDFMTGWTFCERFGVLGSSKVLAKKELSFVPVIGWMWYFLEIVFCKRKWEEDRKTVVQSLRNLQDYPEFF--WFLLHCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFCVTVQNLRGKVTAVYDSTLNF---RNNEM--PTLLGVLNGKKYHADLYVRRIPLDSIP-EDESECAAWLHKLYQEKDEFQEHYRQTGRF 297          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 191.815 bits (486), Expect = 8.414e-57
Identity = 107/306 (34.97%), Postives = 168/306 (54.90%), Query Frame = 1
Query:   40 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNF 957
            MI   L ++LK   L H+++   F++SG  ++ L+ + +  LW  N+ L  KI   L Y I  Q   + +WW   +  LY + E+ +  G ENA++++NH ++ID++ GW   E++G LG +    K+ L  +P++GW+W +   +F KR W +D+ T+  S  +L D+P  +    LL+ EGTRFT++K K S ++A  K +  L   LLPR KGF   V  +R  V  +YD TL F    NNE    T+  VLN     A L  RR  ++ +P   + E A WL+ L+ +KD    ++ Q G F
Sbjct:    1 MIRMGLLKVLKTQLLCHLIICYVFLVSGI-IINLLQLCTLPLWPINKQLARKINCRLGYSIASQLVALLEWWSGTECTLYTDPESFRLYGKENAIVVLNHNFEIDFMTGWTFCERFGVLGSSKVLAKKELSFVPVIGWMWYFLEIVFCKRKWEEDRKTVVQSLRNLQDYPEFF--WFLLHCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFCVTVQNLRGKVTAVYDSTLNF---RNNE--MPTLLGVLNGKKYHADLYVRRIPLDSIP-EDESECAAWLHKLYQEKDEFQEHYRQTGRF 297          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2765])

HSP 1 Score: 150.984 bits (380), Expect = 5.658e-43
Identity = 74/218 (33.94%), Postives = 121/218 (55.50%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNN 720
            LK  F+  +L+   FV+SG  ++    + +  LW +++ LY +I   L Y +W Q   + +WW   +  LY +   V   G E+ +II+NH +++D+L GW + E+YG LG +    K  L  +P++GW W +   +F KR W +D+ T+ +  + L D+P       LLY EGTRFT++K + S ++A SK +  L   LLPR KGF   +  ++  
Sbjct:    7 LKSLFVLQLLIGFVFVVSGL-IINFTQLCTCVLWPFDKQLYRRINTRLSYSLWSQLVMLLEWWSGTECTLYTDQATVDKFGKEHVIIILNHNFEVDFLCGWTICERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRKWEEDRDTVFSGLSRLRDYPEYM--WFLLYCEGTRFTEKKHQISMQVAESKGLPKLKYHLLPRTKGFTTTLQCLKGT 221          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 89.3521 bits (220), Expect = 4.039e-19
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  301 YLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNL-EEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
            ++  E ++IIMNH+  +DW+  W    +Y  L      +K +LK +P  GW  +    IF++R W  D+  +SN            Q  LLL+PEGT  T+     S++ A    ++     L PR  GF  IV  +R  +N+  ++D+T+A+P     +N   T  ++L      E H   +R+ +  +P  +   L  W    + +K+     F
Sbjct:   73 FIPGERSVIIMNHRTRLDWMFLWCCLLRYSYLRQEKICLKAALKSVPGFGWAMQVASFIFIQRRWEDDRTHMSNMLQYFCRIREPVQ--LLLFPEGTDLTENTRARSDEFAEKNGLQKYEYVLHPRTTGFTFIVDTLRGGDNLDAVHDITVAYP-----QNIPQTERHLLAGVFPREIHFHVQRFTVASVPAGA-AGLQAWCQERWREKERRLQRF 280          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Match: c19orf44 (chromosome 19 open reading frame 44 [Source:Xenbase;Acc:XB-GENE-5854937])

HSP 1 Score: 169.859 bits (429), Expect = 1.686e-48
Identity = 107/359 (29.81%), Postives = 180/359 (50.14%), Query Frame = 1
Query:  121 GTCMLPLMMITSFCLWKYNRSLYHKIIYHLC-----YVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            G+   P   +T     K + +L    I  LC      ++  +   + +WW   +  L+ + E + + G E+ +II+NH Y+ID+L GW M E+YG LG +    K+ L  +P++GW W +   +F KR W +D+  +     +L D+P       LLY EGTRFT+ K K S ++A  K +  L + LLPR +GF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +E++P   +++ A WL+ L+ +KD+    ++Q G F   +  V  +R   ++        ++S LF F      + S  +I+ F+  +      V  +I +T+ E GS+YG
Sbjct:    4 GSGPAPSPGVTGMVQSKSSMTLTLSYINVLCGNIMSPLVPAELVMLLEWWSGTQCTLFTDQETIDHFGKEHVIIILNHNYEIDFLCGWTMCERYGVLGSSKVLAKKELLMVPLIGWTWYFLEIVFCKRKWEEDRDMVIQGLRNLRDYPEYM--WFLLYCEGTRFTETKHKISMEVADKKGLARLKHHLLPRTRGFTTAVQCLRGTVSAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEEIP-EDEQKAADWLHKLYQEKDALQEQYIQEGTF-PGTQIVPPRRPWTLLNFLFWATLLLSPLFSFAIGIFASGSPLLILSFMGFMWTASFAVRRLIGVTEIERGSSYG 353          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Match: ENSXETT00000021892.1 (1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like [Source:NCBI gene;Acc:108647603])

HSP 1 Score: 119.013 bits (297), Expect = 5.920e-31
Identity = 68/189 (35.98%), Postives = 109/189 (57.67%), Query Frame = 1
Query:  364 GWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDF 930
            G Q+  + G    +    K+ L ++P++GW+W +   +F KR W +D+ T+    ++L D+P ++    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +E++P   ++E A WL+ L+ +K S F
Sbjct:    9 GTQLYFKVGHTRSSKVLAKKELSYVPVIGWMWYFLEIVFCKRKWEEDRKTVIQGLHNLRDYPEHF--WFLIHCEGTRFTEKKHEISMQVAEAKGLPKLKHHLLPRTKGFAVTVQSLRNVVSAVYDSTLNF---RNNEN--PTLLGVLNGKKYHADLCVRRIPLEEIP-EDEQECASWLHKLYQEKVSIF 189          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Match: ENSXETT00000021896.1 (1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like [Source:NCBI gene;Acc:108647603])

HSP 1 Score: 118.242 bits (295), Expect = 1.129e-30
Identity = 67/186 (36.02%), Postives = 108/186 (58.06%), Query Frame = 1
Query:  385 YGCL----GGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDF 930
            +GC+      +    K+ L ++P++GW+W +   +F KR W +D+ T+    ++L D+P ++    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +E++P   ++E A WL+ L+ +K S F
Sbjct:   17 FGCIKPPYNSSKVLAKKELSYVPVIGWMWYFLEIVFCKRKWEEDRKTVIQGLHNLRDYPEHF--WFLIHCEGTRFTEKKHEISMQVAEAKGLPKLKHHLLPRTKGFAVTVQSLRNVVSAVYDSTLNF---RNNEN--PTLLGVLNGKKYHADLCVRRIPLEEIP-EDEQECASWLHKLYQEKVSIF 194          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Match: ENSXETT00000035309.1 (1-acyl-sn-glycerol-3-phosphate acyltransferase delta-like [Source:NCBI gene;Acc:108647603])

HSP 1 Score: 117.857 bits (294), Expect = 3.410e-30
Identity = 65/173 (37.57%), Postives = 103/173 (59.54%), Query Frame = 1
Query:  412 FVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDF 930
              K+ L ++P++GW+W +   +F KR W +D+ T+    ++L D+P ++    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +E++P   ++E A WL+ L+ +K S F
Sbjct:   59 LAKKELSYVPVIGWMWYFLEIVFCKRKWEEDRKTVIQGLHNLRDYPEHF--WFLIHCEGTRFTEKKHEISMQVAEAKGLPKLKHHLLPRTKGFAVTVQSLRNVVSAVYDSTLNF---RNNEN--PTLLGVLNGKKYHADLCVRRIPLEEIP-EDEQECASWLHKLYQEKVSIF 223          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Match: ENSXETT00000043906.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:42713660:42753341:-1 gene:ENSXETG00000010378.1 transcript:ENSXETT00000043906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.531e-29
Identity = 102/374 (27.27%), Postives = 183/374 (48.93%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAI-FLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISL-LFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  FL H+ +   F+ +G  ++  + + +  +W +N+ LY KI   L Y I  Q   + +WW      LY + EN    G ENA++++NH ++ID+L GW   E++G LG T   ++++ KH+ +   + + N  I  LK+   + K T++         P    + ++ + E  +   + +KS  +  +SK    L++    R   F  I   +   V  +YD TL F    NNEN   T+  VLN     A L  RR  +E++P   ++E A WL+ L+ +KD+    + + G +  ++  V+  R    ++      +++S  LF  +   + + S+  I +F   + +  +    MIR+T+ + GSAYG
Sbjct:    7 LKSQFLCHLFISYVFIGTGL-IVNFIQLCTLIVWPFNKQLYRKINCRLAYCISSQLVMLLEWWSNTDCTLYTDPENYTKYGKENAIVVLNHNFEIDFLCGWNFCERFGVLGVTSNILQKAQKHL-LNERVRQINFTIEALKQKIEQLKQTLTK------QLPDVTLERVVQFIEHAQMA-QHIKSKER-QISK-FTSLLSRFDSRRCAFFAISFQLVFPVSAVYDSTLNF---RNNEN--PTLLGVLNGKKYHADLCVRRIPLEEIP-EDEQECASWLHKLYQEKDAFQEEYYKTGAYPGTA--VVPPRRPWTLINWIFWASLLSYPLFKVLANMISSGSYFTISVFALLMVIVSVGARRMIRVTEIDRGSAYG 361          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Match: Agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:MGI Symbol;Acc:MGI:1915512])

HSP 1 Score: 203.371 bits (516), Expect = 3.207e-61
Identity = 120/373 (32.17%), Postives = 204/373 (54.69%), Query Frame = 1
Query:   64 ILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            +LK  FL H++    F+ SG  ++  + + +  +W  N+ L+ KI   LCY +  Q   + +WW   +  +Y + +   + G ENA++++NHK++ID+L GW +AE+ G LG +    K+ L ++PI+GW+W +   IF  R W +D+ T++ S   L D+P  Y  L L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V  +R+ V  +YD TL F    NNEN   T+  VLN     A    RR  +ED+P   +++ + WL+ L+ +KD+    + + G F + + +V  +R   +V        ++   F F+ + V + S   +   +    +  + V  MI +T+ + GSAYG
Sbjct:    6 LLKSQFLCHLVFCYVFIASGL-IVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKACPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKY--LFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADCYVRRIPMEDIP-EDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPE-TPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Match: Agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:MGI Symbol;Acc:MGI:1336186])

HSP 1 Score: 202.216 bits (513), Expect = 9.699e-61
Identity = 123/373 (32.98%), Postives = 195/373 (52.28%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE-ELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++    + +  LW  ++ LY +I   L Y +W Q   + +WW   +  L+ +   V + G E+ ++I+NH ++ID+L GW M E++G LG +    K  L  +P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A SK + PL   LLPR KGF   V  +R  V  IYD+TL F       N   ++  +L     EA +  RR+ +ED+P  +DE   AQWL+ L+ +KD+    + Q G F     F   +R   ++        ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVVHLLIGFVFVVSGL-IINFTQLCTLALWPISKHLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDHFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLADYPEYM--WFLLYCEGTRFTETKHRISMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIP--ADETSAAQWLHKLYQEKDALQEMYKQKGVF-PGEQFKPARRPWTLLNFLCWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Match: Agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:MGI Symbol;Acc:MGI:1336186])

HSP 1 Score: 202.216 bits (513), Expect = 9.699e-61
Identity = 123/373 (32.98%), Postives = 195/373 (52.28%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE-ELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++    + +  LW  ++ LY +I   L Y +W Q   + +WW   +  L+ +   V + G E+ ++I+NH ++ID+L GW M E++G LG +    K  L  +P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A SK + PL   LLPR KGF   V  +R  V  IYD+TL F       N   ++  +L     EA +  RR+ +ED+P  +DE   AQWL+ L+ +KD+    + Q G F     F   +R   ++        ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVVHLLIGFVFVVSGL-IINFTQLCTLALWPISKHLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDHFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLADYPEYM--WFLLYCEGTRFTETKHRISMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIP--ADETSAAQWLHKLYQEKDALQEMYKQKGVF-PGEQFKPARRPWTLLNFLCWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Match: Agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:MGI Symbol;Acc:MGI:1336186])

HSP 1 Score: 202.216 bits (513), Expect = 9.699e-61
Identity = 123/373 (32.98%), Postives = 195/373 (52.28%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE-ELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++    + +  LW  ++ LY +I   L Y +W Q   + +WW   +  L+ +   V + G E+ ++I+NH ++ID+L GW M E++G LG +    K  L  +P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A SK + PL   LLPR KGF   V  +R  V  IYD+TL F       N   ++  +L     EA +  RR+ +ED+P  +DE   AQWL+ L+ +KD+    + Q G F     F   +R   ++        ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVVHLLIGFVFVVSGL-IINFTQLCTLALWPISKHLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDHFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLADYPEYM--WFLLYCEGTRFTETKHRISMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIP--ADETSAAQWLHKLYQEKDALQEMYKQKGVF-PGEQFKPARRPWTLLNFLCWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Match: Agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:MGI Symbol;Acc:MGI:1336186])

HSP 1 Score: 202.216 bits (513), Expect = 9.699e-61
Identity = 123/373 (32.98%), Postives = 195/373 (52.28%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDE-ELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++    + +  LW  ++ LY +I   L Y +W Q   + +WW   +  L+ +   V + G E+ ++I+NH ++ID+L GW M E++G LG +    K  L  +P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A SK + PL   LLPR KGF   V  +R  V  IYD+TL F       N   ++  +L     EA +  RR+ +ED+P  +DE   AQWL+ L+ +KD+    + Q G F     F   +R   ++        ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVVHLLIGFVFVVSGL-IINFTQLCTLALWPISKHLYRRINCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVDHFGKEHVVVILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYFLEIVFCKRKWEEDRDTVIEGLRRLADYPEYM--WFLLYCEGTRFTETKHRISMEVAASKGLPPLKYHLLPRTKGFTTAVQCLRGTVAAIYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIP--ADETSAAQWLHKLYQEKDALQEMYKQKGVF-PGEQFKPARRPWTLLNFLCWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Match: sp|Q9NRZ5|PLCD_HUMAN (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Homo sapiens OX=9606 GN=AGPAT4 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 7.862e-64
Identity = 126/378 (33.33%), Postives = 207/378 (54.76%), Query Frame = 1
Query:   55 LPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFT--DMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            L  +LK  FL H++    F+ SG  +  + + T   LW  N+ L+ KI   L Y I  Q   + +WW   +  ++ +       G ENA++++NHK++ID+L GW ++E++G LGG+    K+ L ++PI+GW+W +   +F  R W +D+ T++ S   L D+P  Y    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +ED+P   D+E + WL+ L+ +KD+    + + G F ++     ++ +T  + +   SL   V+   F F+ + + + S   +  FI    +  + V  MI +T+ + GSAYG
Sbjct:    3 LAGLLKSQFLCHLVFCYVFIASGLIINTIQLFT-LLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKY--FFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADLYVRRIPLEDIP-EDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASL---VLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Match: sp|Q5R757|PLCD_PONAB (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Pongo abelii OX=9601 GN=AGPAT4 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 8.293e-64
Identity = 126/378 (33.33%), Postives = 207/378 (54.76%), Query Frame = 1
Query:   55 LPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFT--DMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            L  +LK  FL H++    F+ SG  +  + + T   LW  N+ L+ KI   L Y I  Q   + +WW   +  ++ +       G ENA++++NHK++ID+L GW ++E++G LGG+    K+ L ++PI+GW+W +   +F  R W +D+ T++ S   L D+P  Y    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +ED+P   D+E + WL+ L+ +KD+    + + G F ++     ++ +T  + +   SL   V+   F F+ + + + S   +  FI    +  + V  MI +T+ + GSAYG
Sbjct:    3 LAGLLKSQFLCHLVFCYVFIASGLIINTIQLFT-LLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKY--FFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADLYVRRIPLEDIP-EDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASL---VLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Match: sp|Q5E9R2|PLCD_BOVIN (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Bos taurus OX=9913 GN=AGPAT4 PE=2 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 3.574e-63
Identity = 125/378 (33.07%), Postives = 207/378 (54.76%), Query Frame = 1
Query:   55 LPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISL--LFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            L  +LK  FL H++    F++SG  ++  + + +  LW  N+ L+ KI   L Y +  Q   + +WW   +  +Y +       G ENA++++NHK++ID+L GW +AE++G LGG+    K+ L ++PI+GW+W +   +F  R W +D+ T+S S   L D+P  Y    L++ EGTRFT++K + S ++A +K +  L + LLPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +E++P   +++ A WL+ L+ +KD+    + + G F ++     ++ +T   +   L  A + L   F F+   V + S   +  F+    +  + V  MI +T+ + GSAYG
Sbjct:    3 LVALLKSHFLCHLIFCYVFIVSGL-IINTIQLCTLLLWPVNKQLFRKINCRLSYCVSSQLVMLLEWWSGTECVIYTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLAERFGVLGGSKVLAKKELAYVPIIGWMWYFTEMVFCTRKWEQDRKTVSESLLHLRDYPEKY--FFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAVTVRSLRNVVSAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADLYVRRIPLEEVP-EEEDKCAAWLHKLYQEKDAFQEEYSRTGTFPETPVVPPRRPWT---LVNWLFWASMLLYPFFRFVINMVSSGSSLTLASFVLVFFVASMGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Match: sp|Q4R581|PLCD_MACFA (1-acyl-sn-glycerol-3-phosphate acyltransferase delta OS=Macaca fascicularis OX=9541 GN=AGPAT4 PE=2 SV=1)

HSP 1 Score: 208.764 bits (530), Expect = 1.945e-62
Identity = 124/378 (32.80%), Postives = 205/378 (54.23%), Query Frame = 1
Query:   55 LPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFT--DMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            L  +LK  FL H++    F+ SG  +  + + T   LW  N+ L+ KI   L Y I  Q   + +WW   +  ++ +       G ENA++++NHK++ID+L GW ++E++G LGG+    K+ L ++PI+GW+W +   +F  R W +D+ T++ S   L D+P  Y    L++ EGTRFT++K + S ++A +K +  L +  LPR KGF   V ++RN V  +YD TL F    NNEN   T+  VLN     A L  RR  +ED+P   D+  + WL+ L+ +KD+    + + G F ++     ++ +T  + +   SL   V+   F F+ + + + S   +  FI    +  + V  MI +T+ + GSAYG
Sbjct:    3 LAGLLKSQFLCHLVFCYVFIASGLIINTVQLFT-LLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKY--FFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHPLPRTKGFAITVRSLRNVVSAVYDCTLNF---RNNEN--PTLLGVLNGKKYHADLYVRRIPLEDIP-EDDDRCSAWLHKLYQEKDAFQEEYYRTGTFPETPMVPPRRPWTLVNWLFWASL---VLYPFFQFLVSMIRSGSSLTLASFILVFFVASMGVRWMIGVTEIDKGSAYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Match: sp|Q9NRZ7|PLCC_HUMAN (1-acyl-sn-glycerol-3-phosphate acyltransferase gamma OS=Homo sapiens OX=9606 GN=AGPAT3 PE=1 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.802e-61
Identity = 122/372 (32.80%), Postives = 200/372 (53.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+ H+L+   FV+SG  ++  + + +  LW  ++ LY ++   L Y +W Q   + +WW   +  L+ +   V+  G E+A+II+NH ++ID+L GW M E++G LG +    K+ L ++P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT+ K + S ++A +K +  L   LLPR KGF   V  +R  V  +YD+TL F       N   ++  +L     EA +  RR+ +ED+PL  ++E AQWL+ L+ +KD+    + Q G F     F   +R   ++   S    ++S LF F+     + S  +I+ F+  +G     V  +I +T+ E GS+YG
Sbjct:    7 LKTQFVLHLLVGFVFVVSGL-VINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLEIVFCKRKWEEDRDTVVEGLRRLSDYPEYM--WFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNF-----RGNKNPSLLGILYGKKYEADMCVRRFPLEDIPL-DEKEAAQWLHKLYQEKDALQEIYNQKGMF-PGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASFGVRRLIGVTEIEKGSSYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Match: A0A2C9JL80 (PlsC domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106058685 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.070e-82
Identity = 146/373 (39.14%), Postives = 208/373 (55.76%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYGK 1185
            LK T +  +LL   FV+SG  +   +M+ S  +W +NR LY KI  HL Y  W QFTF+ QWW   K+ LY  DE+VKY+G E+ L IMNHK+DIDWL+ W +AE+   LG T  + KE LK++P++GW W +  +IFLKR W  DK  I +      D+P  Y   LLL+PEGTRFT+EK K+S ++  +K    L + LLPR KGFI  +H +R     I + T+AF    +      T+ N+L      AH    R  ++ +P+ SDE  AQWL  LF +KD  +  FL    F    +  I KR  D+++     +     LFY++ +  +  ++   II I    +   +V LMI +T+   GS YG+
Sbjct:    7 LKGTLVSQLLLGYIFVMSGLAVT-FLMLCSCVIWPFNRHLYRKINVHLAYAHWSQFTFLGQWWAGCKVILYASDEDVKYIGKEHILTIMNHKFDIDWLMAWILAERLQMLGNTKIYGKEILKYVPLIGWAWYFTESIFLKRQWDHDKRVIEHDLKQATDYPEGYYVTLLLFPEGTRFTEEKQKASEEVCRAKGYPILKHVLLPRPKGFIITIHGLRGQFPTILNCTVAF----SKNGPAPTLMNILQGKPMLAHFYAERIPLDSVPIDSDEACAQWLRELFKKKDDMYEEFLNTETF-PGPTHNIPKRINDLLMWSFWAVVTCVPLFYYLGSLFIAGTFTQQIIAIVVGIILTFVVRLMIGVTEIHKGSEYGR 373          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Match: R7UVU9 (PlsC domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_20972 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 3.528e-82
Identity = 146/376 (38.83%), Postives = 229/376 (60.90%), Query Frame = 1
Query:   67 LKKTFL-FHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIED-ENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTET-GSAYGK 1185
            +K  FL  H+L+   FV+SG  +  LM +T   +W +NR LY KI+ +L Y  WCQFTF+ QWW      L++++ +++KY+G E+ + +MNHKYDIDWL+ W ++E++  LGGT  + K SLK +P++GW W +  +IFLKR+W KDK  IS     + D+P  Y   LLL+ EGTRFTD+K K+S ++A +K +  L + LLPR +GFI  VH ++  V  I DLT+AF      + AE T+ NVL     +A +  RR  ++ +P ++D+E A W+  +F +KD  ++ F + G F +     I  R  DMVV     + +   L+Y+I + ++  S+  +   I  I +  +I+ LMI +++ ++ GS+YGK
Sbjct:    8 MKANFLPLHILIGYVFVVSGLIVCGLMALTYLLVWPWNRQLYRKIVMNLAYTHWCQFTFLGQWWAGCNCTLHLDNKDDLKYIGHEHVVALMNHKYDIDWLMAWLLSERFAMLGGTKIYGKSSLKMVPLIGWAWTFTESIFLKRNWDKDKEIISRDLAYIRDYPDGYSITLLLFCEGTRFTDDKHKASMEVAKAKGLPLLKHHLLPRTRGFIHTVHGLKGKVPAILDLTVAF----RKDGAEPTLMNVLQGRACKAEMYCRRIPLDSVPTNTDQECADWVQKVFREKDEVYDDFYRNGKFTRGVKTEIPLRVNDMVVWFMWTIVLCVPLYYYIVSLIMTGSYATLFWAIVIIAVFAIILRLMIAVSEIKSHGSSYGK 379          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Match: A0A2T7P6U9 (PlsC domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11752 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 4.742e-81
Identity = 143/374 (38.24%), Postives = 215/374 (57.49%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
             IL+   +  +LL   F++SG  ++  +M+ S  LW  NR LY KI  +L Y  WCQ TF+AQWW   ++ LYI+ E+ K +G E+ L++MNHKYDIDWL+ W +AE++G LGGT  + K+ LK++P++GW W +  +IFLKR W  D+  IS     + D+P  Y    LL+PEGTRFT+EKL++S ++  +K      + LLPR KGFI  VH +R  V  +Y+ T+ FP    +   E  + N++      AH    R   ED+P+ SDE  ++WL   F +KD  ++ F + G F       I +R TD+++     +     LFY+I    +  +    IIFI  +      + L+I +T+T+ GSAYG
Sbjct:    5 RILQGMIVPQLLLGYIFIVSG-LIVNFLMLLSCILWPINRHLYRKINVNLAYSHWCQLTFLAQWWSGSEVLLYIDKEDKKKVGKEHVLVLMNHKYDIDWLMAWVLAERFGMLGGTKIYGKQELKYVPLIGWAWYFTESIFLKRQWEHDRRIISEYLKQITDYPDGYWVTALLFPEGTRFTEEKLRASQEVCRAKGYPLTKHTLLPRTKGFILSVHGMRGKVPALYNCTVGFP----SNGPEPNLMNIVKGVPLLAHFHTERIPFEDIPVDSDEACSEWLRASFQKKDELYDNFKKNGKF-DGEPCTIPRRITDLLMWAFWAVLTCVPLFYYIGQLFVLGTLTQRIIFIAFVAAVCFGMRLLIAVTETKKGSAYG 372          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Match: A0A1S3H6K2 (1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152559 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 1.671e-77
Identity = 139/372 (37.37%), Postives = 221/372 (59.41%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYG 1182
            +K  F+ H+L+   F++SG  ++  +M  +  +W +++++Y K+  +L Y IW Q+TF+ QWW    I L    E+VKY G E+A+II+NHKYDIDWL+G+ +AE+ G LGG+  + KE LK +PI GW W +  ++FLKR+W +D+  I     +L +FP NY   +L++ EGTRFT+ K K+S K+A  K +  L + LLPR KGF+  +  ++  +  IYD T+    SEN    E T  NV+N    +A L  RR  +E++P  +DEE + WL+ L+ +KD  ++ FL+ G+F   +   I KR  D++V     + +   L Y++   + + S  +    +  I    ++V  MI +T+TE GS YG
Sbjct:    7 IKTWFVLHLLMGYIFILSG-LIVNCIMFCTLIIWPFSKTIYRKVNCYLAYWIWSQYTFLGQWWSGSDIVLKTNPEDVKYYGKEHAIIILNHKYDIDWLLGYFLAERLGILGGSKVYGKEMLKFVPIQGWSWYFTESVFLKRNWEQDRKIIIRDIKNLAEFPVNYWVTILMFCEGTRFTEAKHKASMKVAKEKGLPELKHHLLPRTKGFVLTMQGLKGKIPAIYDCTVGITKSEN----EPTFMNVVNGKTFKAELKVRRITLEEIPTDTDEECSAWLHKLYQEKDEFYDGFLKKGHF-DGALIEIPKRPWDLLVWLFWAVTLGVPLIYYLIQVLWSGSIYVSGCVVLVIVFGSVMVRWMIAVTETERGSKYG 372          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Match: A0A0L8HTH6 (PlsC domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006395mg PE=4 SV=1)

HSP 1 Score: 253.832 bits (647), Expect = 2.887e-77
Identity = 126/316 (39.87%), Postives = 193/316 (61.08%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISG--TCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVV 1008
            +K   + H L     ++SG  TC L   M  +  LW  N+ LY K+  +L Y+ WCQFTF+ QWW   +  LYIE  +++Y+G E+AL+IMNHKYDIDWL+GW + E++G LGG+  + K+ LK+IPILGWIW +  +IFL+R+W +D+ T+ +   ++  FP +    +LL+ EGTRFT+EK + S ++A  K    L + LLPR KGF+  + A++  +  IYD T+AF      + AE T+ N+L+  +  A +  RR  I+ +P +  +E A WL+ L+ +KD  F+ F   G F       I +R+ D++V
Sbjct:    8 MKTWSILHFLFCYILLVSGFITCFL---MALTLVLWPLNKDLYRKVNSYLAYLWWCQFTFLGQWWSGTECVLYIEPSDLQYIGKEHALVIMNHKYDIDWLMGWILTERFGMLGGSKIYGKKFLKYIPILGWIWYFTESIFLERNWDQDQKTLVHDIQEIASFPQDVCITILLFCEGTRFTEEKHRISMEVAEKKGFPHLKHHLLPRTKGFVLSLQAMKGKIPAIYDCTVAF----RKDGAEPTLRNILHGRMCRAEMYVRRIPIDTVPYNDSKECANWLHKLYQEKDKLFDQFTMLGRFSGVQKRTIPRRYWDLIV 316          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Cavefish
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:NCBI gene;Acc:103047807])

HSP 1 Score: 196.438 bits (498), Expect = 1.424e-58
Identity = 104/308 (33.77%), Postives = 169/308 (54.87%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKR 990
            LK  F+  +L+   FV+SG  ++  + + S  +W +N+ LY K    + Y +W Q   + +WW      LY +   V   G E+ +II+NH ++ID+L GW M E+YG LG +    K  L  +P++GW W +   +F KR W +D+ T+    + L D+P       LLY EGTRFT++K + S ++A SK +  L   LLPR KGF   +  ++  VK +YD+TL F   EN      T+  +++    +A +  RR+ +ED+P   ++E A WL+ L+ +KD+   Y+ + G +   +  +I KR
Sbjct:    7 LKSQFILQLLIGFVFVVSG-LIINFIQLCSCVIWPFNKQLYRKFNTRMSYSLWSQLVMLLEWWSGTDCTLYTDQATVDMFGKEHVIIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKHELLKVPLIGWTWYFLEIVFCKRKWEEDRDTVFKGLHQLRDYPEYM--WFLLYCEGTRFTEKKHQISMQVAESKGLPKLKYHLLPRTKGFTTTMQCLKGTVKAVYDVTLNFKDKEN-----PTLLGLVSGKKYKADMSVRRFPVEDIP-DDEKECADWLHNLYREKDALQEYYEKEGKYPGPT--IIPKR 303          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Cavefish
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Source:ZFIN;Acc:ZDB-GENE-040426-1924])

HSP 1 Score: 194.512 bits (493), Expect = 5.089e-58
Identity = 102/299 (34.11%), Postives = 162/299 (54.18%), Query Frame = 1
Query:   61 EILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNF 957
             +LK  FL H+++   F++SG  ++  + + +  LW  N+ L  ++   L Y I  Q   + +WW   +  LY + E+ K  G ENA++I+NH +++D+L GW   E++G LG +    K+ L ++P++GW+W +   +F KR W +D+ T++ S   L D+P N+    LLY EGTRFT++K K S ++A  K +  L   LLPR KGF      +R  V  +YD TL F       N   T+  +LN     A L  RR  ++ +P   + E A WL+ L+ +KD     + Q G F
Sbjct:    5 RLLKTQFLCHLIICYVFLVSGI-IINFLQLCTLPLWGINKQLARRVNCRLAYCISSQMVAMLEWWSGTECSLYTDPESYKLYGKENAIVILNHNFEVDFLCGWTFCERFGVLGSSKVLAKQELAYMPVIGWMWYFLEIVFCKRKWEEDRRTVAQSLQRLQDYPENF--WFLLYCEGTRFTEKKHKISMEVAEKKGLPKLKYHLLPRTKGFCVTAQNLRGKVTAVYDSTLNF-----RNNQTPTLLGMLNGKKYHADLYVRRIPLDSVP-EDESECAAWLHKLYQEKDEFQEQYSQTGRF 294          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Cavefish
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 97.4413 bits (241), Expect = 4.189e-22
Identity = 63/194 (32.47%), Postives = 94/194 (48.45%), Query Frame = 1
Query:  301 YLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIR--NNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSD 876
            ++  E ++IIMNH+  +DW+  W    +Y  L      +K +LK +P  GW  +    IF++R W +D+  ++N      D     Q  LLL+PEGT  TD     S+  A    +      L PR  GF  IV  +R  NN+  ++D+T+A+P  +N    E  +  VL     E H   RRY +  LP  SD
Sbjct:   63 FVPGERSVIIMNHRTRLDWMFLWCCLLRYSYLRLEKICLKAALKAVPGFGWAMQVASFIFIQRKWEEDRSHMANMLEYFCDIREPLQ--LLLFPEGTDLTDNTRARSDDFAEKNGLPKYEYVLHPRTTGFTFIVDTLRKGNNLDAVHDITVAYP--KNIPQTERHL--VLGLFPREIHFHVRRYPLSVLPKQSD 250          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Cavefish
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 [Source:NCBI gene;Acc:103034858])

HSP 1 Score: 81.2629 bits (199), Expect = 1.523e-16
Identity = 62/279 (22.22%), Postives = 121/279 (43.37%), Query Frame = 1
Query:  184 LYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDE---KLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFP---ISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDM 1002
            LYH++  ++  V      F  + +  ++I +Y +    K    EN + + NH+   DW+I   +A +   LG     +K+ LK +P+ GW +  +G +++KR    ++ T+      L          L+++PEGTR+  E    +  S   A  +    L + L PR K     + +++ ++  +YD+T+A+     +        +M   L       H+ F R  + ++P  S     +WL+  F  KD     F +    ++   F  + R + +
Sbjct:   46 LYHRVDDYIYTVYQSMVLFFFENYTGVEIIIYGDIPKKK----ENVVYLSNHQSTADWIIADMLAIRQSALGHVRYVLKDGLKWLPLYGWYFSQHGGVYVKRSARFEEKTMRR--KLLSQTKLGTPMYLVIFPEGTRYNPEYKGVISDSQAFAAKEGFAVLKHILTPRMKASYVAIQSMKEHLDAVYDVTVAYEGTLTAGGQRRTAPSMPEFLCKECPRVHIYFERVDMREIPQES-VFFRRWLHERFEIKDKLLTTFYESDEPEKKCRFPGEGRISPL 317          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Sea Lamprey
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2765])

HSP 1 Score: 187.963 bits (476), Expect = 4.298e-56
Identity = 115/382 (30.10%), Postives = 194/382 (50.79%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYF-IKAFVLNC-SWNXXXXXXX--------XXXXXXXXVYLMIRITKTETGSAYG 1182
            LK  F+  +LL   F+ISG  ++  + + +  LW  +R LY ++   L Y +W Q   + + W   +  L+ E   V   G E+A++++NH Y++D+L GW M E+YG LG +    K  L  +P++GW W +   +F KR W +D+  +    + + D+P       LLY EGTRFT++K + S ++A +K +  L + LLPR KGF   VH +R     +YD+TL F      +N   ++  +L     +A +  RR+ ++DLP   +++ A WLY L+ +KD+    + + G F             + +       AV++ LF+  +  + L C +WNI+              +    L V  +IR+T+ + GS YG
Sbjct:    7 LKTQFICQLLLGYVFLISGF-IINFVQLLTLVLWPIDRQLYRRVNCRLAYSLWSQLVMVLEHWSGTECTLFAEPGTVDQFGKEHAIVVLNHNYEVDFLCGWTMCERYGVLGASKVLAKRELLKVPLIGWTWYFLEIVFCKRRWEEDRQAVLQGLHRIRDYPEYV--WFLLYCEGTRFTEKKHRISMEVAKAKGLPKLKHHLLPRTKGFTTTVHCLRGMAGAVYDVTLNF-----KDNKNPSLLGILYGKKYQADMCVRRFPLKDLP-EDEKKCAMWLYNLYLEKDALQEEYSKTGVFP-----------GECIKPNKRPWAVLNWLFWATLLLYPLGCLAWNILTSGSALAITALLIALTAASLGVRRLIRVTEIDRGSNYG 368          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Sea Lamprey
Match: lclat1 (lysocardiolipin acyltransferase 1 [Source:NCBI gene;Acc:406554])

HSP 1 Score: 89.3521 bits (220), Expect = 6.134e-20
Identity = 62/213 (29.11%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  310 SENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKL-LLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKV--IYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
             E ++IIMNH+  +DW+  W    +   L      +K +LKH+P  GW  +    +F+ R W +D+  I   +  LD F    Q+L LL +PEGT  T      S++ A    +    + L PR  GF  IV  + +  K+  ++D+T+A+P S      +       +    E H   RR+ +  LPL S   LA W    +  K++    F
Sbjct:   77 GERSVIIMNHRTRLDWMFLWNCLLRSSYLRLEKICLKSTLKHVPGFGWAMQVAAFVFIARRWEQDEQHI---ARHLDYFTAIDQRLQLLFFPEGTDLTANTKARSDQFAEKNGLPKYEHVLHPRTTGFTHIVQRLHSGGKLDCVHDVTVAYPCSFPQNELQLLAGRFPH----EIHFHVRRHPVSTLPLDS-AGLAAWCCDRWLDKEAMLRSF 281          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Sea Lamprey
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acid acyltransferase, epsilon) [Source:ZFIN;Acc:ZDB-GENE-060929-914])

HSP 1 Score: 85.5001 bits (210), Expect = 1.058e-18
Identity = 56/216 (25.93%), Postives = 105/216 (48.61%), Query Frame = 1
Query:  313 ENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLK-RDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEK---LKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPIS---ENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKD---SDF 930
            EN + + NH+  +DW++   +A +   LG     +K+ LK +P+ GW +  +G +++K RD   +K         ++     Y   L+++PEGTR+  E    +++S   A  + +  L + L PR +     ++A+ +++  IYD+T+A+  +           +M   L C     H+ F R  I+++P H       WL+  F +KD   +DF
Sbjct:   85 ENVIYLSNHQSTVDWVVADMLAVRQNALGHVRYVLKDGLKWLPLYGWYFSQHGGVYVKRRDHYNEKAIERKLKAQMEAQIPMY---LVIFPEGTRYNPEAANVIEASKAFANKEGLPELSHVLTPRIRATHAALNAMSDHLHAIYDITVAYEGTLDAAGRRKTAPSMPEFLCCESPRVHIHFERIDIQEVP-HEPHFFKLWLHERFEKKDKLMADF 296          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Yeast
Match: CST26 (Acyltransferase; enzyme mainly responsible for the introduction of saturated very long chain fatty acids into neo-synthesized molecules of phosphatidylinositol; required for incorporation of stearic acid into phosphatidylinositol; affects chromosome stability when overexpressed; CST26 has a paralog, YDR018C, that arose from the whole genome duplication [Source:SGD;Acc:S000000246])

HSP 1 Score: 97.0561 bits (240), Expect = 1.028e-22
Identity = 65/250 (26.00%), Postives = 112/250 (44.80%), Query Frame = 1
Query:  316 NALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKL-------------------------------LLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAH-----LLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNF 957
            N++ I NH+   DW+  W +A            +K+SL  IPILG+  R    IF+ R W +DK+T+SNS   LD        L                               L+L+PEGT  + +  + S K A     KP  N LLP + G    +  ++ +++ +YD+T+ +   +  E  E  +  + +  LE  +     +  R + ++D+PL  + E ++WLY ++ +KD+    +   G+F
Sbjct:  105 NSVAICNHQIYTDWIFLWWLAYTSNLGANVFIILKKSLASIPILGFGMRNYNFIFMSRKWAQDKITLSNSLAGLDSNARGAGSLAGKSPERITEEGESIWNPEVIDPKQIHWPYNLILFPEGTNLSADTRQKSAKYAAKIGKKPFKNVLLPHSTGLRYSLQKLKPSIESLYDITIGYSGVKQEEYGE-LIYGLKSIFLEGKYPKLVDIHIRAFDVKDIPLEDENEFSEWLYKIWSEKDALMERYYSTGSF 353          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Yeast
Match: YDR018C_mRNA (Probable membrane protein with three predicted transmembrane domains; similar to C. elegans F55A11.5 and maize 1-acyl-glycerol-3-phosphate acyltransferase; YDR018C has a paralog, CST26, that arose from the whole genome duplication [Source:SGD;Acc:S000002425])

HSP 1 Score: 81.6481 bits (200), Expect = 1.822e-17
Identity = 59/243 (24.28%), Postives = 111/243 (45.68%), Query Frame = 1
Query:  313 ENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNS----------SNDLDDFPHNYQKL--------LLLYPEGTRFTDEKLKSSNKIALSKNMK--PLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNE--NAEATMSNV--LNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSS 969
            + A+II NH+   DW+  W ++      G     +K++L++IP+LG+  R    IFL R+W KD+  ++NS             L ++   Y K         L+++PEGT  + +  + S       ++    L + LLP +KG    V  +  ++  IYD+T+ +  +   E    + T+  +  +    E+     R + + ++PL  DE    WL  ++ +KD     +   G F+ ++
Sbjct:  109 DRAIIIANHQMYADWIYLWWLSFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEKALTNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIREFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQFKSNA 351          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Yeast
Match: SLC1 (1-acyl-sn-glycerol-3-phosphate acyltransferase; catalyzes the acylation of lysophosphatidic acid to form phosphatidic acid, a key intermediate in lipid metabolism; enzymatic activity detected in lipid particles and microsomes [Source:SGD;Acc:S000002210])

HSP 1 Score: 47.7506 bits (112), Expect = 1.430e-6
Identity = 48/155 (30.97%), Postives = 78/155 (50.32%), Query Frame = 1
Query:  181 SLYHKIIYHLCYVIWCQFTFIAQW------WGKLKIRLYIEDENVKYLGSENA-----LIIMNHKYDID-WLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTR-FTDE 606
              Y  I   LC +I  Q   +AQW      +  +K+ L ++   VK +G EN      ++I NH+  +D +++G       GC   T+   K+SLK++P LGW    +G  FL  D +K +  I   +  L++   N ++ L ++PEGTR +T E
Sbjct:   24 GFYGVIASILCTLIGKQH--LAQWITARCFYHVMKLMLGLD---VKVVGEENLAKKPYIMIANHQSTLDIFMLGRIFPP--GC---TV-TAKKSLKYVPFLGWFMALSGTYFL--DRSKRQEAIDTLNKGLENVKKN-KRALWVFPEGTRSYTSE 164          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Match: EDO29842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2H2])

HSP 1 Score: 213.772 bits (543), Expect = 1.428e-65
Identity = 108/303 (35.64%), Postives = 179/303 (59.08%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSF 975
            LKK     +  ++ F+I+G  ++ ++ +    LW +N++LY  I  H+ Y+ W Q TF+  WW +  +RLY  +E+ +Y G E+A+ + NH+ D+DWLIGW MA++   LG T  ++K  LK++PI+G+ W  +   F+ R+W KD+  + NS + L DFP+ +   + ++ EGTR T EKL++S + A SKN+  L + LLPR +GF   V  +++ V  +YD+ +AF      E    TM  +L     E HLL RR  ++D+P+ + E  ++W   LF +KD   +Y+L  G +++   F
Sbjct:    8 LKKLPFIPLWFVMVFLITG-MIINIIQVAILPLWTFNKTLYRWINMHVVYLHWSQLTFLVDWWSETDLRLYGNEEDFRYFGKESAICVANHRSDVDWLIGWVMADRVDTLGTTKCYMKGYLKYLPIMGFSWLSSEYAFVSRNWQKDQRVLQNSLDTLQDFPYPF--WIAIFAEGTRLTQEKLQASIEYARSKNIPELQHHLLPRPRGFSITVQHLKDKVSAVYDMEVAF-----VEGKYPTMKGLLLGVKYEIHLLIRRIPVKDIPMETIEVTSKWCQKLFQEKDKAMSYYLANGRYEEPLVF 302          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Match: EDO40659 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J2])

HSP 1 Score: 92.8189 bits (229), Expect = 8.097e-21
Identity = 61/214 (28.50%), Postives = 103/214 (48.13%), Query Frame = 1
Query:  310 SENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVK---VIYDLTLAFPISENNENAEATMSNVLNCNL-EEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
             + +LIIMNH+   DW+  W +  +YG L      +K+ L+ IP +GW  +    IFL+R W +D+  ++   +   D   NY   L+++PEGT   D     S+  A   N+      L PR +GF+  V  +R+  +    I+D+T+A+     + N   T  +++  +   E H   +RY I ++P    EEL  W    + +K+     F
Sbjct:   78 GDTSLIIMNHRCHFDWMFYWSVLVRYGNLQYLRIIMKDVLRRIPGIGWGMQQAMYIFLRRRWEQDEGYLNTILDYFKDL--NYPLQLMIFPEGTNLEDRSRVHSDSFARKNNLPIYEYVLHPRVRGFVHCVEKLRHGPRRMDAIHDVTIAY-----DRNYCFTEKDIILGDFPREIHFHIKRYPISEIPTDV-EELEVWCQKRWLEKEDRLKLF 283          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Match: EDO36141 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJL6])

HSP 1 Score: 85.8853 bits (211), Expect = 6.509e-19
Identity = 54/203 (26.60%), Postives = 102/203 (50.25%), Query Frame = 1
Query:  349 IDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFT---DEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFP-ISEN--NENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
            +DWL+   +A + G LG     +K+ LK +P+ G+ +  +G I+++R   +D   I    + L    +N    L+++PEGTR+     E ++ S   A  + +  L + L PR K     + A+ + +  +YD+T+A+  ++EN     A   M + L    ++ H+   RY  E +P  ++E+   W++  F +KD   + F
Sbjct:   16 VDWLVADLLAIRQGSLGRIRYILKDGLKFLPLYGFYFGQHGGIYVRRSGPRDHYHIIRKLDQLKK--NNTPMWLVIFPEGTRYNIDRPESIEKSKAFAEGEGLPVLQHVLTPRTKATEASLEAVGDYIDAVYDVTIAYKGVTENPLPRTAAKGMPDFLASWGQQVHIYCHRYTPEQIP-KNEEDRRTWVHKCFVEKDQILSRF 215          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Match: EDO35690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKS7])

HSP 1 Score: 82.0333 bits (201), Expect = 2.764e-17
Identity = 59/230 (25.65%), Postives = 110/230 (47.83%), Query Frame = 1
Query:  268 IRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAI-RNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGN 954
            +++YI  E      ++ ALI+MNH+  +DW+  W +  +YG L      +K+ LK++P  GW  + +  IFL+R W  D+  +S+      +  +  Q  LL++PEGT         S+  A   N       L PR +GF   +  + +  +  I+D+T+ + +  N   +E  +  +L    +E H   +R+ I ++   + EE+ +W    + +K++    F   G 
Sbjct:   66 VKVYITGERPPR--NDRALIVMNHRCRLDWMFYWCVLHRYGQLRHEKIILKDDLKNVPGPGWAMQNSMYIFLRRRWEHDQGYLSSVLQYFKEASYPLQ--LLIFPEGTNLDIASKAKSDSFAKKNNRPSYEYVLHPRVRGFTFCMEKLGKELLHSIHDVTIGYDV--NKSFSERDL--LLGTFPKEMHFHIQRHPIGNVNSSNAEEMEKWCCERWEEKENRLKEFYTLGQ 287          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Match: EDO40658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6J1])

HSP 1 Score: 61.2326 bits (147), Expect = 1.134e-10
Identity = 45/168 (26.79%), Postives = 77/168 (45.83%), Query Frame = 1
Query:  448 GWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVK---VIYDLTLAFPISENNENAEATMSNVLNCNL-EEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF 939
            GW  +    IFL+R W +D+  ++   +   D   NY   L+++PEGT   D     S+  A   N+      L PR +GF+  V  +R+  +    I+D+T+A+     + N   T  +++  +   E H   +RY I ++P    EEL  W    + +K+     F
Sbjct:   17 GWGMQQAMYIFLRRRWEQDEGYLNTILDYFKDL--NYPLQLMIFPEGTNLEDRSRVHSDSFARKNNLPIYEYVLHPRVRGFVHCVEKLRHGPRRMDAIHDVTIAY-----DRNYCFTEKDIILGDFPREIHFHIKRYPISEIPTDV-EELEVWCQKRWLEKEDRLKLF 176          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 186.037 bits (471), Expect = 7.745e-55
Identity = 103/312 (33.01%), Postives = 169/312 (54.17%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDM 1002
            LK  F+ H+++   F++SG  ++ L+ + +  +   ++ L  +I   L Y I  Q   + +WW   +  LY + ++    G ENA++++NH ++ID+L GW   E++G LG +    K+ L ++P++GW+W +   +F KR W +D+  ++ S  +L D+P NY    LL+ EGTRFT EK ++S ++A SK +  L   LLPR KGF   V  +R  V  +YD TL F      +N   TM  VLN     A L  RR  +E +P   ++E A WL+ L+ +KD     + + G F    +   ++  T M
Sbjct:    7 LKSLFICHLIIGYVFLVSGL-LINLLQVCTLPVGLVSKQLARRINIRLGYCIASQVVAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGVLGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENY--WFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFWMTVQNLRGTVSAVYDSTLNF-----RDNETPTMLGVLNGKKYHADLYVRRIPLELIP-EEEKECAAWLHKLYQEKDELQGAYEKTGLFPGPKTSPPRQLRTLM 309          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 185.652 bits (470), Expect = 2.163e-54
Identity = 103/312 (33.01%), Postives = 169/312 (54.17%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDM 1002
            LK  F+ H+++   F++SG  ++ L+ + +  +   ++ L  +I   L Y I  Q   + +WW   +  LY + ++    G ENA++++NH ++ID+L GW   E++G LG +    K+ L ++P++GW+W +   +F KR W +D+  ++ S  +L D+P NY    LL+ EGTRFT EK ++S ++A SK +  L   LLPR KGF   V  +R  V  +YD TL F      +N   TM  VLN     A L  RR  +E +P   ++E A WL+ L+ +KD     + + G F    +   ++  T M
Sbjct:    7 LKSLFICHLIIGYVFLVSGL-LINLLQVCTLPVGLVSKQLARRINIRLGYCIASQVVAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGVLGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENY--WFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFWMTVQNLRGTVSAVYDSTLNF-----RDNETPTMLGVLNGKKYHADLYVRRIPLELIP-EEEKECAAWLHKLYQEKDELQGAYEKTGLFPGPKTSPPRQLRTLM 309          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Match: agpat4 (1-acylglycerol-3-phosphate O-acyltransferase 4 [Source:NCBI gene;Acc:101156844])

HSP 1 Score: 186.037 bits (471), Expect = 3.033e-54
Identity = 107/320 (33.44%), Postives = 170/320 (53.12%), Query Frame = 1
Query:   19 IILFAL*MILHLLPEILKKTFLFHVLLILTFVISG-------TCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNF 957
            ++ F L   + LL   LK  F+ H+++   F++SG        C LP+ +++        + L  +I   L Y I  Q   + +WW   +  LY + ++    G ENA++++NH ++ID+L GW   E++G LG +    K+ L ++P++GW+W +   +F KR W +D+  ++ S  +L D+P NY    LL+ EGTRFT EK ++S ++A SK +  L   LLPR KGF   V  +R  V  +YD TL F      +N   TM  VLN     A L  RR  +E +P   ++E A WL+ L+ +KD     + + G F
Sbjct:   20 VVFFRLSWRMGLL-STLKSLFICHLIIGYVFLVSGLLINLLQVCTLPVGLVS--------KQLARRINIRLGYCIASQVVAVLEWWSGTECTLYTDPKSYPLYGKENAIVLLNHNFEIDFLCGWTFCERFGVLGSSKVLAKQELAYVPVIGWMWYFLEIVFCKRKWEEDRRLVAQSLQNLRDYPENY--WFLLFCEGTRFTPEKHQASMQVAESKGLPKLKYHLLPRTKGFWMTVQNLRGTVSAVYDSTLNF-----RDNETPTMLGVLNGKKYHADLYVRRIPLELIP-EEEKECAAWLHKLYQEKDELQGAYEKTGLF 322          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Match: agpat3 (1-acylglycerol-3-phosphate O-acyltransferase 3 [Source:NCBI gene;Acc:101155591])

HSP 1 Score: 184.496 bits (467), Expect = 4.529e-54
Identity = 120/375 (32.00%), Postives = 201/375 (53.60%), Query Frame = 1
Query:   67 LKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFT--DMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKT-ETGSAYG 1182
            LK  F+  +L+   FV+SG  ++  + + +  LW  NR LY +I   L Y +W Q   + +WW   +  LY +   V   G E+ +II+NH ++ID+L GW + E+YG LGG+    K  L  +P++GW W +   +F KR W +D+ T+      L D+P       LLY EGTRFT++K + S ++A SK +  L   LLPR KGF   +  ++  VK +YD+TL F      +    T+  ++N    +A L  RR+ +E++    +EE A WL+ L+ +KD+    + + G F   +    ++ +T  + +   +L   ++S L  F    V++ S  +II FI  + +  + +  +I +T+  +TGS+YG
Sbjct:    7 LKSLFILQLLMGFVFVVSGL-IINFLQLCTCVLWPINRQLYRRINCRLSYSLWSQLVMLLEWWSGTECTLYTDQATVDMFGKEHVIIILNHNFEIDFLCGWTICERYGVLGGSKVLAKHELLKVPLIGWTWYFLEIVFCKRRWEEDRDTVFKGLGRLRDYPEYM--WFLLYCEGTRFTEKKHQISMQVAESKGLPQLKYHLLPRTKGFTTTLRCLKGTVKAVYDVTLNF-----QDKQTPTLLGIVNGKKYKADLSVRRFTVEEI-PEDEEECAHWLHKLYQEKDALQEIYNKEGKFPGPTVIPPRRPWTLLNFLFWATL---LLSPLINFAYGVVVSGSPLLIIGFIIFLIIASIAIRRLIGVTEVKKTGSSYG 369          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Match: agpat5 (1-acylglycerol-3-phosphate O-acyltransferase 5 [Source:NCBI gene;Acc:101168733])

HSP 1 Score: 88.5817 bits (218), Expect = 4.650e-19
Identity = 67/291 (23.02%), Postives = 132/291 (45.36%), Query Frame = 1
Query:  181 SLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDE---KLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPIS---ENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVI 1035
            S+YHKI   +  +      F  + +  ++I +Y +    K    EN + + NH+  +DW+I   +A +   LG     +K+ LK +P+ GW +  +G I++KR    ++  +      L+         L+++PEGTR+  E    +  S   A  + +  L + L PR K     +  +R+++  +YD+T+A+  +    +   +  +M   L       H+ F R  I ++P    E   +WL+  F  KD     F +  N ++ + F  + + + + +  +L   +I
Sbjct:   45 SIYHKIDDRIYCIYQSMVLFFFENYTGVEIVIYGDIPKKK----ENVVYLSNHQCTVDWIIADMLAIRQSALGHVRYVLKDGLKWLPLYGWYFSQHGGIYVKRSAKFNETAMRKKL--LNQTQTGTPMYLVIFPEGTRYNPEIKSVIADSQAFAKKQGLAVLKHTLTPRMKAAHVAIETMRDHLDAVYDVTVAYEGTLDGSSRRRSAPSMPEFLCKECPRVHIHFDRVDINEIP-PEPEFFRRWLHERFEIKDRLLTDFYESQNLEKKTRFPREAKASPLRLYRTLPSVMI 328          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 382/382 (100.00%), Postives = 382/382 (100.00%), Query Frame = 1
Query:   40 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYGK 1185
            MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK
Sbjct:    1 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK 382          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 692.189 bits (1785), Expect = 0.000e+0
Identity = 352/352 (100.00%), Postives = 352/352 (100.00%), Query Frame = 1
Query:  130 MLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYGK 1185
            MLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK
Sbjct:    1 MLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK 352          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 1
Query:  142 MMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYGK 1185
            MMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK
Sbjct:    1 MMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK 348          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 1
Query:  145 MITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNXXXXXXXXXXXXXXXVYLMIRITKTETGSAYGK 1185
            MITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK
Sbjct:    1 MITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYFLQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNIIIIFIFCIGLCLLIVYLMIRITKTETGSAYGK 347          
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Match: SMESG000046088.1 (SMESG000046088.1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 288/296 (97.30%), Postives = 291/296 (98.31%), Query Frame = 1
Query:   40 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYML--FYQKD 921
            MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQW+ +L  FY  +
Sbjct:    1 MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLYHKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNHKYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKRDWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALSKNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEATMSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWIPILITFYNTE 296          

HSP 2 Score: 80.1073 bits (196), Expect = 1.870e-16
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 2
Query:  920 IPILITFYNTEIFNNHHHLLSKNGSQTWSLPNLCIWR 1030
            IPILITFYNTEIFNNHHHLLSKNGSQTWSLPNLCIWR
Sbjct:  286 IPILITFYNTEIFNNHHHLLSKNGSQTWSLPNLCIWR 322          
The following BLAST results are available for this feature:
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGPAT41.637e-6433.331-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
AGPAT33.752e-6232.801-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
AGPAT33.752e-6232.801-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
AGPAT33.752e-6232.801-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
AGPAT33.752e-6232.801-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acl-96.537e-2233.05ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-96.537e-2233.05ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
bus-184.066e-1524.07pep chromosome:WBcel235:V:11773720:11776631:1 gene... [more]
acl-111.716e-1425.00ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-111.716e-1425.00ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agpat37.909e-6333.07gene:FBgn0036623 transcript:FBtr0075417[more]
Agpat37.909e-6333.07gene:FBgn0036623 transcript:FBtr0075419[more]
Agpat37.909e-6333.07gene:FBgn0036623 transcript:FBtr0075418[more]
Agpat39.995e-6333.07gene:FBgn0036623 transcript:FBtr0308819[more]
Agpat45.315e-4932.21gene:FBgn0036622 transcript:FBtr0331172[more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agpat31.925e-5733.121-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat44.348e-5734.971-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
agpat48.414e-5734.971-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
agpat35.658e-4333.941-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
lclat14.039e-1927.31lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
c19orf441.686e-4829.81chromosome 19 open reading frame 44 [Source:Xenbas... [more]
ENSXETT00000021892.15.920e-3135.981-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
ENSXETT00000021896.11.129e-3036.021-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
ENSXETT00000035309.13.410e-3037.571-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
ENSXETT00000043906.11.531e-2927.27pep primary_assembly:Xenopus_tropicalis_v9.1:5:427... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agpat43.207e-6132.171-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
Agpat39.699e-6132.981-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
Agpat39.699e-6132.981-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
Agpat39.699e-6132.981-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
Agpat39.699e-6132.981-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NRZ5|PLCD_HUMAN7.862e-6433.331-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
sp|Q5R757|PLCD_PONAB8.293e-6433.331-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
sp|Q5E9R2|PLCD_BOVIN3.574e-6333.071-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
sp|Q4R581|PLCD_MACFA1.945e-6232.801-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
sp|Q9NRZ7|PLCC_HUMAN1.802e-6132.801-acyl-sn-glycerol-3-phosphate acyltransferase gam... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9JL802.070e-8239.14PlsC domain-containing protein OS=Biomphalaria gla... [more]
R7UVU93.528e-8238.83PlsC domain-containing protein OS=Capitella teleta... [more]
A0A2T7P6U94.742e-8138.24PlsC domain-containing protein OS=Pomacea canalicu... [more]
A0A1S3H6K21.671e-7737.371-acyl-sn-glycerol-3-phosphate acyltransferase del... [more]
A0A0L8HTH62.887e-7739.87PlsC domain-containing protein OS=Octopus bimaculo... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
agpat31.424e-5833.771-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat45.089e-5834.111-acylglycerol-3-phosphate O-acyltransferase 4 (ly... [more]
lclat14.189e-2232.47lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat51.523e-1622.221-acylglycerol-3-phosphate O-acyltransferase 5 [So... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
agpat34.298e-5630.101-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
lclat16.134e-2029.11lysocardiolipin acyltransferase 1 [Source:NCBI gen... [more]
agpat51.058e-1825.931-acylglycerol-3-phosphate O-acyltransferase 5 (ly... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CST261.028e-2226.00Acyltransferase; enzyme mainly responsible for the... [more]
YDR018C_mRNA1.822e-1724.28Probable membrane protein with three predicted tra... [more]
SLC11.430e-630.971-acyl-sn-glycerol-3-phosphate acyltransferase; ca... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298421.428e-6535.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406598.097e-2128.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361416.509e-1926.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356902.764e-1725.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406581.134e-1026.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agpat47.745e-5533.011-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
agpat42.163e-5433.011-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
agpat43.033e-5433.441-acylglycerol-3-phosphate O-acyltransferase 4 [So... [more]
agpat34.529e-5432.001-acylglycerol-3-phosphate O-acyltransferase 3 [So... [more]
agpat54.650e-1923.021-acylglycerol-3-phosphate O-acyltransferase 5 [So... [more]
back to top
BLAST of 1-acyl-sn-glycerol-3-phosphate acyltransferase delta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046088.10.000e+0100.00SMESG000046088.1[more]
SMESG000046088.10.000e+0100.00SMESG000046088.1[more]
SMESG000046088.10.000e+0100.00SMESG000046088.1[more]
SMESG000046088.10.000e+0100.00SMESG000046088.1[more]
SMESG000046088.11.870e-1697.30SMESG000046088.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033378 ID=SMED30033378|Name=1-acyl-sn-glycerol-3-phosphate acyltransferase delta|organism=Schmidtea mediterranea sexual|type=transcript|length=1228bp
CTATATAAATCTTATATGATAATTTTGTTTGCTTTATAAATGATTTTACA
TTTACTACCAGAAATATTGAAGAAAACATTTTTATTTCACGTGCTTTTAA
TCTTAACATTTGTAATAAGTGGAACATGCATGCTTCCCCTTATGATGATA
ACATCATTTTGTTTGTGGAAGTATAACCGTTCGTTGTATCATAAAATCAT
ATATCATTTATGTTATGTCATTTGGTGTCAATTTACGTTTATTGCTCAAT
GGTGGGGTAAATTAAAAATTCGTCTATATATTGAAGATGAAAATGTGAAA
TATCTTGGTAGTGAAAATGCATTGATAATTATGAATCATAAATACGATAT
CGATTGGTTGATCGGTTGGCAAATGGCTGAGCAGTACGGCTGCTTGGGGG
GTACGATACCGTTCGTCAAAGAATCTTTAAAGCATATTCCTATTCTTGGA
TGGATATGGAGATATAATGGCGCTATATTTCTTAAACGCGATTGGACGAA
AGACAAATTAACGATATCCAATTCCTCAAATGATCTGGATGATTTTCCAC
ATAATTATCAAAAATTGCTATTACTTTATCCGGAAGGAACTCGATTTACT
GATGAAAAATTGAAATCAAGCAACAAGATTGCTCTATCCAAAAATATGAA
GCCTCTTGTAAATTGTCTTTTGCCTAGAGCGAAAGGTTTTATTGAAATCG
TCCATGCTATCAGGAACAATGTCAAAGTTATTTATGATTTAACTTTGGCT
TTTCCGATATCTGAAAATAATGAAAATGCTGAAGCTACCATGTCTAATGT
CCTTAATTGTAACCTGGAGGAGGCGCATTTGCTTTTTCGTCGATATGTCA
TTGAAGATCTTCCATTGCACTCTGATGAGGAATTAGCTCAATGGTTATAT
ATGTTGTTTTATCAAAAGGATTCCGATTTTAATTACTTTCTACAATACGG
AAATTTTCAACAATCATCATCATTTGTTATCAAAAAACGGTTCACAGACA
TGGTCGTTGCCGAATCTTTGCATTTGGCGGTAATATCTTTGTTGTTTTAC
TTCATCAAGGCGTTTGTTTTAAACTGCTCATGGAATATAATTATTATATT
CATATTCTGCATCGGGCTATGTCTATTAATTGTTTATTTGATGATTAGAA
TAACCAAAACAGAAACCGGATCGGCCTATGGGAAATAATTGTCAAGGATT
TTATGATATTTTATTGAAAATTAAATTT
back to top

protein sequence of SMED30033378-orf-1

>SMED30033378-orf-1 ID=SMED30033378-orf-1|Name=SMED30033378-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MILHLLPEILKKTFLFHVLLILTFVISGTCMLPLMMITSFCLWKYNRSLY
HKIIYHLCYVIWCQFTFIAQWWGKLKIRLYIEDENVKYLGSENALIIMNH
KYDIDWLIGWQMAEQYGCLGGTIPFVKESLKHIPILGWIWRYNGAIFLKR
DWTKDKLTISNSSNDLDDFPHNYQKLLLLYPEGTRFTDEKLKSSNKIALS
KNMKPLVNCLLPRAKGFIEIVHAIRNNVKVIYDLTLAFPISENNENAEAT
MSNVLNCNLEEAHLLFRRYVIEDLPLHSDEELAQWLYMLFYQKDSDFNYF
LQYGNFQQSSSFVIKKRFTDMVVAESLHLAVISLLFYFIKAFVLNCSWNI
IIIFIFCIGLCLLIVYLMIRITKTETGSAYGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002123Plipid/glycerol_acylTrfase
IPR032098Acyltransf_C
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006629lipid metabolic process
GO:0008654phospholipid biosynthetic process
GO:0016024CDP-diacylglycerol biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:00038411-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002123Phospholipid/glycerol acyltransferaseSMARTSM00563plsc_2coord: 94..218
e-value: 3.1E-10
score: 50.0
IPR002123Phospholipid/glycerol acyltransferasePFAMPF01553Acyltransferasecoord: 84..237
e-value: 4.6E-15
score: 55.4
IPR032098Acyltransferase, C-terminal domainPFAMPF16076Acyltransf_Ccoord: 254..323
e-value: 1.3E-12
score: 47.6
NoneNo IPR availablePANTHERPTHR109831-ACYLGLYCEROL-3-PHOSPHATE ACYLTRANSFERASE-RELATEDcoord: 20..375
NoneNo IPR availablePANTHERPTHR10983:SF24PROTEIN MUM3coord: 20..375
NoneNo IPR availableCDDcd07990LPLAT_LCLAT1-likecoord: 66..267
e-value: 1.40694E-54
score: 176.66
NoneNo IPR availableSUPERFAMILYSSF69593Glycerol-3-phosphate (1)-acyltransferasecoord: 32..191
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 350..372