OCA2 melanosomal transmembrane protein

Overview
NameOCA2 melanosomal transmembrane protein
Smed IDSMED30033373
Length (bp)2326
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of OCA2 melanosomal transmembrane protein (SMED30033373) t-SNE clustered cells

Violin plots show distribution of expression levels for OCA2 melanosomal transmembrane protein (SMED30033373) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of OCA2 melanosomal transmembrane protein (SMED30033373) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for OCA2 melanosomal transmembrane protein (SMED30033373) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033373

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30033373SMESG000080562.1 PL06011A2B05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30033373SMESG000080562.1 dd_Smed_v4_5800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033373SMESG000080562.1 dd_Smed_v4_5800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033373SMESG000080562.1 dd_Smed_v4_5800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033373SMESG000080562.1 dd_Smed_v4_5800_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Match: OCA2 (OCA2 melanosomal transmembrane protein [Source:HGNC Symbol;Acc:HGNC:8101])

HSP 1 Score: 472.241 bits (1214), Expect = 2.230e-154
Identity = 301/657 (45.81%), Postives = 438/657 (66.67%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLG--NRP-QYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSS-----VDIDREQETYVTKYFEVEPK-FANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNH----MPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P+Q   +   ++S +   S+N S    S+ ++V   G+ V    +RP +  +I + ++  +             LG +   P +V+      ++  R + + +++ FEV  +   +  I+  ++     P+ +     ++  SV  Q+  ++ IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLL K + LEH L  + H     + +   ++   ++E++ K+ I D  LL KC  VL  VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE  RL+ ++++V+W+SA+ SS IDNIPFT  MIP++L L +     +P  PL++ LAFGACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++  + M YLL+ H+V+GWN
Sbjct:  198 PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADA------------LGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQ--YLRGSVETQVTIATAILAGVYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIG--ICLVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATMIPVLLNLSHDPEVGLPAPPLMYALAFGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 838          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Match: OCA2 (OCA2 melanosomal transmembrane protein [Source:HGNC Symbol;Acc:HGNC:8101])

HSP 1 Score: 460.299 bits (1183), Expect = 3.763e-150
Identity = 287/657 (43.68%), Postives = 418/657 (63.62%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLG--NRP-QYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSS-----VDIDREQETYVTKYFEVEPK-FANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNH----MPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P+Q   +   ++S +   S+N S    S+ ++V   G+ V    +RP +  +I + ++  +             LG +   P +V+      ++  R + + +++ FEV  +   +  I+  ++     P+ +     ++  SV  Q+  ++ IL GVY LIIF+                        RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLL K + LEH L  + H     + +   ++   ++E++ K+ I D  LL KC  VL  VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE  RL+ ++++V+W+SA+ SS IDNIPFT  MIP++L L +     +P  PL++ LAFGACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++  + M YLL+ H+V+GWN
Sbjct:  198 PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADA------------LGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQ--YLRGSVETQVTIATAILAGVYALIIFE------------------------RPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIG--ICLVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATMIPVLLNLSHDPEVGLPAPPLMYALAFGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 814          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Match: OCA2 (OCA2 melanosomal transmembrane protein [Source:HGNC Symbol;Acc:HGNC:8101])

HSP 1 Score: 349.362 bits (895), Expect = 1.819e-108
Identity = 245/567 (43.21%), Postives = 365/567 (64.37%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLG--NRP-QYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSS-----VDIDREQETYVTKYFEVEPK-FANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAM 1990
            P+Q   +   ++S +   S+N S    S+ ++V   G+ V    +RP +  +I + ++  +             LG +   P +V+      ++  R + + +++ FEV  +   +  I+  ++     P+ +     ++  SV  Q+  ++ IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLL K + LEH L  + H     + +   ++   ++E++ K+ I D  LL KC  VL  VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE  RL+ ++++V+W+SA+ SS IDNIPFT  M
Sbjct:  198 PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADA------------LGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQ--YLRGSVETQVTIATAILAGVYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIG--ICLVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATM 748          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Match: OCA2 (OCA2 melanosomal transmembrane protein [Source:HGNC Symbol;Acc:HGNC:8101])

HSP 1 Score: 336.65 bits (862), Expect = 6.667e-104
Identity = 231/567 (40.74%), Postives = 345/567 (60.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLG--NRP-QYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSS-----VDIDREQETYVTKYFEVEPK-FANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAM 1990
            P+Q   +   ++S +   S+N S    S+ ++V   G+ V    +RP +  +I + ++  +             LG +   P +V+      ++  R + + +++ FEV  +   +  I+  ++     P+ +     ++  SV  Q+  ++ IL GVY LIIF+                        RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLL K + LEH L  + H     + +   ++   ++E++ K+ I D  LL KC  VL  VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE  RL+ ++++V+W+SA+ SS IDNIPFT  M
Sbjct:  198 PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADA------------LGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQ--YLRGSVETQVTIATAILAGVYALIIFE------------------------RPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIG--ICLVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATM 724          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Match: OCA2 (OCA2 melanosomal transmembrane protein [Source:HGNC Symbol;Acc:HGNC:8101])

HSP 1 Score: 87.4261 bits (215), Expect = 9.040e-20
Identity = 51/82 (62.20%), Postives = 69/82 (84.15%), Query Frame = 2
Query:  767 LLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIAR 1012
            L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++R
Sbjct:   51 LAGVYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSR 132          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Match: hoe1 (gene:FBgn0041150 transcript:FBtr0336833)

HSP 1 Score: 410.609 bits (1054), Expect = 3.751e-133
Identity = 271/660 (41.06%), Postives = 411/660 (62.27%), Query Frame = 2
Query:  338 QHFDYHDYSVSNIFPQSINRSIPKKSSAVR---VRFRGSFVLGNRPQYSNISIVISNVEC-VEKS---NQSKSVFRLGCKEVWPLKVSSVD-IDREQETYVTKYFEVEP-------KFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGD---DDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQ-KHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            +H D    S+ ++   S  R  P  +++++   +  RG F L       N S+ +  ++  V +S    +   ++     +VW L V   D ID  ++T   + FE+ P       +    E+  E  +  +  + + +N+          +IY++ +L G+Y +II+++V+R+ AAI+ S  ++  L+ LN RPS+ATI+ W+D +TL LLFGMM++V I SETG FD++A  A+KI  G  WPL+  LC  +AV+S FLDNVTTVLL+TPVTIRLCE + ++P  +L+  V++SNIGG  T +GDPPNVI+ S+  ++ NGVNFA FTLHM  G    ++  ++      R     + D    D+  + EL+ EI VW+R+A +++  S++E  VR  L++K  +L+  L  +   V  P+ ++ +TL  ++ KY I++K LLIKCS  L  VI  FFL S+     L LGW +  GAI++I+L+D  ++E IL +VEW+TL+FFAALF LM  L EL LI +IG     +IL V E+ RL+V+++++LW+SA+ S+F+DNIP TT M+ I + L      ++P+ PLVW LA GACLGGNGTLIGASANVV AG+A+QHGY F+F+ FFKVGFP+M+ + ++   YLL+ H +  W+
Sbjct:    5 EHVD--QLSLISVPRNSSPRVFPIATASLQRIGLGLRGPFRLQENELAINASVPLPLLQVQVMRSYFDGEGMEIYIENASQVWQLDVVYPDLIDATRDTKKQRTFELSPTDPLWLAQANRTELSFEFTSSIEGELPLQLNVDESPIYKRDGVIYAAAVLCGLYVMIIWEIVNRTFAAIIASTLSVGILAALNSRPSMATIMGWIDVETLLLLFGMMILVAILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLNPVPILMCMVIYSNIGGALTPVGDPPNVIIASNSYISKNGVNFAVFTLHMLPG----VLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAYSKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFVISLFFLHSVPELQRLSLGWTALLGAIFLIILADIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAILIILWVSAVASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLGGNGTLIGASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 658          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Match: hoe1 (gene:FBgn0041150 transcript:FBtr0077397)

HSP 1 Score: 410.994 bits (1055), Expect = 1.321e-131
Identity = 269/649 (41.45%), Postives = 403/649 (62.10%), Query Frame = 2
Query:  398 SIPKKSSA------------VRVRFRGSFVLGNRPQYSNISIVISNVEC-VEKS---NQSKSVFRLGCKEVWPLKVSSVD-IDREQETYVTKYFEVEP-------KFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGD---DDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQ-KHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            S+P+ SS             + +  RG F L       N S+ +  ++  V +S    +   ++     +VW L V   D ID  ++T   + FE+ P       +    E+  E  +  +  + + +N+          +IY++ +L G+Y +II+++V+R+ AAI+ S  ++  L+ LN RPS+ATI+ W+D +TL LLFGMM++V I SETG FD++A  A+KI  G  WPL+  LC  +AV+S FLDNVTTVLL+TPVTIRLCE + ++P  +L+  V++SNIGG  T +GDPPNVI+ S+  ++ NGVNFA FTLHM  G    ++  ++      R     + D    D+  + EL+ EI VW+R+A +++  S++E  VR  L++K  +L+  L  +   V  P+ ++ +TL  ++ KY I++K LLIKCS  L  VI  FFL S+     L LGW +  GAI++I+L+D  ++E IL +VEW+TL+FFAALF LM  L EL LI +IG     +IL V E+ RL+V+++++LW+SA+ S+F+DNIP TT M+ I + L      ++P+ PLVW LA GACLGGNGTLIGASANVV AG+A+QHGY F+F+ FFKVGFP+M+ + ++   YLL+ H +  W+
Sbjct:  159 SVPRNSSPRVFPIATASLQRIGLGLRGPFRLQENELAINASVPLPLLQVQVMRSYFDGEGMEIYIENASQVWQLDVVYPDLIDATRDTKKQRTFELSPTDPLWLAQANRTELSFEFTSSIEGELPLQLNVDESPIYKRDGVIYAAAVLCGLYVMIIWEIVNRTFAAIIASTLSVGILAALNSRPSMATIMGWIDVETLLLLFGMMILVAILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLNPVPILMCMVIYSNIGGALTPVGDPPNVIIASNSYISKNGVNFAVFTLHMLPG----VLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAYSKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFVISLFFLHSVPELQRLSLGWTALLGAIFLIILADIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAILIILWVSAVASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLGGNGTLIGASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 803          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Match: hoe1 (gene:FBgn0041150 transcript:FBtr0336834)

HSP 1 Score: 410.609 bits (1054), Expect = 2.323e-131
Identity = 269/649 (41.45%), Postives = 403/649 (62.10%), Query Frame = 2
Query:  398 SIPKKSSA------------VRVRFRGSFVLGNRPQYSNISIVISNVEC-VEKS---NQSKSVFRLGCKEVWPLKVSSVD-IDREQETYVTKYFEVEP-------KFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGD---DDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQ-KHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            S+P+ SS             + +  RG F L       N S+ +  ++  V +S    +   ++     +VW L V   D ID  ++T   + FE+ P       +    E+  E  +  +  + + +N+          +IY++ +L G+Y +II+++V+R+ AAI+ S  ++  L+ LN RPS+ATI+ W+D +TL LLFGMM++V I SETG FD++A  A+KI  G  WPL+  LC  +AV+S FLDNVTTVLL+TPVTIRLCE + ++P  +L+  V++SNIGG  T +GDPPNVI+ S+  ++ NGVNFA FTLHM  G    ++  ++      R     + D    D+  + EL+ EI VW+R+A +++  S++E  VR  L++K  +L+  L  +   V  P+ ++ +TL  ++ KY I++K LLIKCS  L  VI  FFL S+     L LGW +  GAI++I+L+D  ++E IL +VEW+TL+FFAALF LM  L EL LI +IG     +IL V E+ RL+V+++++LW+SA+ S+F+DNIP TT M+ I + L      ++P+ PLVW LA GACLGGNGTLIGASANVV AG+A+QHGY F+F+ FFKVGFP+M+ + ++   YLL+ H +  W+
Sbjct:  168 SVPRNSSPRVFPIATASLQRIGLGLRGPFRLQENELAINASVPLPLLQVQVMRSYFDGEGMEIYIENASQVWQLDVVYPDLIDATRDTKKQRTFELSPTDPLWLAQANRTELSFEFTSSIEGELPLQLNVDESPIYKRDGVIYAAAVLCGLYVMIIWEIVNRTFAAIIASTLSVGILAALNSRPSMATIMGWIDVETLLLLFGMMILVAILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLNPVPILMCMVIYSNIGGALTPVGDPPNVIIASNSYISKNGVNFAVFTLHMLPG----VLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAYSKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFVISLFFLHSVPELQRLSLGWTALLGAIFLIILADIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAILIILWVSAVASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLGGNGTLIGASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Match: hoe1 (gene:FBgn0041150 transcript:FBtr0077400)

HSP 1 Score: 410.609 bits (1054), Expect = 2.323e-131
Identity = 269/649 (41.45%), Postives = 403/649 (62.10%), Query Frame = 2
Query:  398 SIPKKSSA------------VRVRFRGSFVLGNRPQYSNISIVISNVEC-VEKS---NQSKSVFRLGCKEVWPLKVSSVD-IDREQETYVTKYFEVEP-------KFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGD---DDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQ-KHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            S+P+ SS             + +  RG F L       N S+ +  ++  V +S    +   ++     +VW L V   D ID  ++T   + FE+ P       +    E+  E  +  +  + + +N+          +IY++ +L G+Y +II+++V+R+ AAI+ S  ++  L+ LN RPS+ATI+ W+D +TL LLFGMM++V I SETG FD++A  A+KI  G  WPL+  LC  +AV+S FLDNVTTVLL+TPVTIRLCE + ++P  +L+  V++SNIGG  T +GDPPNVI+ S+  ++ NGVNFA FTLHM  G    ++  ++      R     + D    D+  + EL+ EI VW+R+A +++  S++E  VR  L++K  +L+  L  +   V  P+ ++ +TL  ++ KY I++K LLIKCS  L  VI  FFL S+     L LGW +  GAI++I+L+D  ++E IL +VEW+TL+FFAALF LM  L EL LI +IG     +IL V E+ RL+V+++++LW+SA+ S+F+DNIP TT M+ I + L      ++P+ PLVW LA GACLGGNGTLIGASANVV AG+A+QHGY F+F+ FFKVGFP+M+ + ++   YLL+ H +  W+
Sbjct:  168 SVPRNSSPRVFPIATASLQRIGLGLRGPFRLQENELAINASVPLPLLQVQVMRSYFDGEGMEIYIENASQVWQLDVVYPDLIDATRDTKKQRTFELSPTDPLWLAQANRTELSFEFTSSIEGELPLQLNVDESPIYKRDGVIYAAAVLCGLYVMIIWEIVNRTFAAIIASTLSVGILAALNSRPSMATIMGWIDVETLLLLFGMMILVAILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLNPVPILMCMVIYSNIGGALTPVGDPPNVIIASNSYISKNGVNFAVFTLHMLPG----VLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAYSKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFVISLFFLHSVPELQRLSLGWTALLGAIFLIILADIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAILIILWVSAVASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLGGNGTLIGASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Match: hoe1 (gene:FBgn0041150 transcript:FBtr0077399)

HSP 1 Score: 410.609 bits (1054), Expect = 2.323e-131
Identity = 269/649 (41.45%), Postives = 403/649 (62.10%), Query Frame = 2
Query:  398 SIPKKSSA------------VRVRFRGSFVLGNRPQYSNISIVISNVEC-VEKS---NQSKSVFRLGCKEVWPLKVSSVD-IDREQETYVTKYFEVEP-------KFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGD---DDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQ-KHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            S+P+ SS             + +  RG F L       N S+ +  ++  V +S    +   ++     +VW L V   D ID  ++T   + FE+ P       +    E+  E  +  +  + + +N+          +IY++ +L G+Y +II+++V+R+ AAI+ S  ++  L+ LN RPS+ATI+ W+D +TL LLFGMM++V I SETG FD++A  A+KI  G  WPL+  LC  +AV+S FLDNVTTVLL+TPVTIRLCE + ++P  +L+  V++SNIGG  T +GDPPNVI+ S+  ++ NGVNFA FTLHM  G    ++  ++      R     + D    D+  + EL+ EI VW+R+A +++  S++E  VR  L++K  +L+  L  +   V  P+ ++ +TL  ++ KY I++K LLIKCS  L  VI  FFL S+     L LGW +  GAI++I+L+D  ++E IL +VEW+TL+FFAALF LM  L EL LI +IG     +IL V E+ RL+V+++++LW+SA+ S+F+DNIP TT M+ I + L      ++P+ PLVW LA GACLGGNGTLIGASANVV AG+A+QHGY F+F+ FFKVGFP+M+ + ++   YLL+ H +  W+
Sbjct:  168 SVPRNSSPRVFPIATASLQRIGLGLRGPFRLQENELAINASVPLPLLQVQVMRSYFDGEGMEIYIENASQVWQLDVVYPDLIDATRDTKKQRTFELSPTDPLWLAQANRTELSFEFTSSIEGELPLQLNVDESPIYKRDGVIYAAAVLCGLYVMIIWEIVNRTFAAIIASTLSVGILAALNSRPSMATIMGWIDVETLLLLFGMMILVAILSETGVFDYLAVYAYKITNGHVWPLINCLCLFTAVLSSFLDNVTTVLLMTPVTIRLCEVMCLNPVPILMCMVIYSNIGGALTPVGDPPNVIIASNSYISKNGVNFAVFTLHMLPG----VLLVMVQTYIQLRFKFRNISDLQFKDSPEVEELRHEIHVWKRAAASLSAYSKDEELVRQTLMKKVNRLKRSLKKRMTAVIEPAPNYQQTLANLQAKYPIRNKPLLIKCSAALVFVISLFFLHSVPELQRLSLGWTALLGAIFLIILADIEDMEAILARVEWSTLLFFAALFILMEALTELGLIEWIGNMTEGIILGVGEDRRLMVAILIILWVSAVASAFVDNIPLTTMMVKITISLAQNSTLNLPLQPLVWALALGACLGGNGTLIGASANVVCAGVAEQHGYKFTFLQFFKVGFPIMIGSIIVTTGYLLVSHSLFAWH 812          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Zebrafish
Match: oca2 (oculocutaneous albinism II [Source:ZFIN;Acc:ZDB-GENE-070718-4])

HSP 1 Score: 459.144 bits (1180), Expect = 5.448e-150
Identity = 294/651 (45.16%), Postives = 439/651 (67.43%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEV---WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS+    S+N +  + +S ++++  G F+ G      +   ++  VE  E++       R   ++V   W + + S    R  +   T+ FE+    A  +I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSL+ALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP++VLIAEV+F+NIGG ATA+GDPPNVI+VS+++L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL +VIF FFL+S +   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE+ RL +++I+VLW+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  I M YLL  HI + WN
Sbjct:  168 PDRESPWRMLAVSSTESFSMNLTDFRDNSLLKLQVGGPFLGGMEAVQESQEYILIQVEQTEEAGPR----RRRTQQVLYNWTIPLHS---QRSDQILRTRTFEMVSS-APIQISVQAFLLDNQVVPLSMTNQSLYVTVETQVLIAGLILAGVYVLIIFEIVHRTLAAMLGSLSALAALAFIGDRPSLMTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAVGDPPNVIIVSNQDLRKKGIDFAAFTGYMFLG--ICLVLLTSFPFLRLLFWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKKLKTFQRQISQEDKNWEHNIQELQKKHRITDKVLLVKCLTVLGVVIFMFFLNSFVPAIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTAVLIKAVPEDERLAIAIILVLWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIGMCYLLATHIGLHWN 808          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Zebrafish
Match: oca2 (oculocutaneous albinism II [Source:ZFIN;Acc:ZDB-GENE-070718-4])

HSP 1 Score: 458.373 bits (1178), Expect = 1.106e-149
Identity = 294/651 (45.16%), Postives = 439/651 (67.43%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEV---WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS+    S+N +  + +S ++++  G F+ G      +   ++  VE  E++       R   ++V   W + + S    R  +   T+ FE+    A  +I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSL+ALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP++VLIAEV+F+NIGG ATA+GDPPNVI+VS+++L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL +VIF FFL+S +   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE+ RL +++I+VLW+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  I M YLL  HI + WN
Sbjct:  162 PDRESPWRMLAVSSTESFSMNLTDFRDNSLLKLQVGGPFLGGMEAVQESQEYILIQVEQTEEAGPR----RRRTQQVLYNWTIPLHS---QRSDQILRTRTFEMVSS-APIQISVQAFLLDNQVVPLSMTNQSLYVTVETQVLIAGLILAGVYVLIIFEIVHRTLAAMLGSLSALAALAFIGDRPSLMTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAVGDPPNVIIVSNQDLRKKGIDFAAFTGYMFLG--ICLVLLTSFPFLRLLFWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKKLKTFQRQISQEDKNWEHNIQELQKKHRITDKVLLVKCLTVLGVVIFMFFLNSFVPAIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTAVLIKAVPEDERLAIAIILVLWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIGMCYLLATHIGLHWN 802          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Zebrafish
Match: CR381602.1 (oculocutaneous albinism II [Source:NCBI gene;Acc:567419])

HSP 1 Score: 458.373 bits (1178), Expect = 2.276e-149
Identity = 294/651 (45.16%), Postives = 439/651 (67.43%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEV---WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS+    S+N +  + +S ++++  G F+ G      +   ++  VE  E++       R   ++V   W + + S    R  +   T+ FE+    A  +I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSL+ALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP++VLIAEV+F+NIGG ATA+GDPPNVI+VS+++L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL +VIF FFL+S +   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE+ RL +++I+VLW+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  I M YLL  HI + WN
Sbjct:  193 PDRESPWRMLAVSSTESFSMNLTDFRDNSLLKLQVGGPFLGGMEAVQESQEYILIQVEQTEEAGPR----RRRTQQVLYNWTIPLHS---QRSDQILRTRTFEMVSS-APIQISVQAFLLDNQVVPLSMTNQSLYVTVETQVLIAGLILAGVYVLIIFEIVHRTLAAMLGSLSALAALAFIGDRPSLMTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAVGDPPNVIIVSNQDLRKKGIDFAAFTGYMFLG--ICLVLLTSFPFLRLLFWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKKLKTFQRQISQEDKNWEHNIQELQKKHRITDKVLLVKCLTVLGVVIFMFFLNSFVPAIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTAVLIKAVPEDERLAIAIILVLWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIGMCYLLATHIGLHWN 833          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Zebrafish
Match: CR381602.1 (oculocutaneous albinism II [Source:NCBI gene;Acc:567419])

HSP 1 Score: 458.373 bits (1178), Expect = 3.361e-149
Identity = 294/651 (45.16%), Postives = 439/651 (67.43%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEV---WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS+    S+N +  + +S ++++  G F+ G      +   ++  VE  E++       R   ++V   W + + S    R  +   T+ FE+    A  +I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSL+ALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP++VLIAEV+F+NIGG ATA+GDPPNVI+VS+++L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL +VIF FFL+S +   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE+ RL +++I+VLW+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  I M YLL  HI + WN
Sbjct:  201 PDRESPWRMLAVSSTESFSMNLTDFRDNSLLKLQVGGPFLGGMEAVQESQEYILIQVEQTEEAGPR----RRRTQQVLYNWTIPLHS---QRSDQILRTRTFEMVSS-APIQISVQAFLLDNQVVPLSMTNQSLYVTVETQVLIAGLILAGVYVLIIFEIVHRTLAAMLGSLSALAALAFIGDRPSLMTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAVGDPPNVIIVSNQDLRKKGIDFAAFTGYMFLG--ICLVLLTSFPFLRLLFWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKKLKTFQRQISQEDKNWEHNIQELQKKHRITDKVLLVKCLTVLGVVIFMFFLNSFVPAIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTAVLIKAVPEDERLAIAIILVLWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIGMCYLLATHIGLHWN 841          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Match: creb1 (cAMP responsive element binding protein 1 [Source:Xenbase;Acc:XB-GENE-945015])

HSP 1 Score: 447.203 bits (1149), Expect = 1.357e-144
Identity = 281/573 (49.04%), Postives = 405/573 (70.68%), Query Frame = 2
Query:  563 WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTI--SDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            W L +SS    R++     K FE+     +  I I I+        + + ++  +++ S+  Q+  ++++L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+D++TL LLFGMM++V +FS+TGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++EL    ++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K ++LE  L       Q+ + +   ++   ++E++ ++ I DK LLIKC  VL  VIF FFL+S +   +LDLGWI+  G++W++VL+D  + E+IL +VEWATL+FFAALF LM  L  LHLI +IG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++T I M YLL+ H+V+GWN
Sbjct:  293 WTLPLSS---RRKEHIIREKTFEI---LDSDTISINIQAFLQGTQLVPLSLSHQYLSASIETQVTIAAVVLAGVYVLIIFEIVHRTLAAMLGSLAALAALALVGDRPSLVKVVEWIDYETLALLFGMMILVAVFSDTGFFDYCAVKAYQLSRGRIWPMIIILCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQELRKVELDFAGFTGHMFLG--ICLVLLVSFPFLRILYWNKKLYNKEPSEIVELKHEIHVWRLTAQRINPASREETAVKCLLMQKVLKLESLLRKKLQTFQRQISQEDKNWETNIQELQKRHGISDKILLIKCLSVLGFVIFMFFLNSFVPEIHLDLGWIAILGSLWLLVLADVHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYIGEQTALLIKAVPEDERLAIAIILVVWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAIGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSTAIGMCYLLVAHVVLGWN 857          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Match: creb1 (cAMP responsive element binding protein 1 [Source:Xenbase;Acc:XB-GENE-945015])

HSP 1 Score: 446.817 bits (1148), Expect = 1.608e-144
Identity = 281/573 (49.04%), Postives = 405/573 (70.68%), Query Frame = 2
Query:  563 WPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTI--SDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            W L +SS    R++     K FE+     +  I I I+        + + ++  +++ S+  Q+  ++++L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+D++TL LLFGMM++V +FS+TGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++EL    ++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K ++LE  L       Q+ + +   ++   ++E++ ++ I DK LLIKC  VL  VIF FFL+S +   +LDLGWI+  G++W++VL+D  + E+IL +VEWATL+FFAALF LM  L  LHLI +IG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++T I M YLL+ H+V+GWN
Sbjct:  283 WTLPLSS---RRKEHIIREKTFEI---LDSDTISINIQAFLQGTQLVPLSLSHQYLSASIETQVTIAAVVLAGVYVLIIFEIVHRTLAAMLGSLAALAALALVGDRPSLVKVVEWIDYETLALLFGMMILVAVFSDTGFFDYCAVKAYQLSRGRIWPMIIILCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQELRKVELDFAGFTGHMFLG--ICLVLLVSFPFLRILYWNKKLYNKEPSEIVELKHEIHVWRLTAQRINPASREETAVKCLLMQKVLKLESLLRKKLQTFQRQISQEDKNWETNIQELQKRHGISDKILLIKCLSVLGFVIFMFFLNSFVPEIHLDLGWIAILGSLWLLVLADVHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYIGEQTALLIKAVPEDERLAIAIILVVWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAIGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSTAIGMCYLLVAHVVLGWN 847          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Match: creb1 (cAMP responsive element binding protein 1 [Source:Xenbase;Acc:XB-GENE-945015])

HSP 1 Score: 416.772 bits (1070), Expect = 1.252e-134
Identity = 278/572 (48.60%), Postives = 399/572 (69.76%), Query Frame = 2
Query:  563 WPLKVSSVDIDREQETYVTKYFEV-EPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            W L +SS    R++     K FE+ +    +  I+  ++     P+S+     +++ S+  Q+  ++++L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+D++TL LLFGM     +F    F      KA++++RG+ WP++IILC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++EL    ++FA FT HM +G   +L+ S  FLR LY +    + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K ++LE  L       Q+ + +   ++   ++E++ ++ I DK LLIKC  VL  VIF FFL+S +   +LDLGWI+  G++W++VL+D  + E+IL +VEWATL+FFAALF LM  L  LHLI +IG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++T I M YLL+ H+V+GWN
Sbjct:  152 WTLPLSS---RRKEHIIREKTFEILDSDTISINIQAFLQGTQLVPLSLSHQ--YLSASIETQVTIAAVVLAGVYVLIIFEIVHRTLAAMLGSLAALAALALVGDRPSLVKVVEWIDYETLALLFGM----NVFGTLNFV-----KAYQLSRGRIWPMIIILCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQELRKVELDFAGFTGHMFLGICLVLLVSFPFLRILYWNK--KLYNKEPSEIVELKHEIHVWRLTAQRINPASREETAVKCLLMQKVLKLESLLRKKLQTFQRQISQEDKNWETNIQELQKRHGISDKILLIKCLSVLGFVIFMFFLNSFVPEIHLDLGWIAILGSLWLLVLADVHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYIGEQTALLIKAVPEDERLAIAIILVVWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAIGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSTAIGMCYLLVAHVVLGWN 707          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Match: creb1 (cAMP responsive element binding protein 1 [Source:Xenbase;Acc:XB-GENE-945015])

HSP 1 Score: 415.616 bits (1067), Expect = 1.964e-134
Identity = 265/503 (52.68%), Postives = 366/503 (72.76%), Query Frame = 2
Query:  767 LLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+D++TL LLFGM     +F    F      KA++++RG+ WP++IILC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++EL    ++FA FT HM +G   +L+ S  FLR LY +    + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K ++LE  L       Q+ + +   ++   ++E++ ++ I DK LLIKC  VL  VIF FFL+S +   +LDLGWI+  G++W++VL+D  + E+IL +VEWATL+FFAALF LM  L  LHLI +IG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++T I M YLL+ H+V+GWN
Sbjct:  200 LAGVYVLIIFEIVHRTLAAMLGSLAALAALALVGDRPSLVKVVEWIDYETLALLFGM----NVFGTLNFV-----KAYQLSRGRIWPMIIILCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQELRKVELDFAGFTGHMFLGICLVLLVSFPFLRILYWNK--KLYNKEPSEIVELKHEIHVWRLTAQRINPASREETAVKCLLMQKVLKLESLLRKKLQTFQRQISQEDKNWETNIQELQKRHGISDKILLIKCLSVLGFVIFMFFLNSFVPEIHLDLGWIAILGSLWLLVLADVHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYIGEQTALLIKAVPEDERLAIAIILVVWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAIGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSTAIGMCYLLVAHVVLGWN 691          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Match: creb1 (cAMP responsive element binding protein 1 [Source:Xenbase;Acc:XB-GENE-945015])

HSP 1 Score: 416.387 bits (1069), Expect = 3.291e-134
Identity = 278/572 (48.60%), Postives = 399/572 (69.76%), Query Frame = 2
Query:  563 WPLKVSSVDIDREQETYVTKYFEV-EPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            W L +SS    R++     K FE+ +    +  I+  ++     P+S+     +++ S+  Q+  ++++L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+D++TL LLFGM     +F    F      KA++++RG+ WP++IILC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++EL    ++FA FT HM +G   +L+ S  FLR LY +    + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K ++LE  L       Q+ + +   ++   ++E++ ++ I DK LLIKC  VL  VIF FFL+S +   +LDLGWI+  G++W++VL+D  + E+IL +VEWATL+FFAALF LM  L  LHLI +IG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++PI PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++T I M YLL+ H+V+GWN
Sbjct:  183 WTLPLSS---RRKEHIIREKTFEILDSDTISINIQAFLQGTQLVPLSLSHQ--YLSASIETQVTIAAVVLAGVYVLIIFEIVHRTLAAMLGSLAALAALALVGDRPSLVKVVEWIDYETLALLFGM----NVFGTLNFV-----KAYQLSRGRIWPMIIILCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQELRKVELDFAGFTGHMFLGICLVLLVSFPFLRILYWNK--KLYNKEPSEIVELKHEIHVWRLTAQRINPASREETAVKCLLMQKVLKLESLLRKKLQTFQRQISQEDKNWETNIQELQKRHGISDKILLIKCLSVLGFVIFMFFLNSFVPEIHLDLGWIAILGSLWLLVLADVHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYIGEQTALLIKAVPEDERLAIAIILVVWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPIKPLIFALAIGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSTAIGMCYLLVAHVVLGWN 738          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Mouse
Match: Oca2 (oculocutaneous albinism II [Source:MGI Symbol;Acc:MGI:97454])

HSP 1 Score: 473.011 bits (1216), Expect = 6.643e-155
Identity = 280/561 (49.91%), Postives = 395/561 (70.41%), Query Frame = 2
Query:  596 REQETYVTKYFEVEPKFANG-EIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            R +   V++ FE+  + A    I+  ++     P+ +     F+  SV  Q+  +  IL GVY LIIF++VHR++AA+LG+LAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V +FSETGFFD+ A KA++++RG+ W ++ +LC ++A++S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLLEK + LEH L  + H     + +   ++   ++E++ K+ I D+ LL+KC  VL  VI  FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHL+ ++G + + LI MVPE+ R   ++++++W+SA+ SS IDNIPFT  MIP++L L       +P LPL++ LA GACLGGNGTLIGAS NVV AGIA++HGY FSFM+FF++GFP+ML++  I M YLLI HIV+GWN
Sbjct:  277 RSEHVVVSRTFEIVSREAVSISIQASLQQTRLVPLLLAHQ--FLGASVEAQVASAVAILAGVYTLIIFEIVHRTLAAMLGALAALAALAVVGDRPSLTHVVEWIDFETLALLFGMMILVAVFSETGFFDYCAVKAYQLSRGRVWAMIFMLCLMAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFLG--ICLVLLVSFPLLRLLYWNKKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRGLLLEKVLALEHLLAQRLHTFHRQISQEDKNWETNIQELQRKHRISDRSLLVKCLTVLGFVISMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALTHLHLVEYVGEQTALLIKMVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATMIPVLLNLSQDPEISLPALPLMYALALGACLGGNGTLIGASTNVVCAGIAEKHGYGFSFMEFFRLGFPVMLMSCTIGMCYLLIAHIVVGWN 833          
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Match: sp|Q62052|P_MOUSE (P protein OS=Mus musculus OX=10090 GN=Oca2 PE=1 SV=1)

HSP 1 Score: 473.011 bits (1216), Expect = 4.647e-154
Identity = 280/561 (49.91%), Postives = 395/561 (70.41%), Query Frame = 2
Query:  596 REQETYVTKYFEVEPKFANG-EIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            R +   V++ FE+  + A    I+  ++     P+ +     F+  SV  Q+  +  IL GVY LIIF++VHR++AA+LG+LAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V +FSETGFFD+ A KA++++RG+ W ++ +LC ++A++S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLLEK + LEH L  + H     + +   ++   ++E++ K+ I D+ LL+KC  VL  VI  FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHL+ ++G + + LI MVPE+ R   ++++++W+SA+ SS IDNIPFT  MIP++L L       +P LPL++ LA GACLGGNGTLIGAS NVV AGIA++HGY FSFM+FF++GFP+ML++  I M YLLI HIV+GWN
Sbjct:  277 RSEHVVVSRTFEIVSREAVSISIQASLQQTRLVPLLLAHQ--FLGASVEAQVASAVAILAGVYTLIIFEIVHRTLAAMLGALAALAALAVVGDRPSLTHVVEWIDFETLALLFGMMILVAVFSETGFFDYCAVKAYQLSRGRVWAMIFMLCLMAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFLG--ICLVLLVSFPLLRLLYWNKKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRGLLLEKVLALEHLLAQRLHTFHRQISQEDKNWETNIQELQRKHRISDRSLLVKCLTVLGFVISMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALTHLHLVEYVGEQTALLIKMVPEDQRFAAAIVLIVWVSALASSLIDNIPFTATMIPVLLNLSQDPEISLPALPLMYALALGACLGGNGTLIGASTNVVCAGIAEKHGYGFSFMEFFRLGFPVMLMSCTIGMCYLLIAHIVVGWN 833          
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Match: sp|Q04671|P_HUMAN (P protein OS=Homo sapiens OX=9606 GN=OCA2 PE=1 SV=2)

HSP 1 Score: 472.241 bits (1214), Expect = 1.071e-153
Identity = 301/657 (45.81%), Postives = 438/657 (66.67%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLG--NRP-QYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSS-----VDIDREQETYVTKYFEVEPK-FANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNH----MPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P+Q   +   ++S +   S+N S    S+ ++V   G+ V    +RP +  +I + ++  +             LG +   P +V+      ++  R + + +++ FEV  +   +  I+  ++     P+ +     ++  SV  Q+  ++ IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT+LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM +G    L+  + F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLL K + LEH L  + H     + +   ++   ++E++ K+ I D  LL KC  VL  VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE  RL+ ++++V+W+SA+ SS IDNIPFT  MIP++L L +     +P  PL++ LAFGACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++  + M YLL+ H+V+GWN
Sbjct:  198 PDQGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREEHIVVELTQADA------------LGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRETVSISIRASLQQTQAVPLLMAHQ--YLRGSVETQVTIATAILAGVYALIIFEIVHRTLAAMLGSLAALAALAVIGDRPSLTHVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYRLSRGRVWAMIIMLCLIAAVLSAFLDNVTTMLLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIG--ICLVLLVCFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRRLLLGKVLALEHLLARRLHTFHRQISQEDKNWETNIQELQKKHRISDGILLAKCLTVLGFVIFMFFLNSFVPGIHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFVLMEALAHLHLIEYVGEQTALLIKMVPEEQRLIAAIVLVVWVSALASSLIDNIPFTATMIPVLLNLSHDPEVGLPAPPLMYALAFGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCTVGMCYLLVAHVVVGWN 838          
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Match: sp|Q8MIQ9|P_PIG (P protein OS=Sus scrofa OX=9823 GN=Oca2 PE=2 SV=3)

HSP 1 Score: 471.855 bits (1213), Expect = 1.527e-153
Identity = 286/561 (50.98%), Postives = 397/561 (70.77%), Query Frame = 2
Query:  602 QETYVTKYFEV---EPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKH-----VRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            + T +++ FEV   EP   N  I+  ++     P+ +     ++  S+  Q+  +++IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L  ++ W+DF+TL LLFGMM++V IFSETGFFD+ A KA++++RG+ W ++I+LC ++AV+S FLDNVTT LL TPVTIRLCE L +DP++VLIAEV+F+NIGG ATAIGDPPNVI+VS++EL   G++FA FT HM  G     +    F        +  + + +   IVELK EI VWR +A  I+ AS+EE  VR LLLEK + LE  L  + H     + +   ++   ++E++ K+ I D+ LL KC  VL +VIF FFL+S + G +LDLGWI+  GAIW+++L+D  + E+IL +VEWATL+FFAALF LM  L  LHLI ++G + + LI MVPE+ RL  ++IVV+W+SAI SS IDNIPFT  MIP++L L       +P  PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++ ++ M YLL+ H+V+GWN
Sbjct:  291 EHTVMSRTFEVLSREPVSIN--IRASLQQTQIVPLLMAHQ--YLRASIEAQVTIAAVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAVIGDRPTLTQVVEWIDFETLALLFGMMILVAIFSETGFFDYCAVKAYQLSRGRVWAMIIMLCLIAAVLSAFLDNVTTALLFTPVTIRLCEVLNLDPRQVLIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFAG--ICFVLLFSFPLLRLLYWNRKLYNKEPSEIVELKHEIHVWRLTAQRISPASREETAVRGLLLEKVLSLERLLARRLHSFHRQISQEDKNWETNIQELQKKHRISDRTLLTKCVTVLGLVIFMFFLNSFVPGVHLDLGWIAILGAIWLLILADIHDFEIILHRVEWATLLFFAALFILMEALAHLHLIEYVGEQTALLIKMVPEDQRLAAAIIVVVWVSAIASSLIDNIPFTATMIPVLLNLSRDPEISLPAPPLMYALALGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMVVSCMVGMCYLLVAHVVMGWN 845          
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Match: sp|P0A607|Y2703_MYCBO (Uncharacterized transporter Mb2703 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2703 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.722e-43
Identity = 149/450 (33.11%), Postives = 223/450 (49.56%), Query Frame = 2
Query:  902 LDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLV----WGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVI 2239
            +D+D + LL GMM+IVG+  +TG F++ A  A K ARG P  ++I+L  VSA+ S  LDNVTTVLL+ PVT+ +C+ L ++    L+AEV  SNIGG AT +GDPPN+I+ S       G+ F +F LH++                                ++ L   I V  R   +IT+ +   A V AL                                ++   I+D+ LL+KC  VL +V  +F    +    ++    ++  GA  +IV+S     E  L  VEW TL+FFA LF ++  L +  ++  + R  + L         ++ +  ++L +SA IS  IDNIP+   M P++ EL   M   P      W LA GA  GGN T IGASANVV+ GIA++ G   SF +F + G  +  ++  +A IYL + + V+
Sbjct:   53 IDWDVIFLLVGMMIIVGVLRQTGVFEYTAIWAAKRARGSPLRIMILLVLVSALASALLDNVTTVLLIAPVTLLVCDRLNINTTSFLMAEVFASNIGGAATLVGDPPNIIVASRA-----GLTFNDFMLHLT-----------------------------PLVVIVLIALIAVLPRLFGSITVEADRIADVMAL--------------------------------DEGEAIRDRGLLVKCGAVLVLVFAAFVAHPV---LHIQPSLVALLGAGMLIVVSGLTRSE-YLSSVEWDTLLFFAGLFIMVGALVKTGVVNDLARAATQL-----TGGNIVATAFLILGVSAPISGIIDNIPYVATMTPLVAELVAVMGGQPSTDTPWWALALGADFGGNLTAIGASANVVMLGIARRAGAPISFWEFTRKGAVVTAVSIALAAIYLWLRYFVL 427          
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Match: sp|P9WPD9|Y2684_MYCTU (Uncharacterized transporter Rv2684 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2684 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.722e-43
Identity = 149/450 (33.11%), Postives = 223/450 (49.56%), Query Frame = 2
Query:  902 LDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLV----WGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVI 2239
            +D+D + LL GMM+IVG+  +TG F++ A  A K ARG P  ++I+L  VSA+ S  LDNVTTVLL+ PVT+ +C+ L ++    L+AEV  SNIGG AT +GDPPN+I+ S       G+ F +F LH++                                ++ L   I V  R   +IT+ +   A V AL                                ++   I+D+ LL+KC  VL +V  +F    +    ++    ++  GA  +IV+S     E  L  VEW TL+FFA LF ++  L +  ++  + R  + L         ++ +  ++L +SA IS  IDNIP+   M P++ EL   M   P      W LA GA  GGN T IGASANVV+ GIA++ G   SF +F + G  +  ++  +A IYL + + V+
Sbjct:   53 IDWDVIFLLVGMMIIVGVLRQTGVFEYTAIWAAKRARGSPLRIMILLVLVSALASALLDNVTTVLLIAPVTLLVCDRLNINTTSFLMAEVFASNIGGAATLVGDPPNIIVASRA-----GLTFNDFMLHLT-----------------------------PLVVIVLIALIAVLPRLFGSITVEADRIADVMAL--------------------------------DEGEAIRDRGLLVKCGAVLVLVFAAFVAHPV---LHIQPSLVALLGAGMLIVVSGLTRSE-YLSSVEWDTLLFFAGLFIMVGALVKTGVVNDLARAATQL-----TGGNIVATAFLILGVSAPISGIIDNIPYVATMTPLVAELVAVMGGQPSTDTPWWALALGADFGGNLTAIGASANVVMLGIARRAGAPISFWEFTRKGAVVTAVSIALAAIYLWLRYFVL 427          
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Match: A0A1I8JEV5 (CitMHS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 534.258 bits (1375), Expect = 4.785e-177
Identity = 328/688 (47.67%), Postives = 471/688 (68.46%), Query Frame = 2
Query:  275 KCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKS--SAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSV-DIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIF--MAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDK-------------------------YCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            K G +F I+++   +IA  PE+   +H Y+VS+    SIN + P  +  S V V+ RG+ +       +NI++ +  V   E  +QS          VW + ++ V + +  +E    +YF +      G  K+ I+  ++   S+ + + +  +  +VY ++IY++++L  VY LIIF+LVHRS+AA+LGSL ++A L+ +N RPSL  +I+WLDF+TL+LLFGMM++VGIFSE+GFFDW+A  AF++A+G+   L+ +LC  +AV+S FLDNVTT+LL+ PVTIRLCE L++DP+++LIA+V+FSN+GGTATA+GDPPNVI+ S+ EL + GV F NFT+HM++G VFI + +   LR +Y        +D      E++RE+EVWRR+AY   + + E+A V+ALL  K  +LEH L + +        F +TL E++ K                         Y IKDK LL+KCSIVL  VI  FFLSS +   +LDLGWI+  G I ++VL+DFA+++ +L ++EW+TLIFFAALFALM  L EL L+T+IG ++  +IL +PE+++L V++++VLW+SA+ S+FIDNIPFTTAMIPIILEL + +PILPLVW LAFGACLGGNGT+IGASANVV AGIA+Q+GY F+F+ FF+VGFPMM+ T  IAM+YLL+CH +IGWN
Sbjct:   31 KVGVIFAIVLVSCTIIAATPEKESLFHLYTVSSERSPSINVT-PSINFYSVVLVKLRGALLYTPTETSTNITVTVDEVFSAENMSQSL---------VWTVPIAPVVENEVSEEIVRERYFPLNHTAQKGSAKLSIRVRTNYEHSLPLAVSYETLTNAVYNEVIYAALVLAFVYALIIFELVHRSLAAMLGSLMSVAVLALVNRRPSLIEVIAWLDFETLSLLFGMMVMVGIFSESGFFDWVAVLAFRLAKGRTMALVTLLCLFAAVISAFLDNVTTILLMAPVTIRLCEVLRLDPRQLLIAQVMFSNVGGTATAVGDPPNVIIASNAELAEQGVTFTNFTVHMTLGIVFITVAAYALLRLVYWRQDLESNEDPV--AAEIRREVEVWRRTAYGFAVTTSEQAAVKALLQAKICELEHRLAVHRVTATADKPFEQTLAELQQKVRLRAASFMRISFGFVSAVQVAILTYGIKDKELLVKCSIVLSAVIVLFFLSSTVDALHLDLGWIAVMGGIALLVLTDFADMDTLLHRIEWSTLIFFAALFALMEALRELRLVTWIGDQMKLVILALPESSQLPVAILIVLWVSALASAFIDNIPFTTAMIPIILELADVLPILPLVWSLAFGACLGGNGTIIGASANVVAAGIAEQNGYPFTFVQFFRVGFPMMVCTVTIAMLYLLVCHSLIGWN 706          
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Match: A0A1S3HVT1 (P protein-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106158622 PE=4 SV=1)

HSP 1 Score: 525.783 bits (1353), Expect = 7.297e-173
Identity = 334/674 (49.55%), Postives = 462/674 (68.55%), Query Frame = 2
Query:  251 TKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFV--LGNRPQY-SNISIVISNVECVEKSNQSKSV-FRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEH--ELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN--HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            T+     IK   +F   I+ ++ + I+ E   + H +SVS   P S++ +     S V+V   G FV  L +   Y +N+++ ++N    +   Q  +V  +    +   L +S  +   E E Y T  F+       G  K+ + T +   + + ++ + +    +  ++Y++I+LLGVY LI+F+LVHR++AA++GS+AALA LS +N RP+++T+ISWLD +TL+LLFGMM++V IFS+TGFFD+ A  A+K+A+G+ WPL+ ILC   AVVS FLDNVTT+LL+TPVTIRLCE L ++PK +LIA VLFSN+GGTATAIGDPPNVI+VS+  L +  + FANFT HM +G +F+LI +   LR  YR+L+  + +     I ELK EI+VWRRSA  I   ++EE+ V+ALL++K V LE+  +  + K  R     F E++ E+E KY I D WLL+K SIVL +VI +FFL S +T  +LDLGWI+  GAIW++VL+D  +LE +  +VEWATL+FFAALF LM  L EL LI +IG ++  LI  V E  RL V+LI++LW+SAI SSFIDNIPFTTAMIP+++ +     +PI P+VW LAFGACLGGNGTLIGAS NVV AGIA+QHGY F+F++FFKVGFPMML+TT  AM YLL+CHI IGWN
Sbjct:  102 TREKLKQIKVALLFIATIMCSVWVGISEEHEEELHQFSVSAYQPLSLDITPGAGQSVVKVMISGPFVKALDDHGDYENNMTLTVANSAAFDNGTQKPAVKLQSSAIQQETLILSKENASYETEEY-TYLFDFTGPDEQGPFKLRLNTTTAYGVPVSLSYLTLPADSHNAVVYAAIVLLGVYVLIVFELVHRTLAAMMGSMAALAVLSAMNERPTMSTVISWLDTETLSLLFGMMVMVAIFSDTGFFDYCALLAYKLAKGQVWPLMTILCFFGAVVSAFLDNVTTILLMTPVTIRLCEVLNLEPKHLLIAIVLFSNVGGTATAIGDPPNVIIVSNSYLKEKNITFANFTGHMILGILFVLIGAYGLLRVQYRNLA-NLKNKFPPEIAELKHEIKVWRRSAKRIASVTREESVVKALLMQKVVTLENLVKKKLYKTKRSVEKDFKESVSELEKKYRITDHWLLLKSSIVLLVVILAFFLHSFVTQMHLDLGWIAIIGAIWLLVLADIEDLESVFHRVEWATLLFFAALFVLMEALTELGLIEWIGDQVVALIKTVDEEYRLAVALILILWVSAITSSFIDNIPFTTAMIPVVIHIEESIQLPIEPMVWALAFGACLGGNGTLIGASCNVVCAGIAEQHGYGFTFVEFFKVGFPMMLVTTFFAMCYLLVCHIAIGWN 773          
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Match: A0A1S3HYI1 (P protein-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106158622 PE=4 SV=1)

HSP 1 Score: 525.398 bits (1352), Expect = 1.195e-172
Identity = 334/674 (49.55%), Postives = 462/674 (68.55%), Query Frame = 2
Query:  251 TKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFV--LGNRPQY-SNISIVISNVECVEKSNQSKSV-FRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEH--ELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN--HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            T+     IK   +F   I+ ++ + I+ E   + H +SVS   P S++ +     S V+V   G FV  L +   Y +N+++ ++N    +   Q  +V  +    +   L +S  +   E E Y T  F+       G  K+ + T +   + + ++ + +    +  ++Y++I+LLGVY LI+F+LVHR++AA++GS+AALA LS +N RP+++T+ISWLD +TL+LLFGMM++V IFS+TGFFD+ A  A+K+A+G+ WPL+ ILC   AVVS FLDNVTT+LL+TPVTIRLCE L ++PK +LIA VLFSN+GGTATAIGDPPNVI+VS+  L +  + FANFT HM +G +F+LI +   LR  YR+L+  + +     I ELK EI+VWRRSA  I   ++EE+ V+ALL++K V LE+  +  + K  R     F E++ E+E KY I D WLL+K SIVL +VI +FFL S +T  +LDLGWI+  GAIW++VL+D  +LE +  +VEWATL+FFAALF LM  L EL LI +IG ++  LI  V E  RL V+LI++LW+SAI SSFIDNIPFTTAMIP+++ +     +PI P+VW LAFGACLGGNGTLIGAS NVV AGIA+QHGY F+F++FFKVGFPMML+TT  AM YLL+CHI IGWN
Sbjct:  109 TREKLKQIKVALLFIATIMCSVWVGISEEHEEELHQFSVSAYQPLSLDITPGAGQSVVKVMISGPFVKALDDHGDYENNMTLTVANSAAFDNGTQKPAVKLQSSAIQQETLILSKENASYETEEY-TYLFDFTGPDEQGPFKLRLNTTTAYGVPVSLSYLTLPADSHNAVVYAAIVLLGVYVLIVFELVHRTLAAMMGSMAALAVLSAMNERPTMSTVISWLDTETLSLLFGMMVMVAIFSDTGFFDYCALLAYKLAKGQVWPLMTILCFFGAVVSAFLDNVTTILLMTPVTIRLCEVLNLEPKHLLIAIVLFSNVGGTATAIGDPPNVIIVSNSYLKEKNITFANFTGHMILGILFVLIGAYGLLRVQYRNLA-NLKNKFPPEIAELKHEIKVWRRSAKRIASVTREESVVKALLMQKVVTLENLVKKKLYKTKRSVEKDFKESVSELEKKYRITDHWLLLKSSIVLLVVILAFFLHSFVTQMHLDLGWIAIIGAIWLLVLADIEDLESVFHRVEWATLLFFAALFVLMEALTELGLIEWIGDQVVALIKTVDEEYRLAVALILILWVSAITSSFIDNIPFTTAMIPVVIHIEESIQLPIEPMVWALAFGACLGGNGTLIGASCNVVCAGIAEQHGYGFTFVEFFKVGFPMMLVTTFFAMCYLLVCHIAIGWN 780          
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Match: A0A093PJA6 (P protein (Fragment) OS=Pygoscelis adeliae OX=9238 GN=AS28_02784 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 2.721e-157
Identity = 320/730 (43.84%), Postives = 469/730 (64.25%), Query Frame = 2
Query:  104 DDKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFV--LGNRPQYSNISIVISNVECV--EKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINI--IFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            DD  +D SS       +   +   LS      ++   L+ +  K +  K +     +K   +F  +++ +IL  + P+Q   +   +VS +   S+N +    S+ +++   G FV  + ++     I + IS  E     +  Q + V+       W L +SS    R Q+   T+ F++  +   G I + I+     P S+ +++   ++  ++  Q+  +SIIL+GVY LII ++VHR++AA+LGSLAALA L+T+  RPS+  ++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++ +RGK W ++ +LC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS +EL   G++FA FT HM VG    L+  + F        +  + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K + LE  L        + + +   ++   ++E++ K+ I DK LLIKC  VL  VI  FFL+S + G YLDLGWI+  GAIW++VL+D  + E+IL++VEWATL+FFAALF LM  L  LHLI +IG + + LI +VPE+ RL+V++I+VLW+SA+ SS IDNIPFT  MIP++L L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++  I M YLL+ H+V+GWN
Sbjct:   43 DDDSWDNSSAEFEQRFQLGSEMTSLS-RSASAEKYEILDNLHVKFNLSKMRCCLKFLKVSGLFIFVVVCSILFGVYPDQGVSWQMLAVSPLESFSMNLTDFHDSALLKLDIGGPFVADVADQQTEEYIVVQISQTEDTGSRRRRQQQVVYN------WSLPLSS---RRNQQIITTRTFQIPNR---GTIFVNIQAFLQEPGSVPLSMKHQYLHANIEAQVTIASIILVGVYVLIILEIVHRTLAAMLGSLAALAALATVGERPSMVKVVEWIDYETLALLFGMMVLVAIFSETGFFDYCAVKAYRFSRGKVWAMITLLCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSKQELRKKGLDFAAFTGHMFVG--ICLVVLVSFPFLRLLYWNKKLYNKEPSEIVELKHEIYVWRLTAQRINPASREETAVKCLLMQKVLTLEMLLRKKLRTFHRQISQEDKNWETNIQELQKKHRITDKILLIKCLTVLGCVILMFFLNSFVPGIYLDLGWIAMLGAIWLLVLADIHDFEIILNRVEWATLLFFAALFVLMEALAHLHLIDYIGEQTALLIKVVPEDQRLVVAIILVLWVSALASSVIDNIPFTATMIPVLLNLSKDPDVNLPMKPLIFSLAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSCTIGMCYLLVAHVVVGWN 757          
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Match: A0A091VTZ8 (P protein (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_14216 PE=4 SV=1)

HSP 1 Score: 484.567 bits (1246), Expect = 5.469e-157
Identity = 325/730 (44.52%), Postives = 469/730 (64.25%), Query Frame = 2
Query:  104 DDKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVI--SNVECV--EKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINI--IFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            DD  +D SS       +   +   LS     +++   L+ +  K +  K +     +K   +F  +I+ +IL  I P+Q   +   +VS +   S+N +  + S  +++   G FV     Q +   +V+  S  E +   +  Q + V+       W L +SS    R Q+   T+ F   P    G I + I+     P S+ +++   ++  ++  Q+  +SIIL GVY LII ++VHR++AA+LGSLAALATL+T+  RPS+  ++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RGK W ++ +LC ++A++S FLDNVTT+LL TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS +EL   G++FA FT HM VG    L+  + F        +  + + +   IVELK EI VWR +A  I  AS+EE  V+ LL++K + LE  L        + + +   ++   ++E++ K+ I DK LLIKC  VL  VI +FFL+S + G YLDLGWI+  GAIW++VL+D  + E+IL++VEWATL+FFAALF LM  L  LHLI +IG + + LI +VPE+ RL V++I+VLW+SA+ SS IDNIPFT  MIP++L L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMM+++  I M YLL+ H+VIGWN
Sbjct:   43 DDDSWDNSSAEFEQRFQMGSEMTSLS-RSASSEKYEILDNLHVKFNLSKMRCCLKFMKVSGLFIFVIVCSILFGIYPDQGVSWQMLAVSPLESFSMNLTDFRDSVLLKLDIGGPFVADVVDQQTEEYVVVQVSQTEDIGSRRRRQKQVVYN------WSLPLSS---RRNQQIITTRTF---PILNRGTIFLNIQAFLQEPGSVPLSMKHQYLQANIEAQVTTASIILAGVYVLIILEIVHRTLAAMLGSLAALATLATVGERPSMIKVVEWIDYETLALLFGMMVLVAIFSETGFFDYCAVKAYQLSRGKVWAMITLLCLIAAILSAFLDNVTTMLLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSKQELRRRGLDFAAFTGHMFVG--ICLVVLVSFPFLRLLYWNKKLYNKEPSEIVELKHEIYVWRLTAQRINPASREETAVKCLLMQKVLTLEMLLRKKLRTFHRQISQEDKNWETNIQELQKKHRITDKILLIKCLAVLGCVILTFFLNSFVPGIYLDLGWIAMLGAIWLLVLADIHDFEMILNRVEWATLLFFAALFVLMEALAHLHLIDYIGEQTALLIKVVPEDQRLAVAIILVLWVSALASSVIDNIPFTATMIPVLLNLSKDPDVNLPMKPLIFSLAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMIVSCTIGMCYLLVAHVVIGWN 757          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Match: oca2 (Astyanax mexicanus OCA2 melanosomal transmembrane protein (oca2), mRNA. [Source:RefSeq mRNA;Acc:NM_001320209])

HSP 1 Score: 459.529 bits (1181), Expect = 2.191e-151
Identity = 294/650 (45.23%), Postives = 441/650 (67.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT--ISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +  ++VS+    S+N +  + ++ ++++  G F+ G     +   I+I   + VE  ++ K V ++     W + + S    R  +   T+ FE+    A   I I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL IVIF FFL+S + G +L+LGWI+  GA+W+++L+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE  RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  IAM YLL  H+ +GWN
Sbjct:   65 PDRERPWRMFAVSSTESFSMNLTDFRDNALLKLQVGGPFMTGMEGVPAQEYILIQVEQMVEIGSRRKRVQQI--LHNWTIPLHS---KRNDQILTTRTFEM---LAGAPISINVQASLLDNQVVPLSMTHQSLYVTVETQVVIAGVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAFIGDRPNLKTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQVSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQNLRKTGLDFAGFTGYMFLG--ICLVLLTSFPFLRMLYWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKQLRTFQRQISQEDKNWENIIQELQKKHRITDKVLLVKCVSVLSIVIFMFFLNSFVPGIHLELGWIAVLGALWLLILADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTALLIKAVPEAERLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIAMCYLLATHVGLGWN 704          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Match: oca2 (Astyanax mexicanus OCA2 melanosomal transmembrane protein (oca2), mRNA. [Source:RefSeq mRNA;Acc:NM_001320209])

HSP 1 Score: 459.914 bits (1182), Expect = 7.179e-151
Identity = 294/650 (45.23%), Postives = 441/650 (67.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT--ISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +  ++VS+    S+N +  + ++ ++++  G F+ G     +   I+I   + VE  ++ K V ++     W + + S    R  +   T+ FE+    A   I I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL IVIF FFL+S + G +L+LGWI+  GA+W+++L+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE  RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  IAM YLL  H+ +GWN
Sbjct:  126 PDRERPWRMFAVSSTESFSMNLTDFRDNALLKLQVGGPFMTGMEGVPAQEYILIQVEQMVEIGSRRKRVQQI--LHNWTIPLHS---KRNDQILTTRTFEM---LAGAPISINVQASLLDNQVVPLSMTHQSLYVTVETQVVIAGVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAFIGDRPNLKTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQVSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQNLRKTGLDFAGFTGYMFLG--ICLVLLTSFPFLRMLYWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKQLRTFQRQISQEDKNWENIIQELQKKHRITDKVLLVKCVSVLSIVIFMFFLNSFVPGIHLELGWIAVLGALWLLILADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTALLIKAVPEAERLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIAMCYLLATHVGLGWN 765          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Match: oca2 (Astyanax mexicanus OCA2 melanosomal transmembrane protein (oca2), mRNA. [Source:RefSeq mRNA;Acc:NM_001320209])

HSP 1 Score: 459.529 bits (1181), Expect = 9.706e-151
Identity = 294/650 (45.23%), Postives = 441/650 (67.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT--ISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +  ++VS+    S+N +  + ++ ++++  G F+ G     +   I+I   + VE  ++ K V ++     W + + S    R  +   T+ FE+    A   I I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL IVIF FFL+S + G +L+LGWI+  GA+W+++L+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE  RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  IAM YLL  H+ +GWN
Sbjct:  119 PDRERPWRMFAVSSTESFSMNLTDFRDNALLKLQVGGPFMTGMEGVPAQEYILIQVEQMVEIGSRRKRVQQI--LHNWTIPLHS---KRNDQILTTRTFEM---LAGAPISINVQASLLDNQVVPLSMTHQSLYVTVETQVVIAGVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAFIGDRPNLKTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQVSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQNLRKTGLDFAGFTGYMFLG--ICLVLLTSFPFLRMLYWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKQLRTFQRQISQEDKNWENIIQELQKKHRITDKVLLVKCVSVLSIVIFMFFLNSFVPGIHLELGWIAVLGALWLLILADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTALLIKAVPEAERLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIAMCYLLATHVGLGWN 758          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Match: oca2 (Astyanax mexicanus OCA2 melanosomal transmembrane protein (oca2), mRNA. [Source:RefSeq mRNA;Acc:NM_001320209])

HSP 1 Score: 459.529 bits (1181), Expect = 8.284e-150
Identity = 294/650 (45.23%), Postives = 441/650 (67.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT--ISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +  ++VS+    S+N +  + ++ ++++  G F+ G     +   I+I   + VE  ++ K V ++     W + + S    R  +   T+ FE+    A   I I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL IVIF FFL+S + G +L+LGWI+  GA+W+++L+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE  RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  IAM YLL  H+ +GWN
Sbjct:  192 PDRERPWRMFAVSSTESFSMNLTDFRDNALLKLQVGGPFMTGMEGVPAQEYILIQVEQMVEIGSRRKRVQQI--LHNWTIPLHS---KRNDQILTTRTFEM---LAGAPISINVQASLLDNQVVPLSMTHQSLYVTVETQVVIAGVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAFIGDRPNLKTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQVSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQNLRKTGLDFAGFTGYMFLG--ICLVLLTSFPFLRMLYWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKQLRTFQRQISQEDKNWENIIQELQKKHRITDKVLLVKCVSVLSIVIFMFFLNSFVPGIHLELGWIAVLGALWLLILADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTALLIKAVPEAERLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIAMCYLLATHVGLGWN 831          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Match: oca2 (Astyanax mexicanus OCA2 melanosomal transmembrane protein (oca2), mRNA. [Source:RefSeq mRNA;Acc:NM_001320209])

HSP 1 Score: 459.529 bits (1181), Expect = 1.084e-149
Identity = 294/650 (45.23%), Postives = 441/650 (67.85%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT--ISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +  ++VS+    S+N +  + ++ ++++  G F+ G     +   I+I   + VE  ++ K V ++     W + + S    R  +   T+ FE+    A   I I ++   + +  + + +    +  +V  Q++ + +IL GVY LIIF++VHR++AA+LGSLAALA L+ +  RP+L T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A+ I  AS+EE  V+ LL++K + LE  L       Q+ + +   ++   ++E++ K+ I DK LL+KC  VL IVIF FFL+S + G +L+LGWI+  GA+W+++L+D  + E+IL +VEWATL+FFAALF LM  L +L LI +IG + + LI  VPE  RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FF++GFPMML+T  IAM YLL  H+ +GWN
Sbjct:  210 PDRERPWRMFAVSSTESFSMNLTDFRDNALLKLQVGGPFMTGMEGVPAQEYILIQVEQMVEIGSRRKRVQQI--LHNWTIPLHS---KRNDQILTTRTFEM---LAGAPISINVQASLLDNQVVPLSMTHQSLYVTVETQVVIAGVILAGVYVLIIFEIVHRTLAAMLGSLAALAALAFIGDRPNLKTVVEWIDYETLALLFGMMILVAIFSETGFFDYCAVKAYQVSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQNLRKTGLDFAGFTGYMFLG--ICLVLLTSFPFLRMLYWNKKLYNKESSEIVELKHEILVWRQTAHRINPASREETAVKCLLMQKVLNLESLLRKQLRTFQRQISQEDKNWENIIQELQKKHRITDKVLLVKCVSVLSIVIFMFFLNSFVPGIHLELGWIAVLGALWLLILADIQDFEIILHRVEWATLLFFAALFVLMEALAQLQLIDYIGEQTALLIKAVPEAERLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDADVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFRLGFPMMLMTCTIAMCYLLATHVGLGWN 849          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Nematostella
Match: EDO35352 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLS9])

HSP 1 Score: 441.039 bits (1133), Expect = 2.210e-147
Identity = 267/501 (53.29%), Postives = 365/501 (72.85%), Query Frame = 2
Query:  767 LLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYR--IVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNH----MPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            L+ VY LIIF+LVHR+ AA+ G+L ALATLS LN+RPSL  I++W+++DTL+LLFGMM++V +FS+TGFFD++A KA+KI+RG+ W L+ ILC  +A++S FLDNVTT+LL TP+TI+LC+ L +DP  VLIAEV+FSNIGGTATAIGDPPN I+VS+ ++   G++FA FTLH+S+G V  L+    FLR LY      +   + Y   I ELKRE E+WRR+A  + + S EE TV+ LL++K + LE+ +  +++   R  A F E L+E+E+KY I D  LL K   ++C+VI  FF+ S  +   L +GWI+  GAI +++L+D   +E  ++ VEW TL+FFA LF LM+ L  L L+ F+    +  I  V E +RL V++I +LW+SA+ SSFIDNIPFTTAMIP++LEL N     +P+ PLVW LA GACLGGNGTLIGASANVV AG+++Q+GY  +F  FF++GFPMM+ TTL+AM YLL CH V+ W+
Sbjct:   16 LVFVYVLIIFELVHRATAAMFGALLALATLSMLNMRPSLEVILTWIEWDTLSLLFGMMILVAVFSKTGFFDFVALKAYKISRGRVWLLVTILCFATAIISAFLDNVTTILLFTPITIKLCQVLNLDPTYVLIAEVIFSNIGGTATAIGDPPNAIIVSNSQIKKAGIDFAEFTLHISLGIVLCLVLGYGFLRLLYI----PIRLQNVYSPVIAELKREAEIWRRTAERVPLFSAEEKTVKLLLMQKTLMLENNIRNMERKAVREEA-FKENLQELENKYKITDWPLLFKSGSIICVVILLFFIHSFAS-IDLTIGWIAIMGAIALVLLADIDRIEDTMEMVEWTTLVFFAGLFILMKALNSLGLMDFLSNATAEAIQKVDEESRLTVAIIAILWISALASSFIDNIPFTTAMIPVVLELHNKKSLDLPLRPLVWALAMGACLGGNGTLIGASANVVCAGLSEQYGYPLTFNKFFRIGFPMMIATTLVAMGYLLTCHTVLKWD 510          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Medaka
Match: oca2 (OCA2 melanosomal transmembrane protein [Source:NCBI gene;Acc:100049406])

HSP 1 Score: 442.195 bits (1136), Expect = 2.091e-144
Identity = 309/727 (42.50%), Postives = 466/727 (64.10%), Query Frame = 2
Query:  107 DKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT-ISDT---PISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            D+ +D SS  +    +   +   L+     +K  +   + L        K      K   +F I++L ++  ++ P++   +   +VS     S+N +  + ++ ++++  G F  G     S    ++  VE  E+  Q +   R   + ++   V  +  +R  +  VTK FE+    ++  I I I+  + DT   P+S+    +++       I      L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA+FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A  I  AS+EE  V+ LL++K + LE+ L       Q+ + +   ++ + ++E++ K+ I D+ LL+KC  VL +VIF FFL+S I   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFA LF LM  + +L LI FIG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FFK+GFPMM++T +IAM YLL  H+ +GWN
Sbjct:   11 DEPWDSSSLDIERRFRLGSEVASLTRSNSSDKTEAVENLSLSFRLTSSVKCCLRVCKVATIFAIVVLCSLFFSMYPDRDNPWRMLAVSPSDSFSMNVTDFRDNALLKLQVAGPFA-GGMIDLSTQEYILIQVEQTEEPGQRR---RRTQQVIYNWTVP-LHAERSLQRVVTKTFEM---LSSDPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAGII--LCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGMMVLVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYMFLG--ICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAVKCLLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVLVVVIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLFVLMEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFKLGFPMMIMTCMIAMCYLLATHVGLGWN 725          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Medaka
Match: oca2 (OCA2 melanosomal transmembrane protein [Source:NCBI gene;Acc:100049406])

HSP 1 Score: 441.425 bits (1134), Expect = 9.771e-143
Identity = 297/652 (45.55%), Postives = 438/652 (67.18%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT-ISDT---PISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS     S+N +  + ++ ++++  G F  G     S    ++  VE  E+  Q +   R   + ++   V  +  +R  +  VTK FE+    ++  I I I+  + DT   P+S+    +++       I      L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA+FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A  I  AS+EE  V+ LL++K + LE+ L       Q+ + +   ++ + ++E++ K+ I D+ LL+KC  VL +VIF FFL+S I   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFA LF LM  + +L LI FIG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FFK+GFPMM++T +IAM YLL  H+ +GWN
Sbjct:  202 PDRDNPWRMLAVSPSDSFSMNVTDFRDNALLKLQVAGPFA-GGMIDLSTQEYILIQVEQTEEPGQRR---RRTQQVIYNWTVP-LHAERSLQRVVTKTFEM---LSSDPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAGII--LCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGMMVLVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYMFLG--ICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAVKCLLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVLVVVIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLFVLMEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFKLGFPMMIMTCMIAMCYLLATHVGLGWN 841          
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Medaka
Match: oca2 (OCA2 melanosomal transmembrane protein [Source:NCBI gene;Acc:100049406])

HSP 1 Score: 441.039 bits (1133), Expect = 4.261e-142
Identity = 297/652 (45.55%), Postives = 438/652 (67.18%), Query Frame = 2
Query:  332 PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKT-ISDT---PISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHEL-----GIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGN----HMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            P++   +   +VS     S+N +  + ++ ++++  G F  G     S    ++  VE  E+  Q +   R   + ++   V  +  +R  +  VTK FE+    ++  I I I+  + DT   P+S+    +++       I      L GVY LIIF++VHR++AA+LGSLAALA L+ +  RPSL T++ W+D++TL LLFGMM++V IFSETGFFD+ A KA++++RG+ WP++IILC ++A++S FLDNVTT++L TPVTIRLCE L +DP+ VLIAEV+F+NIGG ATA+GDPPNVI+VS++ L   G++FA+FT +M +G    L+    F        +  + + ++  IVELK EI VWR++A  I  AS+EE  V+ LL++K + LE+ L       Q+ + +   ++ + ++E++ K+ I D+ LL+KC  VL +VIF FFL+S I   +LDLGWI+  GA+W++VL+D  + E+IL +VEWATL+FFA LF LM  + +L LI FIG + + LI  VPE+ RL +++I+V+W+SA+ SS IDNIPFT  MIP+++ L      ++P+ PL++ LA GACLGGNGTLIGASANVV AGIA+QHGY FSFM+FFK+GFPMM++T +IAM YLL  H+ +GWN
Sbjct:  255 PDRDNPWRMLAVSPSDSFSMNVTDFRDNALLKLQVAGPFA-GGMIDLSTQEYILIQVEQTEEPGQRR---RRTQQVIYNWTVP-LHAERSLQRVVTKTFEM---LSSDPIAITIQAFLQDTEVVPLSMTHQSLYVTMETQVAIAGII--LCGVYILIIFEIVHRTLAAMLGSLAALAALAVIGNRPSLVTVVEWIDYETLALLFGMMVLVAIFSETGFFDYCAVKAYQLSRGRVWPMIIILCLIAAILSAFLDNVTTMMLFTPVTIRLCEVLNLDPRHVLIAEVIFTNIGGAATAVGDPPNVIIVSNQGLRREGIDFASFTGYMFLG--ICLVLLTSFPFLRLLYWNKKLYNKESIEIVELKHEILVWRQTAQRINPASREETAVKCLLMQKVLTLENLLRKMMKTFQRQISQEDKNWEQNIQELQKKHRITDRVLLVKCVSVLVVVIFVFFLNSFIPSIHLDLGWIAILGALWLLVLADIQDFEIILHRVEWATLLFFAGLFVLMEAIAQLQLIDFIGEQTALLIKAVPEDQRLAIAIILVMWVSALASSLIDNIPFTATMIPVLINLSQDSDVNLPVKPLIFALAMGACLGGNGTLIGASANVVCAGIAEQHGYGFSFMEFFKLGFPMMIMTCMIAMCYLLATHVGLGWN 894          
BLAST of OCA2 melanosomal transmembrane protein vs. Planmine SMEST
Match: SMESG000080562.1 (SMESG000080562.1)

HSP 1 Score: 1291.17 bits (3340), Expect = 0.000e+0
Identity = 737/739 (99.73%), Postives = 737/739 (99.73%), Query Frame = 2
Query:   32 MNHYKPKYKHNSPFIPLEACTDIDDDKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCXXXXXXXXXXXNPEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAXXXXXXXXXXXXXLLGVYGLIIFDLVHRXXXXXXXXXXXXXXXXXXNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNXXXXXXXXXXXIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGXXXXXXXXXXXXXXXXXXXXXTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVXXXXXXXXXXTGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATXXXXXXXXXXMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 2248
            MNHYKPKYKHNSPFIPLEACTDIDDDKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCILILITILIAINPEQHFDYHDYSVSNIFPQSINRSIPKKSS VRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKS FRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAYSVYYQIIYSSIILLGVYGLIIFDLVHRSIAAILGSLAALATLSTLNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNVTTVLLLTPVTIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGSVFILIFSLLFLRFLYRDLSSTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVIFSFFLSSIITGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATLIFFAALFALMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN
Sbjct:    1 MNHYKPKYKHNSPFIPLEACTDIDDDKMYDESSTLLHNNRKRALDFDELSVDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCILILITILIAINPEQHFDYHDYSVSNIFPQSINRSIPKKSSTVRVRFRGSFVLGNRPQYSNISIVISNVECVEKSNQSKSAFRLGCKEVWPLKVSSVDIDREQETYVTKYFEVEPKFANGEIKIEIKTISDTPISIGINIIFMAYSVYYQIIYSSIILLGVYGLIIFDLVHRSIAAILGSLAALATLSTLNLRPSLATIISWLDFDTLNLLFGMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDNVTTVLLLTPVTIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVILVSSKELNDNGVNFANFTLHMSVGSVFILIFSLLFLRFLYRDLSSTVGDDDTYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQKHVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVIFSFFLSSIITGFYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATLIFFAALFALMRELEELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFTTAMIPIILELGNHMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQHGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN 739          
The following BLAST results are available for this feature:
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OCA22.230e-15445.81OCA2 melanosomal transmembrane protein [Source:HGN... [more]
OCA23.763e-15043.68OCA2 melanosomal transmembrane protein [Source:HGN... [more]
OCA21.819e-10843.21OCA2 melanosomal transmembrane protein [Source:HGN... [more]
OCA26.667e-10440.74OCA2 melanosomal transmembrane protein [Source:HGN... [more]
OCA29.040e-2062.20OCA2 melanosomal transmembrane protein [Source:HGN... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoe13.751e-13341.06gene:FBgn0041150 transcript:FBtr0336833[more]
hoe11.321e-13141.45gene:FBgn0041150 transcript:FBtr0077397[more]
hoe12.323e-13141.45gene:FBgn0041150 transcript:FBtr0336834[more]
hoe12.323e-13141.45gene:FBgn0041150 transcript:FBtr0077400[more]
hoe12.323e-13141.45gene:FBgn0041150 transcript:FBtr0077399[more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oca25.448e-15045.16oculocutaneous albinism II [Source:ZFIN;Acc:ZDB-GE... [more]
oca21.106e-14945.16oculocutaneous albinism II [Source:ZFIN;Acc:ZDB-GE... [more]
CR381602.12.276e-14945.16oculocutaneous albinism II [Source:NCBI gene;Acc:5... [more]
CR381602.13.361e-14945.16oculocutaneous albinism II [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
creb11.357e-14449.04cAMP responsive element binding protein 1 [Source:... [more]
creb11.608e-14449.04cAMP responsive element binding protein 1 [Source:... [more]
creb11.252e-13448.60cAMP responsive element binding protein 1 [Source:... [more]
creb11.964e-13452.68cAMP responsive element binding protein 1 [Source:... [more]
creb13.291e-13448.60cAMP responsive element binding protein 1 [Source:... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oca26.643e-15549.91oculocutaneous albinism II [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q62052|P_MOUSE4.647e-15449.91P protein OS=Mus musculus OX=10090 GN=Oca2 PE=1 SV... [more]
sp|Q04671|P_HUMAN1.071e-15345.81P protein OS=Homo sapiens OX=9606 GN=OCA2 PE=1 SV=... [more]
sp|Q8MIQ9|P_PIG1.527e-15350.98P protein OS=Sus scrofa OX=9823 GN=Oca2 PE=2 SV=3[more]
sp|P0A607|Y2703_MYCBO3.722e-4333.11Uncharacterized transporter Mb2703 OS=Mycobacteriu... [more]
sp|P9WPD9|Y2684_MYCTU3.722e-4333.11Uncharacterized transporter Rv2684 OS=Mycobacteriu... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JEV54.785e-17747.67CitMHS domain-containing protein OS=Macrostomum li... [more]
A0A1S3HVT17.297e-17349.55P protein-like isoform X2 OS=Lingula unguis OX=757... [more]
A0A1S3HYI11.195e-17249.55P protein-like isoform X1 OS=Lingula unguis OX=757... [more]
A0A093PJA62.721e-15743.84P protein (Fragment) OS=Pygoscelis adeliae OX=9238... [more]
A0A091VTZ85.469e-15744.52P protein (Fragment) OS=Opisthocomus hoazin OX=304... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oca22.191e-15145.23Astyanax mexicanus OCA2 melanosomal transmembrane ... [more]
oca27.179e-15145.23Astyanax mexicanus OCA2 melanosomal transmembrane ... [more]
oca29.706e-15145.23Astyanax mexicanus OCA2 melanosomal transmembrane ... [more]
oca28.284e-15045.23Astyanax mexicanus OCA2 melanosomal transmembrane ... [more]
oca21.084e-14945.23Astyanax mexicanus OCA2 melanosomal transmembrane ... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO353522.210e-14753.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
oca22.091e-14442.50OCA2 melanosomal transmembrane protein [Source:NCB... [more]
oca29.771e-14345.55OCA2 melanosomal transmembrane protein [Source:NCB... [more]
oca24.261e-14245.55OCA2 melanosomal transmembrane protein [Source:NCB... [more]
back to top
BLAST of OCA2 melanosomal transmembrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080562.10.000e+099.73SMESG000080562.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033373 ID=SMED30033373|Name=OCA2 melanosomal transmembrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2326bp
ATCTATATAAATCTTATATGTAACTTTTGGAATGAATCATTATAAACCAA
AATATAAGCATAATTCACCATTTATACCTCTTGAAGCATGTACAGATATA
GATGATGATAAAATGTATGATGAAAGTTCGACTTTATTACATAATAATCG
CAAACGAGCTTTGGATTTTGATGAACTAAGTGTTGATGAAATTCCGAATA
AACGCAGAAGTTTCCTAGAAATTGTGTTACAGAAATTATCAAAACTCAAA
ACCAAAAATCTTTTTAACGATATTAAATGTGGATTTGTTTTTTGCATTCT
TATATTAATAACCATTTTAATAGCTATAAATCCCGAACAACATTTTGATT
ATCACGATTATAGTGTTTCAAATATTTTCCCCCAGTCAATTAATAGGTCT
ATTCCTAAGAAGTCGTCGGCTGTTCGTGTAAGATTTCGTGGCTCATTTGT
GCTAGGAAACAGGCCACAATATTCCAACATTTCTATTGTAATTTCAAATG
TGGAATGTGTTGAAAAATCTAATCAAAGTAAAAGTGTGTTTAGACTCGGA
TGTAAAGAAGTCTGGCCACTTAAGGTATCAAGTGTAGATATTGACAGAGA
ACAAGAAACGTATGTTACGAAATATTTTGAAGTAGAACCGAAATTTGCTA
ATGGAGAAATTAAAATAGAAATAAAGACAATATCCGATACTCCTATTTCT
ATTGGAATAAATATTATTTTTATGGCCTATTCAGTTTACTATCAAATTAT
ATATTCATCTATTATATTACTTGGGGTCTATGGGTTGATCATTTTTGATC
TTGTCCATCGGTCGATTGCTGCTATTTTAGGTTCTCTTGCAGCTCTGGCC
ACTTTGTCTACTTTGAATTTGAGACCTTCTCTTGCGACCATAATATCCTG
GTTGGATTTCGATACTTTGAATTTGCTTTTTGGGATGATGTTAATTGTGG
GAATTTTCTCTGAAACTGGTTTTTTCGATTGGATTGCTTTTAAGGCATTT
AAAATAGCTCGTGGTAAACCGTGGCCATTATTAATAATATTGTGTACAGT
ATCCGCGGTTGTATCGGGATTTCTAGACAATGTGACAACAGTGTTATTAC
TAACCCCTGTTACTATCAGATTGTGTGAAGCTTTGAAAATGGATCCTAAA
AGAGTATTAATTGCTGAAGTGTTATTTTCAAATATTGGTGGAACTGCAAC
TGCTATAGGTGATCCACCGAATGTCATATTAGTTTCTTCTAAAGAACTGA
ATGATAATGGAGTTAACTTTGCAAATTTTACTCTTCATATGAGTGTTGGA
TCAGTTTTTATTCTCATTTTCTCTCTGCTATTTTTAAGATTTTTATATCG
AGATTTATCAAGCACAGTTGGAGACGATGACACTTACAGAATTGTTGAAT
TAAAAAGAGAAATTGAAGTCTGGCGAAGGAGTGCTTACACAATTACAATA
GCATCCCAAGAAGAAGCCACAGTCCGAGCATTGTTGTTAGAAAAGGCTGT
TCAACTTGAACATGAACTTGGAATTCAAAAACATGTTCGAAGGCCGTCGG
CACATTTTCATGAAACTCTTAAGGAAATGGAAGATAAATATTGTATCAAA
GATAAGTGGCTTTTGATAAAGTGCTCTATCGTACTTTGTATAGTCATTTT
TTCTTTTTTTCTTTCGTCGATCATAACTGGATTTTACTTAGATTTAGGTT
GGATATCGTTTTTTGGTGCTATTTGGATTATTGTTTTGTCCGATTTTGCC
AATTTAGAAGTTATTCTAGACAAAGTTGAATGGGCTACTTTGATATTTTT
CGCAGCTCTTTTTGCATTAATGAGAGAATTAGAAGAATTACATTTAATAA
CATTTATTGGTCGTGAAATTTCCAATTTAATTCTGATGGTACCAGAAAAT
AACCGTTTATTGGTCAGTTTAATTGTAGTATTATGGATGTCTGCCATAAT
TTCAAGCTTCATTGACAATATTCCCTTTACAACTGCAATGATACCTATTA
TTCTTGAATTAGGTAATCATATGCCTATTCTACCATTGGTGTGGGGTCTT
GCTTTTGGAGCTTGTTTGGGGGGTAATGGTACACTAATTGGTGCTTCAGC
TAATGTTGTTGTTGCTGGTATTGCTCAACAACATGGATACAGTTTTTCCT
TCATGGATTTTTTCAAAGTGGGATTTCCGATGATGTTGCTGACCACACTG
ATTGCCATGATATATTTATTAATTTGTCATATTGTAATAGGCTGGAATTA
AAATTAAGAGGAAATGTGACTATTTTAATAATTTTTTGAGTTATACTTTC
TGTATTATATATATCTAATAAACAGA
back to top

protein sequence of SMED30033373-orf-1

>SMED30033373-orf-1 ID=SMED30033373-orf-1|Name=SMED30033373-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MTFGGSPIAVAVPPIFENNTSAINTLLGSIFKASHNLIVTGVSNNTVVTL
SRNPDTTADTVHNIINNGHGLPRAILNALKAIQSKKPVSEKIPTINIIPK
SKFKVSKSNQDIMVAREGLKFKVDKVARAAREPKIAAIDRWTRSKMINP*
back to top

protein sequence of SMED30033373-orf-2

>SMED30033373-orf-2 ID=SMED30033373-orf-2|Name=SMED30033373-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=740bp
MNHYKPKYKHNSPFIPLEACTDIDDDKMYDESSTLLHNNRKRALDFDELS
VDEIPNKRRSFLEIVLQKLSKLKTKNLFNDIKCGFVFCILILITILIAIN
PEQHFDYHDYSVSNIFPQSINRSIPKKSSAVRVRFRGSFVLGNRPQYSNI
SIVISNVECVEKSNQSKSVFRLGCKEVWPLKVSSVDIDREQETYVTKYFE
VEPKFANGEIKIEIKTISDTPISIGINIIFMAYSVYYQIIYSSIILLGVY
GLIIFDLVHRSIAAILGSLAALATLSTLNLRPSLATIISWLDFDTLNLLF
GMMLIVGIFSETGFFDWIAFKAFKIARGKPWPLLIILCTVSAVVSGFLDN
VTTVLLLTPVTIRLCEALKMDPKRVLIAEVLFSNIGGTATAIGDPPNVIL
VSSKELNDNGVNFANFTLHMSVGSVFILIFSLLFLRFLYRDLSSTVGDDD
TYRIVELKREIEVWRRSAYTITIASQEEATVRALLLEKAVQLEHELGIQK
HVRRPSAHFHETLKEMEDKYCIKDKWLLIKCSIVLCIVIFSFFLSSIITG
FYLDLGWISFFGAIWIIVLSDFANLEVILDKVEWATLIFFAALFALMREL
EELHLITFIGREISNLILMVPENNRLLVSLIVVLWMSAIISSFIDNIPFT
TAMIPIILELGNHMPILPLVWGLAFGACLGGNGTLIGASANVVVAGIAQQ
HGYSFSFMDFFKVGFPMMLLTTLIAMIYLLICHIVIGWN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005765lysosomal membrane
GO:0005789endoplasmic reticulum membrane
GO:0010008endosome membrane
GO:0033162melanosome membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007286spermatid development
GO:0008283cell proliferation
GO:0030318melanocyte differentiation
GO:0042438melanin biosynthetic process
GO:0043473pigmentation
GO:0048066developmental pigmentation
GO:0055085transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004680Cit_transptr-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004680Citrate transporter-like domainPFAMPF03600CitMHScoord: 255..680
e-value: 9.5E-55
score: 185.9
NoneNo IPR availablePANTHERPTHR43568FAMILY NOT NAMEDcoord: 85..743
NoneNo IPR availableCDDcd01116P_permeasecoord: 250..734
e-value: 8.58074E-138
score: 410.105
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 653..675
NoneNo IPR availableTMHMMTMhelixcoord: 265..282
NoneNo IPR availableTMHMMTMhelixcoord: 561..583
NoneNo IPR availableTMHMMTMhelixcoord: 630..648
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 239..258
NoneNo IPR availableTMHMMTMhelixcoord: 719..741
NoneNo IPR availableTMHMMTMhelixcoord: 337..359
NoneNo IPR availableTMHMMTMhelixcoord: 420..442
NoneNo IPR availableTMHMMTMhelixcoord: 535..557
NoneNo IPR availableTMHMMTMhelixcoord: 682..704