Leukotriene A-4 hydrolase

Overview
NameLeukotriene A-4 hydrolase
Smed IDSMED30033366
Length (bp)2516
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leukotriene A-4 hydrolase (SMED30033366) t-SNE clustered cells

Violin plots show distribution of expression levels for Leukotriene A-4 hydrolase (SMED30033366) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leukotriene A-4 hydrolase (SMED30033366) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leukotriene A-4 hydrolase (SMED30033366) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033366

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30033366h1SMcG0019728 Contig44829newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033366h1SMcG0019728 Contig44829uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30033366h1SMcG0019728 dd_Smed_v6_3027_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermis progenitor cellSMED30033366h1SMcG0019728 dd_Smed_v4_3027_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 444.506 bits (1142), Expect = 7.456e-146
Identity = 245/599 (40.90%), Postives = 352/599 (58.76%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    ++G+    V+      + L+LD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R   T   +    + +KF QK+PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH +   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLFYLE L+G  ++ L +LK Y+  F  KS++TD+WK F + Y  +K  V    L  + W+ W Y PG  PI+ +   D ++   C  L + WI      +++ + LN F+    D +      LN+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + V  +   K +MHP+T
Sbjct:   23 HLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEV--KYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFNALGGWGELQNSVK----TFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPN--YDMTLTNACIALSQRWI------TAKEDDLNSFNAT--DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 433.721 bits (1114), Expect = 5.734e-142
Identity = 239/568 (42.08%), Postives = 340/568 (59.86%), Query Frame = 1
Query:  403 ILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            +LD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R   T   +    + +KF QK+PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH +   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLFYLE L+G  ++ L +LK Y+  F  KS++TD+WK F + Y  +K  V    L  + W+ W Y PG  PI+ +   D ++   C  L + WI      +++ + LN F+    D +      LN+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + V  +   K +MHP+T
Sbjct:   30 VLDTKDLTIEKVVINGQEV--KYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFNALGGWGELQNSVK----TFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPN--YDMTLTNACIALSQRWI------TAKEDDLNSFNAT--DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT 576          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 385.571 bits (989), Expect = 1.913e-124
Identity = 208/454 (45.81%), Postives = 288/454 (63.44%), Query Frame = 1
Query:  403 ILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFS 1737
            +LD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R   T   +    + +KF QK+PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH +   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLFYLE L+G  ++ L +LK Y+  F  KS++TD+WK F + Y  +K  V    L  + W+ W Y PG  PI+ +   D ++   C  L + WI      +++ + LN F+
Sbjct:   30 VLDTKDLTIEKVVINGQEV--KYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFNALGGWGELQNSVKT----FGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPN--YDMTLTNACIALSQRWI------TAKEDDLNSFN 464          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Match: RNPEP (arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:10078])

HSP 1 Score: 316.62 bits (810), Expect = 1.664e-96
Identity = 211/642 (32.87%), Postives = 327/642 (50.93%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFE-------NEQISGSVVHNVKVLN-SASKELILD------VRNLEIKRIVIDNEDVLFQYVN------GKLGGKLVIPLSLGTKRS-KFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRML---PDQRYYFFQVLNDI-QGVQLPESSLKVMGNIY-GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDD-TKSRTVENFHIQKFAMHPITRGEIHKIIFPR 2097
            D  S +N   F +   H + + +F        +  +SG+ V +++ L    + EL LD      V    ++R    +E+   + V+         G  L +      + + + QV++ Y    +   + W+ PE T GKK  F+Y+Q QA+  R+ +PC DTP VK  YSA IE P     VMSA   S+       +  F+   PIPSYL+++A G LV +++GPRS V++EP L + A+ E+   IE+ L   E+L GPY W   DLL +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEISHSW GNLVTN+ W  FW+NEG T Y +R I   L  +  Y  L    G + L   ++    I G ++   KL   +  G DPDD+++  PYEKG   + YL  L+G +D+   +LK Y+  F+ +S+  D++  F+ +Y  E +K     + G ++D W   PG  P        DS+++   EL + W        +  EL  K    +   P + Y     L+ I Q   LP  ++K +G+ Y  ++N  N+EL   W  + L++ +     +V EFL++QG+ KY   LY  +    +  ++   E F      +H      + +I+ P+
Sbjct:   24 DVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLSGTAVLDLRCLEPEGAAELRLDSHPCLEVTAAALRRERPGSEEPPAEPVSFYTQPFSHYGQALCVSFPQPCRAAERLQVLLTYRV-GEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSA---STWEKRGPNKFFFQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAA-YTCLEAATGRALLRQHMD----ITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFDRWLNTPGWPPYLPDLSPGDSLMKPAEELAQLW--------AAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGGSEVAQTLAKETFASTASQLHSNVVNYVQQIVAPK 648          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Match: RNPEP (arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:10078])

HSP 1 Score: 269.24 bits (687), Expect = 2.697e-82
Identity = 143/325 (44.00%), Postives = 198/325 (60.92%), Query Frame = 1
Query:  586 WMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEK 1551
            W+ PE T GKK  F+Y+Q QA+  R+ +PC DTP VK  YSA IE P     VMSA   S+       +  F+   PIPSYL+++A G LV +++GPRS V++EP L + A+ E+   IE+ L   E+L GPY W   DLL +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEISHSW GNLVTN+ W  FW+NEG T Y +R I   L  +  Y  L    G + L   ++    I G ++   KL   +  G DPDD+++  PYEKG   + YL  L+G +D+   +LK Y+  F+ +S+  D++  F+ +Y  E +K
Sbjct:   21 WLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSA---STWEKRGPNKFFFQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAA-YTCLEAATGRALLRQHMD----ITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKK 337          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 416.001 bits (1068), Expect = 3.053e-135
Identity = 233/617 (37.76%), Postives = 343/617 (55.59%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVID--NEDVLFQYV---NGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD-KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D ++ AN E   V      WK+DFE + I+G V   + V    ++ ++LD R+L ++ + ++   E     +    N  LG KLVI         +  + I+Y ++N++ ALQ++  E T  +   +L+SQ QAINARS+ PC DTP VK+TY A +  P  L  +MSA+ + ST S   ++    F+Q + IPSYL++I  GHL   +I  R  V++EP   E +  EF + EKIL +AE++ GPY W   DL++LP +FP+GGMENPC+ F+TP LL GD+S +N IAHEISHSWTGNLVTN +W+HFW+NEG T +LER I  K+   E  R      G    E  +     ++GPDHE+TKLV NL   DPDD+FS VPYEKGS LLF +E  +G + +  ++L+ YI  +  K+VST+EWK + +    +K+ +    L+ I W+ W +K G  P   +   D + +Q C +L   W        ++ E+  K S           +V   + G ++P      +   Y L    N+EL   W +L L + + P VD    F  + GR+KY K +Y+ L+ W  T+ R +  F      MHPIT   I  ++
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITLDV-KQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRVAPYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYE--EALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLHKAGLPPKPKY---DSTPMQACKDLAAKWTTEGSEAPTDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMP-----ALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGWSATRDRAISQFKANIPNMHPITVKAIQSLL 608          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 416.001 bits (1068), Expect = 3.053e-135
Identity = 233/617 (37.76%), Postives = 343/617 (55.59%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVID--NEDVLFQYV---NGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD-KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D ++ AN E   V      WK+DFE + I+G V   + V    ++ ++LD R+L ++ + ++   E     +    N  LG KLVI         +  + I+Y ++N++ ALQ++  E T  +   +L+SQ QAINARS+ PC DTP VK+TY A +  P  L  +MSA+ + ST S   ++    F+Q + IPSYL++I  GHL   +I  R  V++EP   E +  EF + EKIL +AE++ GPY W   DL++LP +FP+GGMENPC+ F+TP LL GD+S +N IAHEISHSWTGNLVTN +W+HFW+NEG T +LER I  K+   E  R      G    E  +     ++GPDHE+TKLV NL   DPDD+FS VPYEKGS LLF +E  +G + +  ++L+ YI  +  K+VST+EWK + +    +K+ +    L+ I W+ W +K G  P   +   D + +Q C +L   W        ++ E+  K S           +V   + G ++P      +   Y L    N+EL   W +L L + + P VD    F  + GR+KY K +Y+ L+ W  T+ R +  F      MHPIT   I  ++
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITLDV-KQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRVAPYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYE--EALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLHKAGLPPKPKY---DSTPMQACKDLAAKWTTEGSEAPTDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMP-----ALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGWSATRDRAISQFKANIPNMHPITVKAIQSLL 608          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 412.535 bits (1059), Expect = 6.689e-134
Identity = 233/617 (37.76%), Postives = 343/617 (55.59%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVID--NEDVLFQYV---NGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD-KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D ++ AN E   V      WK+DFE + I+G V   + V    ++ ++LD R+L ++ + ++   E     +    N  LG KLVI         +  + I+Y ++N++ ALQ++  E T  +   +L+SQ QAINARS+ PC DTP VK+TY A +  P  L  +MSA+ + ST S   ++    F+Q + IPSYL++I  GHL   +I  R  V++EP   E +  EF + EKIL +AE++ GPY W   DL++LP +FP+GGMENPC+ F+TP LL GD+S +N IAHEISHSWTGNLVTN +W+HFW+NEG T +LER I  K+   E  R      G    E  +     ++GPDHE+TKLV NL   DPDD+FS VPYEKGS LLF +E  +G + +  ++L+ YI  +  K+VST+EWK + +    +K+ +    L+ I W+ W +K G  P   +   D + +Q C +L   W        ++ E+  K S           +V   + G ++P      +   Y L    N+EL   W +L L + + P VD    F  + GR+KY K +Y+ L+ W  T+ R +  F      MHPIT   I  ++
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITLDV-KQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRA-PYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYE--EALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLHKAGLPPKPKY---DSTPMQACKDLAAKWTTEGSEAPTDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMP-----ALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGWSATRDRAISQFKANIPNMHPITVKAIQSLL 607          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 412.535 bits (1059), Expect = 6.689e-134
Identity = 233/617 (37.76%), Postives = 343/617 (55.59%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVID--NEDVLFQYV---NGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD-KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D ++ AN E   V      WK+DFE + I+G V   + V    ++ ++LD R+L ++ + ++   E     +    N  LG KLVI         +  + I+Y ++N++ ALQ++  E T  +   +L+SQ QAINARS+ PC DTP VK+TY A +  P  L  +MSA+ + ST S   ++    F+Q + IPSYL++I  GHL   +I  R  V++EP   E +  EF + EKIL +AE++ GPY W   DL++LP +FP+GGMENPC+ F+TP LL GD+S +N IAHEISHSWTGNLVTN +W+HFW+NEG T +LER I  K+   E  R      G    E  +     ++GPDHE+TKLV NL   DPDD+FS VPYEKGS LLF +E  +G + +  ++L+ YI  +  K+VST+EWK + +    +K+ +    L+ I W+ W +K G  P   +   D + +Q C +L   W        ++ E+  K S           +V   + G ++P      +   Y L    N+EL   W +L L + + P VD    F  + GR+KY K +Y+ L+ W  T+ R +  F      MHPIT   I  ++
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITLDV-KQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRA-PYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYE--EALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLHKAGLPPKPKY---DSTPMQACKDLAAKWTTEGSEAPTDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMP-----ALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGWSATRDRAISQFKANIPNMHPITVKAIQSLL 607          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 412.535 bits (1059), Expect = 6.689e-134
Identity = 233/617 (37.76%), Postives = 343/617 (55.59%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVID--NEDVLFQYV---NGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD-KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D ++ AN E   V      WK+DFE + I+G V   + V    ++ ++LD R+L ++ + ++   E     +    N  LG KLVI         +  + I+Y ++N++ ALQ++  E T  +   +L+SQ QAINARS+ PC DTP VK+TY A +  P  L  +MSA+ + ST S   ++    F+Q + IPSYL++I  GHL   +I  R  V++EP   E +  EF + EKIL +AE++ GPY W   DL++LP +FP+GGMENPC+ F+TP LL GD+S +N IAHEISHSWTGNLVTN +W+HFW+NEG T +LER I  K+   E  R      G    E  +     ++GPDHE+TKLV NL   DPDD+FS VPYEKGS LLF +E  +G + +  ++L+ YI  +  K+VST+EWK + +    +K+ +    L+ I W+ W +K G  P   +   D + +Q C +L   W        ++ E+  K S           +V   + G ++P      +   Y L    N+EL   W +L L + + P VD    F  + GR+KY K +Y+ L+ W  T+ R +  F      MHPIT   I  ++
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITLDV-KQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRA-PYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYE--EALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLHKAGLPPKPKY---DSTPMQACKDLAAKWTTEGSEAPTDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMP-----ALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGWSATRDRAISQFKANIPNMHPITVKAIQSLL 607          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0089314)

HSP 1 Score: 391.349 bits (1004), Expect = 1.182e-125
Identity = 219/618 (35.44%), Postives = 351/618 (56.80%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVI---DNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLR-WLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLN----KFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +SY+  +    + S  NWK+DF   +I GSV+H  KVL +   +++LDVR++ +    +    +E  +  +++     +G KL + L  GT +    V I+Y T++ ++ LQW+ P  T+GK+H +++SQ QAI+ARS+ PCQDTP VK TY AT+E PS+L  +MSA+        +  +  F+Q++PIP+YLV+IA G LV   +G  S+V++E  + +    EF +   +L  A ELCGPY W+  DLL++PPSFP+GGMENPC+ F+TP LL GDKS  + +AHEI+HSWTGNLVTN  ++HFW+NEG T ++E  I+ ++Q ++      +   +++L+  +   Q+   P  E TKLV +L    PDD+FS VPY KGS  L YLE L G   +   +L+ Y+  +  KS+ T ++++  + Y I+ +K +  KL  + WD W    G  P+  +   D+S+     EL   W        S  EL +    K +  +     +  +++     V L E  + ++ + Y L ++ N+E+    + L +R+  +  +D++ EF NS  R+K+ + +Y+ L  W + K   + NF   K  M  +    I K
Sbjct:    8 DPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALIDK----KEPGKTLFKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKEL-DFKMLSNLTDLQECIRT-QLNKTP--ELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDKKD--KLSAVDWDLWLKSEGMPPVIPN--FDESLANVTKELASLWSS-----KSVAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWPEAKPAAIRNFVNVKDQMMAVCSHTIEK 608          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0089315)

HSP 1 Score: 391.349 bits (1004), Expect = 1.182e-125
Identity = 219/618 (35.44%), Postives = 351/618 (56.80%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVI---DNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLR-WLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLN----KFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +SY+  +    + S  NWK+DF   +I GSV+H  KVL +   +++LDVR++ +    +    +E  +  +++     +G KL + L  GT +    V I+Y T++ ++ LQW+ P  T+GK+H +++SQ QAI+ARS+ PCQDTP VK TY AT+E PS+L  +MSA+        +  +  F+Q++PIP+YLV+IA G LV   +G  S+V++E  + +    EF +   +L  A ELCGPY W+  DLL++PPSFP+GGMENPC+ F+TP LL GDKS  + +AHEI+HSWTGNLVTN  ++HFW+NEG T ++E  I+ ++Q ++      +   +++L+  +   Q+   P  E TKLV +L    PDD+FS VPY KGS  L YLE L G   +   +L+ Y+  +  KS+ T ++++  + Y I+ +K +  KL  + WD W    G  P+  +   D+S+     EL   W        S  EL +    K +  +     +  +++     V L E  + ++ + Y L ++ N+E+    + L +R+  +  +D++ EF NS  R+K+ + +Y+ L  W + K   + NF   K  M  +    I K
Sbjct:    8 DPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALIDK----KEPGKTLFKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKEL-DFKMLSNLTDLQECIRT-QLNKTP--ELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDKKD--KLSAVDWDLWLKSEGMPPVIPN--FDESLANVTKELASLWSS-----KSVAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWPEAKPAAIRNFVNVKDQMMAVCSHTIEK 608          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0347402)

HSP 1 Score: 390.578 bits (1002), Expect = 1.606e-124
Identity = 219/618 (35.44%), Postives = 350/618 (56.63%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVI---DNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLR-WLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLN----KFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +SY+  +    + S  NWK+DF   +I GSV+H  KVL +   +++LDVR++ +    +    +E  +  +++     +G KL + L  GT +    V I+Y T++ ++ LQW+ P  T+GK+H +++SQ QAI+ARS+ PCQDTP VK TY AT+E PS+L  +MSA+         +    F+Q++PIP+YLV+IA G LV   +G  S+V++E  + +    EF +   +L  A ELCGPY W+  DLL++PPSFP+GGMENPC+ F+TP LL GDKS  + +AHEI+HSWTGNLVTN  ++HFW+NEG T ++E  I+ ++Q ++      +   +++L+  +   Q+   P  E TKLV +L    PDD+FS VPY KGS  L YLE L G   +   +L+ Y+  +  KS+ T ++++  + Y I+ +K +  KL  + WD W    G  P+  +   D+S+     EL   W        S  EL +    K +  +     +  +++     V L E  + ++ + Y L ++ N+E+    + L +R+  +  +D++ EF NS  R+K+ + +Y+ L  W + K   + NF   K  M  +    I K
Sbjct:   79 DPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALIDKKEPGKTL----FKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKEL-DFKMLSNLTDLQECIRT-QLNKTP--ELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDKKD--KLSAVDWDLWLKSEGMPPVIPN--FDESLANVTKELASLWSS-----KSVAELADSAEIKTTISIHQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWPEAKPAAIRNFVNVKDQMMAVCSHTIEK 679          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Match: CG46339 (gene:FBgn0285963 transcript:FBtr0472698)

HSP 1 Score: 93.5893 bits (231), Expect = 3.792e-19
Identity = 84/353 (23.80%), Postives = 143/353 (40.51%), Query Frame = 1
Query:  625 FLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSST--LSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIG-------PRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQL-----------NYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILE----KLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG 1608
             + +Q   ++AR  +PC D P +K  +S +I  P   ++ +S + KS +        +  FE    +P+YLV+    ++V S++        PR  +++ P+        ++ + K L   E+  G         L+  P F +  MEN   I F    LL  +  QL             IAHE++H W GNLVT   WD  W+ EG   Y+    LE    + QS +    L     + E + D   + I +  D   T  V  +        F  + Y KG++LL  L +++G        +  +  F   ++  D+      ++  E+  +          D W  +PG
Sbjct:  426 MISTQFSPVDARRAFPCFDRPDMKANFSISIVRPMQFKMALSNMPKSGSRRFRRGFIRDDFETTPKMPTYLVAFIVSNMVDSRLASQDSGLTPRVEIWTRPQFVGMTHYAYKMVRKFLPYYEDFFGIKNKLPKIDLVSVPDFGFAAMENWGLITFRDSALLVPEDLQLASSSEHMQVVAGIIAHELAHQWFGNLVTPKWWDDLWLKEGFACYMSYKALEHAHPEFQSMDTLTMLEFKESM-EHDADNTSHAISF--DVRSTNDVRRI--------FDPISYSKGTILLRMLNSIVGDVAFRSATRDLLKKFAYGNMDRDDLWAMLTRHGHEQGTLPKDLSVKQIMDSWITQPG 767          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Match: CG46339 (gene:FBgn0285963 transcript:FBtr0472697)

HSP 1 Score: 93.5893 bits (231), Expect = 4.026e-19
Identity = 84/353 (23.80%), Postives = 143/353 (40.51%), Query Frame = 1
Query:  625 FLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSST--LSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIG-------PRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQL-----------NYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILE----KLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG 1608
             + +Q   ++AR  +PC D P +K  +S +I  P   ++ +S + KS +        +  FE    +P+YLV+    ++V S++        PR  +++ P+        ++ + K L   E+  G         L+  P F +  MEN   I F    LL  +  QL             IAHE++H W GNLVT   WD  W+ EG   Y+    LE    + QS +    L     + E + D   + I +  D   T  V  +        F  + Y KG++LL  L +++G        +  +  F   ++  D+      ++  E+  +          D W  +PG
Sbjct:  315 MISTQFSPVDARRAFPCFDRPDMKANFSISIVRPMQFKMALSNMPKSGSRRFRRGFIRDDFETTPKMPTYLVAFIVSNMVDSRLASQDSGLTPRVEIWTRPQFVGMTHYAYKMVRKFLPYYEDFFGIKNKLPKIDLVSVPDFGFAAMENWGLITFRDSALLVPEDLQLASSSEHMQVVAGIIAHELAHQWFGNLVTPKWWDDLWLKEGFACYMSYKALEHAHPEFQSMDTLTMLEFKESM-EHDADNTSHAISF--DVRSTNDVRRI--------FDPISYSKGTILLRMLNSIVGDVAFRSATRDLLKKFAYGNMDRDDLWAMLTRHGHEQGTLPKDLSVKQIMDSWITQPG 656          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 420.624 bits (1080), Expect = 8.131e-137
Identity = 232/600 (38.67%), Postives = 342/600 (57.00%), Query Frame = 1
Query:  310 HFN--WKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR--KSSTLSNDVRQ-HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWI-----GFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H N  + +DF+   + G V   V+VL      L LD ++L+I ++  + +   F+ +  K    G  L I L     R +  ++ IEY T+  +TALQW+ P+ T GKKH +L+SQ QA + R++ PCQDTP VK TY A +  P +L  +MSA+R  +    S+  R  ++F Q +P+PSYL++I  G L   +IGPRS V+SE E  ++A  EF + E +L  AE L GPY W   D+L+LPPSFPYGGMENPC+ F+TP +L GD+S    IAHEISHSWTGNLVTN TW+HFW+NEGHT Y+ER+I   ++  E  R      G  EL   +      +G ++  T LVPNLH  D D++FS VPYEKG  LL++LE L+G  ++ + ++K+YI  F   SV+T+EWK + F Y  +K  +    L  + W+ W + PG  P+      D +M   C  L + W+         F  ++ + LN        Q   F  +L  +Q   LP S +K MG +Y L N  N+E+   W  +C+++ +  AV    +    QGR+K+ + L+K +Y++       V+ F   + ++HP+T
Sbjct:   20 HLNLIYHVDFDRHVLKGKVALTVEVLEDKFSSLTLDSKDLKISKVSANGQAAKFE-LGAKHKFKGSPLEITLPFELSRGQHVIVEIEYETSPTATALQWLTPKQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPRELVALMSALRDGQEPDPSDSSRVIYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEYVDEAAYEFAETETMLKTAESLAGPYVWGQYDVLVLPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNRTWEHFWLNEGHTVYIERMIARCME-GEQLRQFKGIGGWKELHESVKQ----FGANNVLTNLVPNLHEVDTDEAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLFAYGSVTTEEWKNYLFTYFKDKVDI----LNKVDWNAWMHTPGMAPVRPQ--YDTTMADACTSLCQKWVKAKEADLASFTEADVKQLNS------PQLIEFMALL--LQEDPLPLSHVKKMGEVYKLNNIKNAEVRFRWLRICVKAQWEEAVPLALKMATEQGRMKFTRPLFKEVYNFSKYSDEAVKTFKENRGSLHPVT 599          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 419.853 bits (1078), Expect = 1.699e-136
Identity = 232/600 (38.67%), Postives = 342/600 (57.00%), Query Frame = 1
Query:  310 HFN--WKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR--KSSTLSNDVRQ-HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWI-----GFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H N  + +DF+   + G V   V+VL      L LD ++L+I ++  + +   F+ +  K    G  L I L     R +  ++ IEY T+  +TALQW+ P+ T GKKH +L+SQ QA + R++ PCQDTP VK TY A +  P +L  +MSA+R  +    S+  R  ++F Q +P+PSYL++I  G L   +IGPRS V+SE E  ++A  EF + E +L  AE L GPY W   D+L+LPPSFPYGGMENPC+ F+TP +L GD+S    IAHEISHSWTGNLVTN TW+HFW+NEGHT Y+ER+I   ++  E  R      G  EL   +      +G ++  T LVPNLH  D D++FS VPYEKG  LL++LE L+G  ++ + ++K+YI  F   SV+T+EWK + F Y  +K  +    L  + W+ W + PG  P+      D +M   C  L + W+         F  ++ + LN        Q   F  +L  +Q   LP S +K MG +Y L N  N+E+   W  +C+++ +  AV    +    QGR+K+ + L+K +Y++       V+ F   + ++HP+T
Sbjct:   20 HLNLIYHVDFDRHVLKGKVALTVEVLEDKFSSLTLDSKDLKISKVSANGQAAKFE-LGAKHKFKGSPLEITLPFELSRGQHVIVEIEYETSPTATALQWLTPKQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPRELVALMSALRDGQEPDPSDSSRVIYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEYVDEAAYEFAETETMLKTAESLAGPYVWGQYDVLVLPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNRTWEHFWLNEGHTVYIERMIARCME-GEQLRQFKGIGGWKELHESVKQ----FGANNVLTNLVPNLHEVDTDEAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLFAYGSVTTEEWKNYLFTYFKDKVDI----LNKVDWNAWMHTPGMAPVRPQ--YDTTMADACTSLCQKWVKAKEADLASFTEADVKQLNS------PQLIEFMALL--LQEDPLPLSHVKKMGEVYKLNNIKNAEVRFRWLRICVKAQWEEAVPLALKMATEQGRMKFTRPLFKEVYNFSKYSDEAVKTFKEIRGSLHPVT 599          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Match: rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:ZFIN;Acc:ZDB-GENE-040718-241])

HSP 1 Score: 335.88 bits (860), Expect = 3.987e-104
Identity = 204/622 (32.80%), Postives = 326/622 (52.41%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVR-NLEIKRIVIDNE-------DVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYG-LTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDW-DDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D  + ++   F ++  H + K+DF  + ISG+    ++ +  +  EL LD+  +L +  I +          + L Q         LV   +  +   K Q+ I Y  T D   + W++PE T GK   ++++Q QA+  RS +PC DTP VK+TYSA ++ P     VMSA +     ++      F  + PIP+YLV++A G L  +++GPR+ V++EP L + A+ E+++ IE  L + E+L GPY W   D+L +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEI HSW GNLVTN+TW  FW+NEG T Y +R +  +L   E Y  L    G + L   ++      G DH   KL   +  G DPDD+++  PYEKG   + YL  L G + +   +LK Y+  F+ +SV  ++   F+ +Y  E ++    K+EG+ +D W   PG  P         ++++    L + W+  H     E+            Q  YF   +  ++   LP+ +LK +   Y  +  + N+EL   W+ +  ++ Y P    + +FL+SQG+ KY   +Y+ L++  ++TK+  +E F      +H   R  + KII
Sbjct:   16 DVATSSSFRQFKIEHFHLDLKVDFLQKSISGTETIELQCIQDSQSELQLDIHPSLSVHEITLSQNARDWTRTEFLTQDFTSYGTTLLVKFPTAFSSDDKLQLAIRYTAT-DGPGVCWLEPEQTAGKLKPYVFTQGQAVLNRSCFPCFDTPAVKSTYSAAVQVPDGFTAVMSANKWEQRKADGA--FLFTMEHPIPAYLVALAVGDLQSAEVGPRTRVWTEPCLLQAAKQEYDNVIEDFLSVGEKLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIVHEICHSWFGNLVTNATWGDFWLNEGFTMYAQRRVCRELY-GEAYTCLEAATGKALLRQHMDN----TGEDHPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLTGDQSRFDTFLKAYVEKFKFRSVLAEDALEFYLEYFPELKERNVHKIEGLDFDSWLNVPGWPPYVPDLSAGQTLMKPAELLAEKWLS-HNL-DLESICKTDLKSWKTYQTVYFLDRI--LEKSPLPDGNLKKLEECYSQIIKSNNAELKVRWAQIVAKNQYSPGFQHIRDFLSSQGKQKYTLPVYRALWNGSEETKALAIEMFSATSGQLHVNVRNYVKKII 625          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Match: rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:ZFIN;Acc:ZDB-GENE-040718-241])

HSP 1 Score: 335.88 bits (860), Expect = 3.987e-104
Identity = 204/622 (32.80%), Postives = 326/622 (52.41%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVR-NLEIKRIVIDNE-------DVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYG-LTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDW-DDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            D  + ++   F ++  H + K+DF  + ISG+    ++ +  +  EL LD+  +L +  I +          + L Q         LV   +  +   K Q+ I Y  T D   + W++PE T GK   ++++Q QA+  RS +PC DTP VK+TYSA ++ P     VMSA +     ++      F  + PIP+YLV++A G L  +++GPR+ V++EP L + A+ E+++ IE  L + E+L GPY W   D+L +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEI HSW GNLVTN+TW  FW+NEG T Y +R +  +L   E Y  L    G + L   ++      G DH   KL   +  G DPDD+++  PYEKG   + YL  L G + +   +LK Y+  F+ +SV  ++   F+ +Y  E ++    K+EG+ +D W   PG  P         ++++    L + W+  H     E+            Q  YF   +  ++   LP+ +LK +   Y  +  + N+EL   W+ +  ++ Y P    + +FL+SQG+ KY   +Y+ L++  ++TK+  +E F      +H   R  + KII
Sbjct:   16 DVATSSSFRQFKIEHFHLDLKVDFLQKSISGTETIELQCIQDSQSELQLDIHPSLSVHEITLSQNARDWTRTEFLTQDFTSYGTTLLVKFPTAFSSDDKLQLAIRYTAT-DGPGVCWLEPEQTAGKLKPYVFTQGQAVLNRSCFPCFDTPAVKSTYSAAVQVPDGFTAVMSANKWEQRKADGA--FLFTMEHPIPAYLVALAVGDLQSAEVGPRTRVWTEPCLLQAAKQEYDNVIEDFLSVGEKLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIVHEICHSWFGNLVTNATWGDFWLNEGFTMYAQRRVCRELY-GEAYTCLEAATGKALLRQHMDN----TGEDHPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLTGDQSRFDTFLKAYVEKFKFRSVLAEDALEFYLEYFPELKERNVHKIEGLDFDSWLNVPGWPPYVPDLSAGQTLMKPAELLAEKWLS-HNL-DLESICKTDLKSWKTYQTVYFLDRI--LEKSPLPDGNLKKLEECYSQIIKSNNAELKVRWAQIVAKNQYSPGFQHIRDFLSSQGKQKYTLPVYRALWNGSEETKALAIEMFSATSGQLHVNVRNYVKKII 625          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Match: rnpepl1 (arginyl aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5522])

HSP 1 Score: 246.899 bits (629), Expect = 2.001e-70
Identity = 181/630 (28.73%), Postives = 294/630 (46.67%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILD------VRNLEIKRIVIDNEDVLFQYVNGKL------GGKLVIPLSLGTKR--SKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFE-DIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIGKDKML-RWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKF--SRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIY-GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKIIF 2091
            D  S +N   F +   H +  L+F  ++I+G  V  +  +    + LILD      + +++ K         +F  +  ++      G  L I L     R    F+V + Y TT D  A+ W+  E+T G+    +++Q  ++  RS +PC DTP VK+TYSAT+  P  + V+MSA R  S  S   R  +F  + P+P+YLV++  G L  + IGPRS V++EP +   A  +    +E+ L +AE L GPY W   DL+ LPPSFP   MENPC+ F+   +L   +  L  + HEI+H W GN VTN+TW+  W++EG   Y +R I  +    E +  L     +  L   + +     G ++  +KL      G +P    +   YEKG   + YL  L G  K    +L+ YI  FR  SV   +   FF  +  E ++   ++ EG++++ W    GP   E       ++      L   W       + + ++++ F  S     Q   F   L D     L +  + ++ + Y  L +  N+E+   W  + +R+ + P + +V  FL+      Y   LY+ L      K   VE F+  +  +HP  R  + +I+F
Sbjct:   36 DIASASNFHCFKLRHFHLDLHLNFAVKRITGWQVLELTPVQPGVQSLILDTHPSLLIHSVDCKVPGASGAPDVFLSLTYRVEPFTDYGSSLNITLPAAVIRPHRAFRVTVRYTTT-DGPAIWWLDAELTCGQTRPLVFTQGHSVCNRSFFPCFDTPAVKSTYSATVRVPEGVTVLMSASR--SAYSKQDRVFQFSMEYPVPAYLVALVAGDLQHADIGPRSRVWAEPCILTCAVSKLGGSVERWLNVAEGLFGPYVWGRYDLVFLPPSFPIVAMENPCLTFIISSILESQEFLLIDVIHEIAHGWFGNAVTNATWEEMWLSEGLATYAQRRITTE-AYGEAFTCLETVFRLDALHRQMRL----LGDNNPVSKLQAKFEPGVNPSSLMNLFTYEKGFCFVSYLSQLCGDIKRFDSFLRAYIEKFRFSSVIAQDLLDFFLGFFPELKEGCVAQREGLEFERWLNGCGPPLCEPDLSAGRTLTGPVQHLCDLWGN----DAPDTQVISTFDLSSWSTFQTVLFLDRLLDRS--PLSQEVMSLLSSCYAALLDDMNAEVQIRWLQIVVRNSFYPDLPRVRSFLHKHTSRMYTVPLYEDLCG-GVMKCFAVEVFYQTQARLHPNLRRTLQQILF 650          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 430.254 bits (1105), Expect = 2.081e-140
Identity = 243/617 (39.38%), Postives = 353/617 (57.21%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVIIEYN--TTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTL-SNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPD-QRYYFFQVLND-IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +S+A+ E F +   +    +DF +  I+ S    V+ L  +   LILD ++L IK++ ++ +D  F         G  L I L     R + +VI+E +  T+  S+ALQW+  E T GK H +L+SQ QA + RS+ PCQDTP VK TY + +  P +L  +MSA+R    +  ND  +  + F Q +PIPSYL+++  G L G K GPR+T+++E EL E +  EF + EK+L  AE+L GPY W   DLLILPPSFPYGGMENPC+ F+TP +L GD+S    IAHEISHSWTGNLVTN TW++FW+NEGHT YLER I + L   E +R      G  EL+  +N     +G  +  T LVPNLH  D D +FS VPYEKG  LLFYLE L+G  ++ L +LK+YI  F  KSV+T++WK F + Y  +K  +    L+ + W  W + PG  P++     D ++   C  L + W+      + E++L +  +  + D   +   +VL   +    L  S +K M  +Y L +  NSE+   W  LC+R+     +    +    QGR+K+ + LY+ LY+++  +  TV  F   +  MHP+T   + K
Sbjct:    3 DPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFALGTSHSFKGTPLEITLPFSLTRGQ-EVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGELVEQNDCSRKIYCFMQNVPIPSYLIALVVGALEGRKGGPRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVN----TFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPK--YDMTLANACIALSQKWVK-----AKESDLSSFNADDVKDLSSHQLIEVLTILLLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNFEKAREETVNTFLKNRSCMHPVTEMLVAK 602          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 384.8 bits (987), Expect = 3.302e-123
Identity = 229/614 (37.30%), Postives = 332/614 (54.07%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVIIEYN--TTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPD-QRYYFFQVLND-IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +S+A+ E F +   +    +DF +  I+ S    V+ L  +   LILD ++L IK++ ++ +D  F         G  L I L     R + +VI+E +  T+  S+ALQW+  E T GK H +L+SQ QA + RS+ PCQDTP VK TY + +  P +L  +MSA+R                          + C H      GPR+T+++E EL E +  EF + EK+L  AE+L GPY W   DLLILPPSFPYGGMENPC+ F+TP +L      L  IAHEISHSWTGNLVTN TW++FW+NEGHT YLER I + L   E +R      G  EL+  +N     +G  +  T LVPNLH  D D +FS VPYEKG  LLFYLE L+G  ++ L +LK+YI  F  KSV+T++WK F + Y  +K  +    L+ + W  W + PG  P++     D ++   C  L + W+      + E++L +  +  + D   +   +VL   +    L  S +K M  +Y L +  NSE+   W  LC+R+     +    +    QGR+K+ + LY+ LY+++  +  TV  F   +  MHP+T   + K
Sbjct:    6 DPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFALGTSHSFKGTPLEITLPFSLTRGQ-EVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGEL----------------------VDCIH-----GGPRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVN----TFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPK--YDMTLANACIALSQKWVK-----AKESDLSSFNADDVKDLSSHQLIEVLTILLLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNFEKAREETVNTFLKNRSCMHPVTEMLVAK 575          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 375.941 bits (964), Expect = 5.770e-120
Identity = 229/617 (37.12%), Postives = 328/617 (53.16%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVIIEYN--TTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKV-----MGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D +S+A+ E F +   +    +DF +  I+ S    V+ L  +   LILD ++L IK++ ++ +D  F         G  L I L     R + +VI+E +  T+  S+ALQW+  E T GK H +L+SQ QA + RS+ PCQDTP VK TY + +  P +L  +MSA+R                          + C H      GPR+T+++E EL E +  EF + EK+L  AE+L GPY W   DLLILPPSFPYGGMENPC+ F+TP +L      L  IAHEISHSWTGNLVTN TW++FW+NEGHT YLER I + L   E +R      G  EL+  +N     +G  +  T LVPNLH  D D +FS VPYEKG  LLFYLE L+G  ++ L +LK+YI  F  KSV+T++WK F + Y  +K  +    L+ + W  W + PG  P++ +              VK   G   F  ++   L+ F+    D +      L ++  + L E+ L V     M  +Y L +  NSE+   W  LC+R+     +    +    QGR+K+ + LY+ LY+++  +  TV  F   +  MHP+T   + K
Sbjct:    7 DPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFALGTSHSFKGTPLEITLPFSLTRGQ-EVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGEL----------------------VDCIH-----GGPRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVN----TFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPN--------------VKILHGI--FSQAKESDLSSFNA--DDVKDLSSHQLIEVLTILLLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNFEKAREETVNTFLKNRSCMHPVTEMLVAK 568          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 368.237 bits (944), Expect = 5.079e-117
Identity = 221/579 (38.17%), Postives = 316/579 (54.58%), Query Frame = 1
Query:  376 VLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVIIEYN--TTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTL-SNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPD-QRYYFFQVLND-IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            +L S  +  ILD ++L IK++ ++ +D  F         G  L I L     R + +VI+E +  T+  S+ALQW+  E T GK H +L+SQ QA + RS+ PCQDTP VK TY + +  P +L  +MSA+R    +  ND  +  + F Q +PIPSYL+++  G L G                      F   EK+L  AE+L GPY W   DLLILPPSFPYGGMENPC+ F+TP +L      L  IAHEISHSWTGNLVTN TW++FW+NEGHT YLER I + L   E +R      G  EL+  +N     +G  +  T LVPNLH  D D +FS VPYEKG  LLFYLE L+G  ++ L +LK+YI  F  KSV+T++WK F + Y  +K  +    L+ + W  W + PG  P++     D ++   C  L + W+      + E++L +  +  + D   +   +VL   +    L  S +K M  +Y L +  NSE+   W  LC+R+     +    +    QGR+K+ + LY+ LY+++  +  TV  F   +  MHP+T   + K
Sbjct:   20 ILESCLELHILDTKDLTIKKVAVNGKDAKFALGTSHSFKGTPLEITLPFSLTRGQ-EVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGELVEQNDCSRKIYCFMQNVPIPSYLIALVVGALEGF---------------------FSFTEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVN----TFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPK--YDMTLANACIALSQKWVK-----AKESDLSSFNADDVKDLSSHQLIEVLTILLLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNFEKAREETVNTFLKNRSCMHPVTEMLVAK 560          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 367.081 bits (941), Expect = 8.525e-117
Identity = 222/577 (38.47%), Postives = 311/577 (53.90%), Query Frame = 1
Query:  376 VLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVIIEYN--TTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTL-SNDVRQ--HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            +L S  +  ILD ++L IK++ ++ +D  F         G  L I L     R + +VI+E +  T+  S+ALQW+  E T GK H +L+SQ QA + RS+ PCQDTP VK TY + +  P +L  +MSA+R    +  ND  +  + F Q +PIPSYL+++  G L G                      F   EK+L  AE+L GPY W   DLLILPPSFPYGGMENPC+ F+TP +L      L  IAHEISHSWTGNLVTN TW++FW+NEGHT YLER I + L   E +R      G  EL+  +N     +G  +  T LVPNLH  D D +FS VPYEKG  LLFYLE L+G  ++ L +LK+YI  F  KSV+T++WK F + Y   K+KV+   L+ + W  W + PG  P++     D ++   C  L + W+              K S +     +Y+   L       L  S +K M  +Y L +  NSE+   W  LC+R+     +    +    QGR+K+ + LY+ LY+++  +  TV  F   +  MHP+T   + K
Sbjct:   20 ILESCLELHILDTKDLTIKKVAVNGKDAKFALGTSHSFKGTPLEITLPFSLTRGQ-EVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGELVEQNDCSRKIYCFMQNVPIPSYLIALVVGALEGF---------------------FSFTEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNT----FGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYF--KDKVD--ILDKVDWKGWMHTPGMPPVQPK--YDMTLANACIALSQKWV--------------KVSGITCYVIHYYCAFLFQ---APLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNFEKAREETVNTFLKNRSCMHPVTEMLVAK 546          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Match: Lta4h (leukotriene A4 hydrolase [Source:MGI Symbol;Acc:MGI:96836])

HSP 1 Score: 443.736 bits (1140), Expect = 1.072e-145
Identity = 240/600 (40.00%), Postives = 356/600 (59.33%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGG------KLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    ++G+    V+      + L LD ++L I+++VI+ ++V  +Y  G+  G      ++ +P++L +K  +  + I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R       +    + ++F Q++PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH H   G  EL+  +      +G  H FTKLV +L   DPD ++S +PYEKG  LLFYLE L+G  ++ L +LK Y+  F  +SV+TD+WK+F + +   K+KV+   L  + W+ W Y PG  P++ +   D ++   C  L + W+      +++ E L+ FS  + D +      LN+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + V  +   K +MHP+T
Sbjct:   23 HLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDLTIEKVVINGQEV--KYTLGESQGYKGSPMEISLPIAL-SKNQEIVIEISFETSPKSSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFHALGGWGELQNTIK----TFGESHPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSVTTDDWKSFLYSHF--KDKVD--LLNQVDWNTWLYAPGLPPVKPN--YDVTLTNACIALSQRWV------TAKEEDLSSFS--IADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Match: Rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:MGI Symbol;Acc:MGI:2384902])

HSP 1 Score: 319.701 bits (818), Expect = 7.667e-98
Identity = 188/527 (35.67%), Postives = 282/527 (53.51%), Query Frame = 1
Query:  532 KFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIY-GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDD-TKSRTVENFHIQKFAMHPITRGEIHKIIFPR 2097
            +F++ + Y    +   + W+ PE T GKK  F+Y+Q QA+  R+ +PC DTP VK TYSA IE P     VMSA        N   +  F+   PIPSYL+++A G L  +++GPRS V++EP L E A+ E+   IE+ L   E+L GPY W   DLL +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEISHSW GNLVTN+ W  FW+NEG T Y +R I   L  +  Y  L    G + L   +N    + G ++   KL   +  G DPDD+++  PYEKG   + YL  L+G +D+  ++LK Y+  F+ +S+  +++  F+ +Y  E +K     + G ++D W   PG  P        DS+++   EL + W+     P  +       S     Q  YF   +  +Q   LP  ++K +G  Y  ++N  N+EL   W  + L++ Y     +V +FL SQG+ KY   LY  +    +  ++   + F      +H      + +I+ P+
Sbjct:  135 RFELELTYRV-GEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKCTYSALIEVPDGFTAVMSADTWEKRGPN---KFFFQMSHPIPSYLIALAIGDLASAEVGPRSRVWAEPCLIEAAKEEYSGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAA-YTCLEAATGRALLRQHMN----VSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFDRWLNTPGWPPYLPDLSPGDSLMKPAEELAELWVTSE--PDMQAIEAVAISTWKTYQLVYFLDKI--LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGKQKYTLPLYHAMMGGSEMARTLAKDTFAATASQLHSNVVNYVQQILAPK 648          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Match: Rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:MGI Symbol;Acc:MGI:2384902])

HSP 1 Score: 275.018 bits (702), Expect = 1.693e-81
Identity = 171/526 (32.51%), Postives = 259/526 (49.24%), Query Frame = 1
Query:  532 KFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIG-KDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIY-GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDD-TKSRTVENFHIQKFAMHPITRGEIHKIIFPR 2097
            +F++ + Y    +   + W+ PE T GKK  F+Y+Q QA+  R+ +PC DTP VK TYSA IE P     VMSA        N   +  F+   PIPSYL+++A G L  +++GPR                                       DLL +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEISHSW GNLVTN+ W  FW+NEG T Y +R I   L  +  Y  L    G + L   +N    + G ++   KL   +  G DPDD+++  PYEKG   + YL  L+G +D+  ++LK Y+  F+ +S+  +++  F+ +Y  E +K     + G ++D W   PG  P        DS+++   EL + W+     P  +       S     Q  YF   +  +Q   LP  ++K +G  Y  ++N  N+EL   W  + L++ Y     +V +FL SQG+ KY   LY  +    +  ++   + F      +H      + +I+ P+
Sbjct:  135 RFELELTYRV-GEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKCTYSALIEVPDGFTAVMSADTWEKRGPN---KFFFQMSHPIPSYLIALAIGDLASAEVGPRY--------------------------------------DLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAA-YTCLEAATGRALLRQHMN----VSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFDRWLNTPGWPPYLPDLSPGDSLMKPAEELAELWVTSE--PDMQAIEAVAISTWKTYQLVYFLDKI--LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGKQKYTLPLYHAMMGGSEMARTLAKDTFAATASQLHSNVVNYVQQILAPK 609          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Match: Rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:MGI Symbol;Acc:MGI:1914170])

HSP 1 Score: 244.588 bits (623), Expect = 2.054e-69
Identity = 162/522 (31.03%), Postives = 258/522 (49.43%), Query Frame = 1
Query:  535 FQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIGKDKML-RWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIY-GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            FQVI+ Y +T D+ A+ W+ PE+T G    F+++Q  ++  RS +PC DTP VK TYSA ++AP  ++V+MSA +  S    +   + F  + P+P+YLV++  G L  + IGPRS V++EP L   A  +    +E+ L  AE L GPY W   D++ LPPSFP   MENPC+ F+   +L  D+  +  + HE++HSW GN VTN+TW+  W++EG   Y +R I     ++E Y      L  +     L+    + G D   +KL   L  G +P    +   YEKG   ++YL  L G  +    +L+ Y+  ++  SV   +    F  +  E ++       G++++ W    GP   E       S+ +    L + W       ++ +      S+    Q   F   L D  G  LP+  +  +   Y  L ++ N+E+   W  + +R+ Y P + +V  FL SQ    Y   LY+ L      KS  +E F+  +  +HP  R  I +I+
Sbjct:  158 FQVILRYTST-DAPAIWWLDPELTYGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPLGVQVLMSATQ--SVYVEEEGLYHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRI-----TTETYGAAFTCLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQGSSLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLLD--GSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCT-GALKSFALEVFYQTQGRLHPNLRRTIQQIL 668          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Match: Aopep (aminopeptidase O [Source:MGI Symbol;Acc:MGI:1919311])

HSP 1 Score: 110.538 bits (275), Expect = 1.817e-24
Identity = 120/543 (22.10%), Postives = 215/543 (39.59%), Query Frame = 1
Query:  541 VIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSA--VRKSSTLSNDVRQHKFEQKIPIPS--YLVSIACGHLVGSKIGPRSTVYSE---PELNEKARLEFED-------------------------------------------IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLN-YIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQI------------IYGPDHEFTKLVPNL------HGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG-PIPIEHHSLLDDS----MIQECNELVKAWIGFHQFPSSENELLNK--FSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFL 1941
            + I Y T  +  ++ W     T       +Y+    IN R+L+PCQ+ P   +T+ AT+ A +   V+MS     K + L        +   +P+P+  + +++ C   +  K  P   + +E   P    +A L +++                                           I   L  A  + G + +   D+LI+P +FP  GM +P IIFL+   LTG        + HEI+HSW G  +    W   W++EG   +LE +   + Q   P    H  L   EL   L  +++            +  P+ E T  V         HG +P+  F +V Y KG  LL +L   +G+     +L+ ++  F  + + + ++     + + E +++  S    ++  DW    G P  ++     +D     + ++    V  WI  ++ P        +  F ++ PDQ     + L  ++   L   +L  +   Y L    ++E+ H W  L ++  Y  A +QV  FL
Sbjct:  136 IRIWYKTKPEGQSVAWT----TDQNGRPCVYTMGSPINNRALFPCQEPPVAMSTWQATVRAAASFVVLMSGENSAKPTPLREGYMSWHYYVTMPMPASTFAIAVGCWTEMKPKASPPDDLMTEHSLPLSPSEADLRYDNTCNHMEYPCRFQSASAASQDIIPYRVFAPVCLEGACQEALLWLIPSCLSAAHSVLGTHPFSRLDILIVPTNFPSLGMASPHIIFLSQSTLTGTSHLCGTRLCHEIAHSWFGLAIGARDWTEEWLSEGFATHLEDIFWAEAQQLPP----HEALEQQELRACLRWHRLQDELRNSPEGMQVLRPNKEETGHVSASGASVVKHGLNPEKGFMQVHYLKGYFLLRFLTRTLGEKIYFPFLRKFVHLFHGQLILSQDFLQMLLENIPENKRLGLSVENIVR--DWLECSGIPKALQEERKAEDCSPSRLARQVGSEVAKWIRVNRRPRKRKRGKREVAFEKLSPDQIVLLLEWL--LEQKTLSPQTLHCLQQTYHLPE-QDAEVRHRWCELVIKHKYTKAYNQVERFL 665          
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Match: sp|Q3SZH7|LKHA4_BOVIN (Leukotriene A-4 hydrolase OS=Bos taurus OX=9913 GN=LTA4H PE=2 SV=3)

HSP 1 Score: 445.277 bits (1144), Expect = 2.118e-145
Identity = 242/599 (40.40%), Postives = 352/599 (58.76%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    +SG+    ++      + LILD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TYSA +  P +L  +MSA+R       +    + ++F QK+PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH H   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLFYLE L+G  ++ L +LK Y+  F  KS++TD WK F + +  +K  +    L  + W+ W Y PG  P++ +   D ++   C  L + WI      +++++ LN FS    D + +    +N+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + +  +   K +MHP+T
Sbjct:   23 HLRCSIDFTRRVLSGTAALTIQSQEDNLRSLILDTKDLTIEKVVINGQEV--KYTLGERQSYKGSPIEISLPIALCKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYSAEVSVPKELVALMSAIRDGEAPDPEDPNRKIYRFSQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYIWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFHALGGWGELQNSIK----TFGETHPFTKLVVDLTNTDPDVAYSSVPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYKSITTDNWKDFLYSHFKDKVDI----LNQVDWNTWLYSPGLPPVKPN--YDMTLTNACISLSQRWI------TAKDDDLNSFSSA--DLKDFSSHQVNEFLAQMLQNAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAIRTYKEHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Match: sp|P09960|LKHA4_HUMAN (Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2)

HSP 1 Score: 444.506 bits (1142), Expect = 3.581e-145
Identity = 245/599 (40.90%), Postives = 352/599 (58.76%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    ++G+    V+      + L+LD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R   T   +    + +KF QK+PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH +   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLFYLE L+G  ++ L +LK Y+  F  KS++TD+WK F + Y  +K  V    L  + W+ W Y PG  PI+ +   D ++   C  L + WI      +++ + LN F+    D +      LN+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + V  +   K +MHP+T
Sbjct:   23 HLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEV--KYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFNALGGWGELQNSVK----TFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPN--YDMTLTNACIALSQRWI------TAKEDDLNSFNAT--DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Match: sp|Q6S9C8|LKHA4_CHILA (Leukotriene A-4 hydrolase OS=Chinchilla lanigera OX=34839 GN=LTA4H PE=2 SV=3)

HSP 1 Score: 444.506 bits (1142), Expect = 3.698e-145
Identity = 245/600 (40.83%), Postives = 351/600 (58.50%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRM-LPDQRY-----YFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF +  ++G     ++      + L+LD + L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSAVR   T   +    + +KF QK+PIP YL+++  G L   KIGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH H   G  EL+  +      +G  H FTKLV +L   DPD ++S VPYEKG  LLF+LE L+G  ++ L +LK Y+  F  KS++TD+WK F + +  +K  +    L  + W+ W Y PG  P++ +   D ++   C  L + WI      +++ E LN F+   L D        +  QVL   Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + +  +   K +MHP+T
Sbjct:   23 HLRCSVDFSSRALTGIAALTIQSQEDNLRSLVLDTKALTIEKVVINGQEV--KYALGERQSYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQDTPSVKLTYTAEVSVPKELVALMSAVRDGETPDPEDPSRKIYKFNQKVPIPCYLIALVVGALESRKIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFHALGGWGELQNTIK----TFGETHPFTKLVVDLTDVDPDVAYSSVPYEKGFALLFHLEQLLGGPEVFLGFLKAYVERFSYKSITTDDWKNFLYSHFKDKVDI----LNQVDWNAWLYSPGLPPVKPN--YDMTLTNACIALSQRWI------TAKEEDLNTFNATDLKDLSTHQVNEFLAQVL---QQAPLPLGHVKRMQEVYNFNAVNNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAIRTYQAHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Match: sp|P24527|LKHA4_MOUSE (Leukotriene A-4 hydrolase OS=Mus musculus OX=10090 GN=Lta4h PE=1 SV=4)

HSP 1 Score: 443.736 bits (1140), Expect = 7.500e-145
Identity = 240/600 (40.00%), Postives = 356/600 (59.33%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGG------KLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSND---VRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLND-----IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    ++G+    V+      + L LD ++L I+++VI+ ++V  +Y  G+  G      ++ +P++L +K  +  + I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R++ PCQDTP VK TY+A +  P +L  +MSA+R       +    + ++F Q++PIP YL+++  G L   +IGPR+ V+SE E  EK+  EF + E +L IAE+L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GDKS  N IAHEISHSWTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH H   G  EL+  +      +G  H FTKLV +L   DPD ++S +PYEKG  LLFYLE L+G  ++ L +LK Y+  F  +SV+TD+WK+F + +   K+KV+   L  + W+ W Y PG  P++ +   D ++   C  L + W+      +++ E L+ FS  + D +      LN+     +Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + V  +   K +MHP+T
Sbjct:   23 HLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDLTIEKVVINGQEV--KYTLGESQGYKGSPMEISLPIAL-SKNQEIVIEISFETSPKSSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPEDPSRKIYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFHALGGWGELQNTIK----TFGESHPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSVTTDDWKSFLYSHF--KDKVD--LLNQVDWNTWLYAPGLPPVKPN--YDVTLTNACIALSQRWV------TAKEEDLSSFS--IADLKDLSSHQLNEFLAQVLQKAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAVHTYQEHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Match: sp|P19602|LKHA4_CAVPO (Leukotriene A-4 hydrolase OS=Cavia porcellus OX=10141 GN=LTA4H PE=1 SV=3)

HSP 1 Score: 438.728 bits (1127), Expect = 7.753e-143
Identity = 244/600 (40.67%), Postives = 351/600 (58.50%), Query Frame = 1
Query:  310 HFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL----GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR--KSSTLSNDVRQ-HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRM-LPDQRY-----YFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            H    +DF    ++G     ++      + LILD ++L I+++VI+ ++V  +Y  G+     G  + I L +   +++  VI I + T+  S+ALQW+ PE T GK+H +L+SQ QAI+ R+  PCQDTP VK TY+A +  P +L  +MSA+R  ++   ++  R+ +KF QK+PIP YL+++  G L   KIGPR+ V+SE E  +K+  EF + E +L IAE+L GPY W   D L+LPPSF YGGMENPC+ F+TP LL GDKS  N IAHEISH+WTGNLVTN TWDHFW+NEGHT YLER I  +L   E +RH H   G  EL+  +       G    FTKLV +L   DPD ++S VPYEKG  LLF+LE L+G  ++ L +LK Y+  F  KS++TD+WK F F +  +K  +    L  + WD W Y PG  PI+ +   D ++   C  L + WI      +++ + LN FS   L D        +  QVL   Q   LP   +K M  +Y      NSE+   W  LC++S +  A+    +    QGR+K+ + L+K L  +D +  + ++ +H  K +MHP+T
Sbjct:   23 HLRCSVDFTRRALTGVAALTIQSQEDNLRSLILDTKDLTIEKVVINGQEV--KYALGEKQSYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAFLPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPADPSRKIYKFSQKVPIPCYLIALVVGALESRKIGPRTLVWSEKEQVDKSAYEFSETESMLKIAEDLGGPYVWGQYDRLVLPPSFSYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHTWTGNLVTNKTWDHFWLNEGHTVYLERHICGRL-FGEKFRHFHALGGWGELQNTVK----TLGETQAFTKLVVDLTDTDPDVAYSSVPYEKGFALLFHLEQLLGGPEVFLGFLKAYVEKFSYKSITTDDWKNFLFSHFKDKVDI----LNQVDWDAWLYSPGLPPIKPN--YDMTLTNACIALSQRWI------TAKEKDLNTFSATDLKDLSSHQVNEFLAQVL---QRAPLPLGHVKRMQEVYNCNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQAIQTYHAHKASMHPVT 600          
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Match: A0A4E0R355 (Leukotriene A-4 hydrolase OS=Fasciola hepatica OX=6192 GN=D915_007503 PE=4 SV=1)

HSP 1 Score: 502.671 bits (1293), Expect = 3.702e-165
Identity = 268/615 (43.58%), Postives = 376/615 (61.14%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLN--SASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQ---HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSE--------NELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMH 2055
            D +S AN+ D+      F+W +DF  + I G+ V  +K ++   A   LILD   L I+ + I   DV ++ V  K   LG   V+ +++ +   +F V I Y T+ +S+ALQW++PE+T  +K  F++SQ QAI+ARSL+PCQDTP VK T+ A + AP +  VVM  VR K  ++SN   Q   + +EQ IPIPSYLV+IACG L   ++GPRS+V++E  +  KA  EF DIEK+L  AE LCGPY W++ D+L+LPPSFPYGGMENPC+ F++P LL GDKS +N IAHEI+HSWTGN VTNS W+HFW+NEGHT YLERLI+E L  ++  RHL + +G  EL  ++       G  HEFT+LV  L G DPD S++R+PYEKGSLLL+YLET  G+DKM+ WLK Y+  F   ++ T+ W  F  K + E+ +      + + WD+W + PG +P        +  I +C+ LV        F S E          +L  +  + P QR    + LN  +  +L   +L+ +     L+   N+EL   WS  C+RSHY+PA+D   EFLNS GR++Y + LY+ L  W +  +R  EN+  Q+  MH
Sbjct:    6 DPSSSANASDYHTAHIKFDWNIDFTTKTIGGAAVLTIKRVSHEKAHPPLILDANELSIQAVKIHGNDVQWKCVPHKHPVLGS--VLEVTVPSSDPQFDVEIAYKTSPNSSALQWLEPELTADRKLPFMFSQCQAIHARSLFPCQDTPSVKATFEAVVHAPKEAVVVMGGVRTKQPSVSNRGDQWMTYHYEQTIPIPSYLVTIACGDLASERVGPRSSVWAERSVVAKAAKEFADIEKMLAAAEHLCGPYVWKVYDVLVLPPSFPYGGMENPCLTFVSPTLLAGDKSLVNVIAHEIAHSWTGNFVTNSNWEHFWLNEGHTIYLERLIMEYLHGTQ-MRHLLLAIGYEELLNEVKH----LGTTHEFTRLVTKLDGVDPDVSYNRIPYEKGSLLLYYLETKFGRDKMMHWLKAYVKHFGGSALDTNSWVEFLSKTLGEEAQ------KNVNWDEWLHAPG-MPSWKPKFEAEEAIAQCDSLVAL------FESDELSTKSAVTASVLKLWKELSPIQRELTMRRLN--KRPELKHENLRAIDAALELSKQQNAELRFEWSHACIRSHYLPALDSCLEFLNSTGRMRYTRPLYRSLKQWPEVLTRVHENYKNQRPFMH 598          
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Match: A0A504X7M0 (Leukotriene A-4 hydrolase OS=Fasciola gigantica OX=46835 GN=FGIG_00782 PE=4 SV=1)

HSP 1 Score: 502.286 bits (1292), Expect = 4.781e-164
Identity = 265/609 (43.51%), Postives = 375/609 (61.58%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLN--SASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQ---HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIG--FHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMH 2055
            D +S AN+  +      F+W +DF  + I G+ V  +K ++       LILD   L I+ + I   DV ++ V  K   LG   V+ +++ +   +F V I Y T+ +S+ALQW++PE+T  +K  F++SQ QAI+ARSL+PCQDTP VK T+ A + AP +  VVM  VR K  ++SN   Q   + +EQ IPIPSYLV+IACG L   ++GPRS+V++E  +  KA  EF DIEK+L  AE LCGPY W++ D+L+LPPSFPYGGMENPC+ F++P LL GDKS +N IAHEI+HSWTGN VTNS W+HFW+NEGHT YLERLI+E L  ++  RHL + +G  EL  ++N      G  HEFT+LV  L G DPD S++R+PYEKGSLLL+YLET  G+DKM+ WLK Y+  F   ++ T+ W  F  K + E+     +K + + WD+W + PG +P        +  I +C+ LV  +         +    +L  +  + P QR    + LN  +  +L   +L+ +     L+   N+EL   WS  C+RSHY+PA+D   EFLNS GR++Y + LY+ L  W +  +R  EN+  Q+  MH
Sbjct:   73 DPSSSANASHYHTAHIKFDWNIDFTTKTIGGAAVLTIKRVSHEKTHPPLILDANELSIQAVKIHGNDVQWKCVPHKHPVLGS--VLEVTVPSSDPQFDVEIAYKTSPNSSALQWLEPELTADRKLPFMFSQCQAIHARSLFPCQDTPSVKATFEAVVHAPKEAVVVMGGVRTKQPSVSNRGDQWMIYHYEQTIPIPSYLVTIACGDLASERVGPRSSVWAERSVVAKAAKEFSDIEKMLAAAEHLCGPYVWKVYDVLVLPPSFPYGGMENPCLTFVSPTLLAGDKSLVNVIAHEIAHSWTGNFVTNSNWEHFWLNEGHTIYLERLIMEYLHGTQ-MRHLLLAIGYEELLNEVNH----LGTTHEFTRLVTKLDGVDPDVSYNRIPYEKGSLLLYYLETRFGRDKMMHWLKAYVKQFGGSALDTNSWVEFLSKTLGEE-----AKEKNVNWDEWLHAPG-MPSWKPKFEAEEAIAQCDSLVALFESDELSTKSAVTASVLKLWKELSPIQRELTMRRLN--KRPELKHENLRAIDAALELSKQQNAELRFEWSHACIRSHYLPALDSCLEFLNSTGRMRYTRPLYRSLKQWPEVLTRVHENYKNQRPFMH 666          
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Match: A0A5K3FS52 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.372e-161
Identity = 261/621 (42.03%), Postives = 383/621 (61.67%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLN---SASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ----HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIP-IEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
             D +S +N E F+     F+WK+DF    +SG V  ++  L+   + S  L LD++++ +  + I+ +   F   NG    LG  L +   +G +RS F V+IEY+TT  S+ALQW+  +MT  KK  FL++Q QAI+ARSL+PCQDTP VK TY+A + AP  + V+MSA R +S    D  +    H F Q IPIPSYLV++ACG LV ++IG RS V++EP +  +A+LEF +++ ++  AE LCG YEW I D+L+LPPSFPYGGMENPC+ F+TP LL GD+S  + IAHEISHSWTGNLVTN++W+HFW+NEGHT Y+E L+LE L  ++ YR L I LG  EL+  L  ++      H   K+VP L G   DD+FS +PY+KGSLLL+YLE   GK  +L WLK+YI+ FR  S+ST  W  F   ++ +      + L+ + W++W Y  GPIP +        S++ +  E +++         S   +  ++  M+P QR   +Q L  ++ + L   +L+V+ ++  ++ + N+E+ + WSL+ L S Y+P VD   EFLNSQGR+K+ + +YK L  W   + + + NF   +  +HP T   + K I
Sbjct:   18 QDPSSQSNPELFVTQHVDFDWKVDFNARVLSGKVTLHMTPLDLYSADSVALKLDIKDINVLCVNINEKPAEFTIQNGSHPNLGNVLCV--DVGYQRSGFTVVIEYDTTPQSSALQWLDAQMTADKKCPFLFTQCQAIHARSLFPCQDTPRVKFTYTACVIAPPGVTVLMSAQRPTSPRHCDEPESPSMHFFTQDIPIPSYLVALACGELVSARIGSRSLVWAEPSVLPRAQLEFNEVDTLIAAAESLCGEYEWGIYDILVLPPSFPYGGMENPCLTFVTPTLLAGDRSLTSVIAHEISHSWTGNLVTNASWEHFWLNEGHTKYVEGLVLELLYGTD-YRELFIELGYEELQICLGEFK----EGHPLAKMVPCLTGVHTDDAFSVIPYQKGSLLLYYLEQTYGKAAILSWLKSYISHFRRHSLSTRTWMDFLAAHLGQ------TVLQEVNWNEWLYGSGPIPWVPKSDRKLSSVVDQVVERIRS-TPLGSDTDSAAYVRCQYELMIPLQRQLLWQRL--LKYIPLSHDNLRVLDSMLAVSRSQNAEIRYRWSLIVLYSQYLPGVDCALEFLNSQGRMKFTRPIYKALMAWPTIRQQAINNFKSHRPFLHPTTAKLVEKDI 622          
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Match: A0A0X3PPR4 (Leuk-A4-hydro_C domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR128187 PE=4 SV=1)

HSP 1 Score: 493.426 bits (1269), Expect = 1.978e-161
Identity = 258/613 (42.09%), Postives = 374/613 (61.01%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLN---SASKELILDVRNLEIKRIVIDNEDVLFQYVNG---KLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSA---VRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSEN---ELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            D +S +N E F+    +F+W +DF  + ISG V + +   +   +  + L+ DV++LEI ++ I+  +  +   +G   +LG  L I   L  + + F + I Y T+  S ALQW+   +T  K+  FL++Q QAI+ARSL+PCQDTP VK TY+AT+ A   + V+MSA      +   S+    H FEQ IP+PSYLV++ CG L  ++IGPRS V++EP + E+A  EF ++++++  AE +CGPY+W   D+L+LPPSFP+GGMENPC+ F+TP LL GD+S +  IAHE SHSWTGNLVTN++W++FW+NEGHT YLE L+LE +   + YR LHI LG  EL+  L  ++      H FTKLVP L G DPDD FS +PY+KGSLLL++LE   GK  ML+WL+ Y+  FR  S+ST  W  F  K      ++ P+ L  + WDDWFYK   IP   +     S +  C+ +V A I      S  N    + + +  ++  QR    Q L  ++ V  P  +L+V+  ++ ++   NSE+ + WSL+CLRS Y+P +    EFLNSQGR+K+ + +YK L  W     + + NF  Q+  MHP T
Sbjct:   19 DPSSNSNPEYFLTRHVNFDWTIDFNTKTISGCVAYEMVAFDLSTAPDQMLVFDVKDLEISKVCINETETKWLVTDGPHPQLGSCLKI--HLPEQTASFTLHIGYQTSPQSPALQWLDAAITADKQKPFLFTQCQAIHARSLFPCQDTPRVKFTYTATVRADPCMTVLMSAKYCADSTECPSSGNPVHNFEQPIPVPSYLVALVCGDLRSAQIGPRSKVWAEPSVVERAAFEFGEVDQVISAAERICGPYQWGNYDILVLPPSFPFGGMENPCLTFVTPTLLAGDRSLICTIAHEASHSWTGNLVTNASWENFWLNEGHTKYLEGLVLEAMYGVD-YRELHIELGYEELQACLADFK----QGHPFTKLVPCLDGVDPDDCFSIIPYQKGSLLLYFLEQKYGKPAMLKWLRAYLDHFRGLSLSTRSWLDFLSK------QLGPNVLTEVNWDDWFYKTDAIPWVPNFTRKLSTV--CDSVVSA-ITKEDLRSDANVADSVRSTYEGLVSLQRQLVLQRL--LERVPFPHDNLRVLDQMFQISQAKNSEIRYRWSLICLRSQYLPGLHSALEFLNSQGRMKFTRPIYKALMSWPSVAEQAISNFKAQRQNMHPTT 613          
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Match: A0A0X3PWM7 (Leukotriene A-4 hydrolase OS=Schistocephalus solidus OX=70667 GN=LKHA4 PE=4 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 5.560e-161
Identity = 261/617 (42.30%), Postives = 377/617 (61.10%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNV---KVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNG---KLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSA-----VRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIP-----IEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
            D +S +N E F+    +F+W LDF  + IS  V + +    +  +  + L+ DV++LEI ++ I+  +  +   +G   +LG  L I L   T  + F + IEY T+  S+ALQW+   MT  K+  FL++Q QAI+ARSL+PCQDTP VK TY+AT+ A   + V+MSA      R+  +  N V  H FEQ IP+PSYLV++ CG L  ++IGPRS V++EP +  KA  EF ++++++  AE LCGPY+W   D+++LPPSFPYGGMENPC+ F+TPCLL GD+S ++ IAHE+SHSWTGNLVTN++W++FW+NEGHT YLE L+LE +   + YR LHI LG  EL+  L  +       H FTKLVP L G   DD FS +PY+KGSLLL++LE   GK  ML+WL+ Y+  FR  S+ST  W  F  K      ++ P+ L  + W+DWFYK G IP         S + DS++    + V         P+  + + + +  ++P QR    Q L  ++ V +   +L+V+  +  ++ + NSEL + WSL+CLRS Y+P +    EFLNSQGR+K+ + +YK L        + + NF  Q+  MHP T
Sbjct:   19 DPSSNSNPEYFLTRHVNFDWTLDFNTKTISARVAYEMIPFDLYTAPDQMLVFDVKDLEISKVSINETETKWLVTDGPHPQLGSCLKIHLPRQT--TSFTLHIEYRTSPQSSALQWLDAAMTADKQKPFLFTQCQAIHARSLFPCQDTPRVKFTYTATVRADPCMTVLMSAKYFADPRECPSSGNPV--HNFEQSIPVPSYLVALVCGDLRSAQIGPRSKVWAEPSVVGKAAFEFGEVDQMISAAERLCGPYQWGTYDIVVLPPSFPYGGMENPCLTFVTPCLLAGDRSLISTIAHEVSHSWTGNLVTNASWENFWLNEGHTKYLEGLVLEAMYGFD-YRELHIELGYEELQACLAEFT----EGHPFTKLVPCLDGVHTDDYFSIIPYQKGSLLLYFLEQKYGKPAMLKWLQAYLDHFRGLSLSTRSWLDFLSK------QLGPNVLTEVNWNDWFYKTGAIPWVPKFTRKLSTVCDSVVSAITKEV-----LINDPNVASFVRSTYESLMPLQRQLVLQRL--LERVPIHHDNLRVLDQMLQISQSKNSELRYRWSLICLRSQYLPGLHSALEFLNSQGRMKFTRPIYKALMSCQSIAEQAINNFKAQRQNMHPTT 613          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 365.155 bits (936), Expect = 3.661e-116
Identity = 217/617 (35.17%), Postives = 324/617 (52.51%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQY--VNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR--KSSTLSNDVRQ-HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFS----RMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
             D  S+++    +    + + + DF +  + G V   V+VL      L LD ++L+I ++  + +   F+    +G  G  L I L          V +EY T+  ++ALQW+ P  T GKKH +L+SQ QA + R++ PCQDTP VK TY A +  P +L  VMSAVR  + +  ++  R  ++F Q +P+PSYL+++  G L   +IGPRS V+SE E  ++   EF + E +L  AE L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL GD+S  N IAHEISHSWTGNLVTN TW+HF                                         ++Q  +G ++  T LV NL G +PD+ FS VPYEKG  LL++LE L+G    + ++K+YI  F   SV+T++WK + F Y  +K  +    L  + W+ W Y PG  P + +   D ++   CN L + W        +++  L+ FS    + L   +   F  L  +Q   LP S +K M  +Y   +  NSE +  W  LC++S +  AV    +    QGR+K+ + L+  +Y++   +   V+ F   +  MH +T   + K
Sbjct:    5 TDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFELGAQHGFKGSPLDITLPFELSGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPKELIAVMSAVRDGQEADPTDSSRVIYRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDRSLSNVIAHEISHSWTGNLVTNKTWEHF-----------------------------------------VHQ--FGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPY---DTTLADACNALAQRWT------KAKDADLSGFSEADIKQLSSHQLIEFLALLLLQD-PLPTSHVKRMQEVYKFNSINNSE-IRCWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFD-VYNFAKFRDEAVKVFKEHRNEMHSVTAMLVAK 562          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 356.295 bits (913), Expect = 1.191e-112
Identity = 208/610 (34.10%), Postives = 315/610 (51.64%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQY--VNGKLGGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFS----RMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
             D  S+++    +    + + + DF +  + G V   V+VL      L LD ++L+I ++  + +   F+    +G  G  L I L     R +  ++ +EY T+  ++ALQW+ P  T GKKH +L+SQ QA + R++ P   T             P+D   V+               ++F Q +P+PSYL+++  G L   +IGPRS V+SE E  ++   EF + E +L  AE L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL    +    IAHEISHSWTGNLVTN TW+HFW+NEGHT YLER+I    Q                           +G ++  T LV NL G +PD+ FS VPYEKG  LL++LE L+G  ++ + ++K+YI  F   SV+T++WK + F Y  +K  +    L  + W+ W Y PG  P +     D ++   CN L + W        +++  L+ FS    + L   +   F  L  +Q   LP S +K M  +Y   +  NSE+   W  LC++S +  AV    +    QGR+K+ + L++ +Y++   +   V+ F   +  MH +T
Sbjct:    5 TDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFELGAQHGFKGSPLDITLPFELSRGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVPNLLTQTHIAVRDGQEADPTDSSRVI---------------YRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLVSTCNSPGVIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRVHQ---------------------------FGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPQ--YDTTLADACNALAQRWT------KAKDADLSGFSEADIKQLSSHQLIEFLALLLLQVDPLPTSHVKRMQEVYKFNSINNSEIRCRWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFRDVYNFAKFRDEAVKVFKEHRNEMHSVT 560          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 346.665 bits (888), Expect = 4.756e-109
Identity = 211/616 (34.25%), Postives = 314/616 (50.97%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQY--VNGKLGGKLVIPLSLGTKR-----SKFQVIIE--YNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFS----RMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPIT 2064
             D  S+++    +    + + + DF +  + G V   V+VL      L LD ++L+I ++  + +   F+    +G  G  L I L     R     S   VI+E  Y T+  ++ALQW+ P  T GKKH +L+SQ QA + R++ P   T             P+D   V+               ++F Q +P+PSYL+++  G L   +IGPRS V+SE E  ++   EF + E +L  AE L GPY W   DLL+LPPSFPYGGMENPC+ F+TP LL         IAHEISHSWTGNLVTN TW+HFW+NEGHT YLER+I    Q                           +G ++  T LV NL G +PD+ FS VPYEKG  LL++LE L+G  ++ + ++K+YI  F   SV+T++WK + F Y  +K  +    L  + W+ W Y PG  P +     D ++   CN L + W        +++  L+ FS    + L   +   F  L  +Q   LP S +K M  +Y   +  NSE+   W  LC++S +  AV    +    QGR+K+ + L++ +Y++   +   V+ F   +  MH +T
Sbjct:    5 TDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFELGAQHGFKGSPLDITLPFELSRLCIFISGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVPNLLTQTHIAVRDGQEADPTDSSRVI---------------YRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLV--------IAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRVHQ---------------------------FGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPQ--YDTTLADACNALAQRWT------KAKDADLSGFSEADIKQLSSHQLIEFLALLLLQVDPLPTSHVKRMQEVYKFNSINNSEIRCRWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFRDVYNFAKFRDEAVKVFKEHRNEMHSVT 558          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Match: rnpep (arginyl aminopeptidase [Source:NCBI gene;Acc:103045130])

HSP 1 Score: 325.094 bits (832), Expect = 3.239e-100
Identity = 203/631 (32.17%), Postives = 333/631 (52.77%), Query Frame = 1
Query:  253 SQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVR-NLEIKRIVI--DNEDVLFQYVNGK----LGGKLVIPLSLG-TKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIGKDKML-RWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG-PIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPD-----QRYYFFQVLNDIQGVQLPESSLKVMGNIYG-LTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDW-DDTKSRTVENFHIQKFAMHPITRGEIHKII 2088
            +  D  + ++   F ++  H + ++DF+   +SG+    V+    ++ EL+LD   +LE+  +    D  D      + +     G  LV+      +   +F + I+Y T +    + W+ PE T GK   ++++Q QA+  RS +PC DTP VK+TY+A I+ P     VMSA +     +++      EQ  PIP+YLV++A G LV +++GPRS V++EP L E A+ E++  IE+ L++ E L GPY W   D+L +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEI HSW GNLVTN+ W  FW+NEG T Y +R I ++L   E Y  L    G + L   ++      G DH   KL   +  G DPDD+++  PYEKG   + YL  L G  K    +LK Y+  F+ +SV  ++   FF ++  + +K    K+EG+++D W    G P+ +   S    S+++  ++L   W        +++  +   S++  +     Q  YF   +  I+   LP+ + +++   Y  +  + N+EL   W+ +  ++ + P    V  FL+ QG+ KY   +Y+ L+   ++ K+   E F      +H   R  + KI+
Sbjct:   12 TAEDVATSSSFRRFRIEHFHLDLQVDFDQRSLSGTESLRVRCALGSAAELLLDSHPSLELHEVSFSRDERDWTAAQFHSRDFTSYGSTLVVQFPTAWSSGDQFHLSIKY-TAHQGPGVCWLDPEQTAGKLRPYVFTQGQAVLNRSFFPCFDTPAVKSTYTAAIKVPDGFTAVMSATKWEHRKADNTFLFSMEQ--PIPAYLVALAVGDLVSAEVGPRSRVWTEPCLLEAAKKEYDGVIEEFLLVGERLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRICKELY-GEAYTCLEAATGRALLRQHMDN----TGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLRGDQKRFDAFLKAYVDRFKFRSVIAEDALEFFLEFFPDLKKNSVHKIEGLEFDSWLNVSGWPLYLPDLS-AGQSLMKPADQLADLW-------GADSVDIAAISKINTEAWKTYQTVYFLDKI--IEKSPLPDGNTRMLEEQYPHMVKSNNAELRLRWAQIVAKNQHKPGYPHVRSFLSCQGKQKYTLPVYRALWSGTEEMKALATEIFSATSHQLHINVRNYVKKIM 624          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Match: rnpep (arginyl aminopeptidase [Source:NCBI gene;Acc:103045130])

HSP 1 Score: 310.842 bits (795), Expect = 3.125e-95
Identity = 192/590 (32.54%), Postives = 314/590 (53.22%), Query Frame = 1
Query:  253 SQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVR-NLEIKRIVI--DNEDVLFQYVNGK----LGGKLVIPLSLG-TKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLIGKDKML-RWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG-PIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPD-----QRYYFFQVLNDIQGVQLPESSLKVMGNIYG-LTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYN 1968
            +  D  + ++   F ++  H + ++DF+   +SG+    V+    ++ EL+LD   +LE+  +    D  D      + +     G  LV+      +   +F + I+Y T +    + W+ PE T GK   ++++Q QA+  RS +PC DTP VK+TY+A I+ P     VMSA +     +++      EQ  PIP+YLV++A G LV +++GPRS V++EP L E A+ E++  IE+ L++ E L GPY W   D+L +PPSFP+GGMENPC+ F+TPCLL GD+S  + I HEI HSW GNLVTN+ W  FW+NEG T Y +R I ++L   E Y  L    G + L   ++      G DH   KL   +  G DPDD+++  PYEKG   + YL  L G  K    +LK Y+  F+ +SV  ++   FF ++  + +K    K+EG+++D W    G P+ +   S    S+++  ++L   W        +++  +   S++  +     Q  YF   +  I+   LP+ + +++   Y  +  + N+EL   W+ +  ++ + P    V  FL+ Q R  ++
Sbjct:   12 TAEDVATSSSFRRFRIEHFHLDLQVDFDQRSLSGTESLRVRCALGSAAELLLDSHPSLELHEVSFSRDERDWTAAQFHSRDFTSYGSTLVVQFPTAWSSGDQFHLSIKY-TAHQGPGVCWLDPEQTAGKLRPYVFTQGQAVLNRSFFPCFDTPAVKSTYTAAIKVPDGFTAVMSATKWEHRKADNTFLFSMEQ--PIPAYLVALAVGDLVSAEVGPRSRVWTEPCLLEAAKKEYDGVIEEFLLVGERLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRICKELY-GEAYTCLEAATGRALLRQHMDN----TGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLRGDQKRFDAFLKAYVDRFKFRSVIAEDALEFFLEFFPDLKKNSVHKIEGLEFDSWLNVSGWPLYLPDLS-AGQSLMKPADQLADLW-------GADSVDIAAISKINTEAWKTYQTVYFLDKI--IEKSPLPDGNTRMLEEQYPHMVKSNNAELRLRWAQIVAKNQHKPGYPHVRSFLSCQVRRHFS 583          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007860.1 (pep scaffold:Pmarinus_7.0:GL477456:228700:267302:1 gene:ENSPMAG00000007109.1 transcript:ENSPMAT00000007860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 208.379 bits (529), Expect = 5.307e-63
Identity = 99/180 (55.00%), Postives = 124/180 (68.89%), Query Frame = 1
Query:  643 QAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSS---TLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFW 1173
            QAI+ RS+ PCQDTP +K TY A +  P  L  +MSA+   S     + +   HKF+Q + IPSYL+++  G L   +IGPR+ V+SE E  E+A  EF + E +L  AEEL GPY W   DLL+LPPSFPYGGMENPC+ F+TP +L GDKS    +AHEISHSWTGNLVTN TW+HFW
Sbjct:    1 QAIHCRSMVPCQDTPSLKFTYDAKVSVPKSLVALMSALCDGSEPDPTNGEFTVHKFKQPVQIPSYLIALVVGALKSREIGPRTKVWSEKEFVEQAASEFSETETMLTTAEELVGPYVWGRYDLLVLPPSFPYGGMENPCLTFVTPTVLAGDKSLAGVVAHEISHSWTGNLVTNKTWEHFW 180          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007859.1 (pep scaffold:Pmarinus_7.0:GL477456:174117:191217:1 gene:ENSPMAG00000007104.1 transcript:ENSPMAT00000007859.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 1.434e-27
Identity = 69/190 (36.32%), Postives = 100/190 (52.63%), Query Frame = 1
Query: 1309 YGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLE-TLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFH--QFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSEL 1869
            +GP+H FTKLVP L G DPDDSFS VPYEKG  LL++LE  L G D  + ++K YI  F   + +T+EWK + F+Y  +K  V    L+ + W  W Y PG  P++     D ++  +C+ L   W         S   + L  FS    +Q+  F  +L     + +   SL+ M  +Y L +  NSE+
Sbjct:    4 FGPEHGFTKLVPVLDGVDPDDSFSTVPYEKGFALLYHLEQALGGPDVFIGFVKAYIEKFAYSTATTEEWKAYLFEYFKDKADV----LQAVDWKAWIYSPGMPPVKLQ--YDTTLADDCSALATRWSQAKDADLASFSADDLKDFSS---NQKVEFLALLLLQPALPV--KSLQRMEEVYKLNSVKNSEI 182          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007869.1 (pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1 gene:ENSPMAG00000007088.1 transcript:ENSPMAT00000007869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.976e-19
Identity = 91/381 (23.88%), Postives = 156/381 (40.94%), Query Frame = 1
Query:  463 FQYVNGKLGGKLVIPLSL--GTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAV----RKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL----VGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQLN--------YIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKL-------VPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE-WKTF 1521
            F Y N      L  P +L  G+   K + + E N  +        K     G+      +Q +A +AR  +PC D P +K T+  T+  P D  V +S +    RK      ++ + ++ +   + +YL++   G        S  G    VY+    +E+ +   E   K L   ++    PY     DL+ +   F  G MEN   + +    LL   K+  +         + HE++H W GNLVT   W H W+NEG  +++E L ++           H +    E +         Y P  E   L       VP  H  + D+ F  + Y KG+ ++  L   IG +   + +  Y+  F+ K+ +T++ W++ 
Sbjct:   76 FNYQNEDEKVALSFPSTLEPGSGMLKIEFVGELN--DKMKGFYRSKYTAACGEARYAAVTQFEATDARRAFPCWDEPGIKATFDVTLIVPQD-RVALSNMNVLERKPHEADPELVEVRYARTPIMSTYLLAFVVGEFDFVEARSSDGVLVRVYTPLGKSEQGKFALEVATKTLPFYKDYFNVPYPLPKIDLIAIA-DFAAGAMENWGLVTYRETALLVDPKNSSSASKQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVD-----------HCF---PEFDIWTQFVSTDYAPALELDALDNSHPIEVPVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDEDFKKGMNMYLTKFQHKNAATEDLWESL 438          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 78.5666 bits (192), Expect = 3.888e-15
Identity = 82/330 (24.85%), Postives = 129/330 (39.09%), Query Frame = 1
Query:  634 SQSQAINARSLYPCQDTPFVKTTYSATI------EAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL-----VGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLL-------TGDK-SQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDP--------------DDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRL-KSVSTDEWK 1515
            SQ +  +AR  +PC D P +K T+  T+       A S++ VV   +  ++++  D    KF   + +P+YL++           V +K   R            A        KIL   EE    PY     D + +P  F  G MEN   + +    LL        G+K S    + HE++H W GNLVT   W   W+NEG  +YLE                  Y+G  E+E   N+  +I   D +    V  L    P              +  F  + Y KG+ +L    + + +   +  LK+Y+   +   +V  D W+
Sbjct:  210 SQMEPTDARKTFPCFDEPDMKATFDITLIHKAEHVALSNMPVVY--MSTATSIEEDWVHTKFNTSVVMPTYLLAFIISDFEKVEAVANKTLIRIWAKKTEIAAGNAEYALNITGKILNFFEEYYDVPYVLPKSDQIAIP-DFAAGAMENWGLVTYRETALLYNPDVSSNGNKESVATIVTHELAHQWFGNLVTMRWWSELWLNEGFASYLE------------------YIGTHEVEPSWNIKALIILNDLQRAMSVDALASSRPLSVPHSEVMTPAQANSMFDTISYSKGACILSMTSSFLTEPVFVAGLKSYLKEMQFGNAVHQDLWR 518          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 77.411 bits (189), Expect = 8.374e-15
Identity = 72/320 (22.50%), Postives = 133/320 (41.56%), Query Frame = 1
Query:  610 GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATI-EAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVG----SKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQ--------LNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE-WKTF 1521
            G       +Q +  +AR  +PC D P  K ++  +I    +   +    + ++ T  + + +  F+  + + +YLV+            +K G   ++Y+ P   ++     E+  K L   EEL    Y     DL+ +P  F  G MEN   + +    LL G K+            IAHE++H W GNLVT + W+  W+NEG   ++E +    L+    +  + ++L    +E    + Q      H  +     +      + F  V Y KG+ +L  L T +     +  ++ Y+      +  TD+ W++ 
Sbjct:  324 GSDRPLAVTQFEPTSARESFPCFDEPDFKASFDISIVRDAAHTTLSNMPLNETVTRKDGLLEDTFKGSVVMSTYLVAFIVSDFKSISNKTKHGTNVSIYTSPGKEQQGSFALENAIKFLDFYEELFNISYPLPKQDLVAIP-DFAAGAMENWGLVTYRETALLLGPKASGVRDTLWVAQVIAHELAHQWFGNLVTMNWWNDLWLNEGFATFMEFVATGSLKPD--WLMMDVFLTEVVMEA---LTQDSLPSSHAISSAA--VGTMQIGEMFDSVSYNKGASVLNMLRTFLTPAVFVDGIRDYLLVHSYGNAHTDDLWESL 635          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Yeast
Match: LAP2 (Leucyl aminopeptidase yscIV with epoxide hydrolase activity; metalloenzyme containing one zinc atom; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; also known as leukotriene A4 hydrolase [Source:SGD;Acc:S000004990])

HSP 1 Score: 349.747 bits (896), Expect = 6.944e-110
Identity = 225/633 (35.55%), Postives = 355/633 (56.08%), Query Frame = 1
Query:  262 DKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSA---SKELILDVRNLEIKRIVIDNEDVLFQYVNGK--LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFE-DIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLH-GKDPDDSFSRVPYEKGSLLLFYLETLI-GKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHH-SLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRM-----LPDQRYYFFQVLN----------DIQGVQLPESSLKVMGNIY--GLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            D+++ +N +DF V  +  N  + FE   ISGSV   +K L+     S EL LD   L+++ + ID     FQ    K  LG +LVI  +  +    F + I++ TT+  TALQW+  + T G K  +++SQ +AI+ARSL+PC DTP VK+T++A+IE+P  L VV S +R   T S D   ++FEQK+PIP+YL+ IA G L  + IGPRSTVY+EP   +  + EFE D+EK +  AE++   YEW   D+L+   S+PYGGME+P + F TP L+  D+S ++ IAHE++HSW+GNLVTN +W+HFW+NEG T YLER I+  +   EP RH    +G S+L+  ++  +    P+  F+ LV NL+   DPDD+FS VPYEKG  LLF+LET++ GK +   +++ Y   F  KS+ T ++    +++  EK+++    L+ + W+ W YKPG  P  H  + L D++ Q    L   W+   Q   +  +  ++F+ +       +Q   F + L           D    + P +S + + +IY   +  + N+E++       + +        + ++L + GR+K+ +  Y+ L   D  +   +  F   K   HPI +  + +
Sbjct:   57 DQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRKEPLGSRLVI--NNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGK-PYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESP--LPVVFSGIRIEDT-SKDTNIYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIH-GEPTRHFSALIGWSDLQNSIDSMK---DPE-RFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEI----LDSVDWETWLYKPGMPPRPHFITALADNVYQ----LADKWVEMAQHLKTTEDFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKFPVAS-RALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLLNSVD--RRLALATFDKFKDTYHPICKALVKQ 667          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Yeast
Match: AAP1 (Arginine/alanine amino peptidase; overproduction stimulates glycogen accumulation; AAP1 has a paralog, APE2, that arose from the whole genome duplication [Source:SGD;Acc:S000001089])

HSP 1 Score: 73.559 bits (179), Expect = 8.059e-14
Identity = 77/317 (24.29%), Postives = 134/317 (42.27%), Query Frame = 1
Query:  610 GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL--VGS---KIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMENPCIIF--LTPCLLTGDKSQLN-------YIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVST-DEW 1512
            G+      +Q +A +AR  +PC D P +K T++ T+ + S L  + +   ++ T+    +   F     + +YLV+     L  V S   +I  R  VYS P   +  +       + L   E+     Y     D++ +   F  G MEN  ++   +   LL  + S L+        I HE++H W GNLVT   W+  W+NEG   ++      K Q        ++      L+  LN+  +      E    VP  +  + +  F  + Y KGS LL  +   +G++  ++ +  Y+  F+  +  T D W
Sbjct:  121 GETKYMATTQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYTTFNTTPKMSTYLVAFIVADLRYVESNNFRIPVR--VYSTPGDEKFGQFAANLAARTLRFFEDTFNIEYPLPKMDMVAVH-EFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYV---TDNLQRALNLDSLRSSHPIE----VPVNNADEINQIFDAISYSKGSSLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTGDLW 427          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Yeast
Match: APE2 (Aminopeptidase yscII; may have a role in obtaining leucine from dipeptide substrates; APE2 has a paralog, AAP1, that arose from the whole genome duplication [Source:SGD;Acc:S000001640])

HSP 1 Score: 67.781 bits (164), Expect = 5.031e-12
Identity = 72/315 (22.86%), Postives = 132/315 (41.90%), Query Frame = 1
Query:  610 GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL--VGSK---IGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMENPCIIF--LTPCLLTGDKSQLNYIA-------HEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE 1509
            G+      +Q +  +AR  +PC D P +K +++ T+ +   L  + +   K+  + +  +   F     + +YLV+     L  V SK   I  R  VY+ P   +  +   +   K L   E+  G  Y     D + +   F  G MEN  ++   +   LL  D S L+ I        HE++H W GNLVT   W+  W+NEG   ++      + Q        ++      L+  L++  +      E    VP     + +  F  + Y KG+ LL  +   +G++  ++ +  Y+  F+  +  T++
Sbjct:  217 GETKYMATTQMEPTDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVKNEYVKDGKKVTLFNTTPKMSTYLVAFIVAELKYVESKNFRIPVR--VYATPGNEKHGQFAADLTAKTLAFFEKTFGIQYPLPKMDNVAVH-EFSAGAMENWGLVTYRVVDLLLDKDNSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPEWKVWEQYV---TDTLQHALSLDSLRSSHPIE----VPVKKADEINQIFDAISYSKGASLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTED 521          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Yeast
Match: TMA108 (Ribosome-associated, nascent chain binding factor; binds N-terminal region of nascent peptides during translation; recognizes target proteins via its putative metallopeptidase peptide-binding pocket [Source:SGD;Acc:S000001399])

HSP 1 Score: 53.9138 bits (128), Expect = 9.003e-8
Identity = 67/307 (21.82%), Postives = 123/307 (40.07%), Query Frame = 1
Query:  634 SQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQH--KFEQKIPIPSYLVSIACGHLVGSKI-----GPRS---TVYSEPELNEKARLEFEDIEKILVIAEE-LCGPYEWEICDLLILPPSFPYGGMENPCII-------FLTPCLLTGD---KSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEK------LQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDP--DDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKT 1467
            +  Q  +A +++PC D P  K+T+   I   +  + V +   +     +  ++H  KF +   + + +   + G L   K      G R+   ++Y+  ++   A    + ++K L + E     PY     D ++LP       MEN  +I        + P  L  +   +     I HE+ H W GN ++  +W+  W NE    +L   ILE+        +SEPY    +   +     D+N   I         ++     G D    D F    Y KG ++L  L+   G+  + + L++
Sbjct:  152 THCQPFSASNIFPCIDEPSNKSTFQLNIATDAQYKAVSNTPVEMVEALDSSQKHLVKFAKTPLMTTSVFGFSIGDLEFLKTEIKLEGDRTIPVSIYAPWDI-ANAAFTLDTVQKYLPLLESYFKCPYPLPKLDFVLLP-YLSDMAMENFGMITIQLNHLLIPPNALANETVREQAQQLIVHELVHQWMGNYISFDSWESLWFNESFATWLACHILEQNGDLSHYWTSEPYLLQQVEPTMCRDAADVNGRSIF--------QIAQRNTGIDSQTSDIFDPEAYTKGIIMLRSLQLATGESHLQKGLES 448          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Match: EDO33493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS27])

HSP 1 Score: 447.203 bits (1149), Expect = 1.492e-147
Identity = 245/623 (39.33%), Postives = 352/623 (56.50%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVI--DNEDVLFQYVNG--KLGGKLVIPLSLGTKR-SKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSN---DVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLR-WLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRM------LPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            +D  S++  E+ +     +N  +DF ++ +   V  +  V       L+LD R+L ++ + +   N+ + F   +     G  L I L  G K  ++  + I Y T+ D++ALQW+ PE T GKKH ++++Q QAI+ARS+ PCQD+P VK TYSA +  P DL  +MSA R  S L +   D+  ++FEQK+ IPSYL+++  G L G ++GPRS V++E E+ E+   EF ++E+++  AE L G Y W   DLLILPPSFPYGGMENPC+ F+TP LL GD+S    IAHEISHSWTGNLVTNSTW+HFW+NEG T +LER I+ +++  E  R      G   L   ++     +  +   TKLV +L   DPDD+FS VPYEKGS  L YLE L+G  ++   + + YI  ++ K+ +TDEWKTF F Y  +K  +    LE + W+ W  KPG  P+      D S+   C  L + WI      +SE E LN FS         P +  +  Q+L       L  + L+ M N Y   +  NSE+   W  LC+RS +  A     +FL SQGR+K+ + LY+ L+  + +K   V  F   +   HPI    + K
Sbjct:    2 SDPCSFSRPEECLCTNITWNVSVDFASKVLVCDVELDFLVKKDNVASLVLDTRDLNVQSVAVRPSNDQLTFSLGSKHKAFGTPLEISLPPGLKSGARLSIAISYRTSPDASALQWLTPEQTSGKKHPYMFTQCQAIHARSIIPCQDSPGVKATYSAKVSVPKDLVALMSAARTGSELDHQKQDLMTYQFEQKVAIPSYLIALVVGALKGRQVGPRSHVWTEQEMVEECAYEFAEMEQMISAAESLVGEYVWGPYDLLILPPSFPYGGMENPCLTFVTPTLLAGDRSLTGVIAHEISHSWTGNLVTNSTWEHFWLNEGFTVFLERKIIGRMK-GEQMRQFGFIGGWKTLMDAVSK----FADNMSLTKLVVSLKDTDPDDAFSSVPYEKGSCFLVYLEQLLGGPEVFEPFFRKYIDTYKYKTCTTDEWKTFLFDYFKDKTNI----LETVDWEAWLRKPGMPPVNMIERYDSSLADACISLCQKWIN-----ASEKE-LNSFSSQDIASFTSPQKVEFLAQLLAKTSSSPLSVAHLQAMQNAYQFNSYKNSEIKFRWLRLCVRSGWADAFQPTVDFLLSQGRMKFTRPLYEELFKCEKSKDLAVTTFKKHRAFYHPICSAMVAK 609          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Match: EDO41732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I6])

HSP 1 Score: 144.436 bits (363), Expect = 3.578e-36
Identity = 126/513 (24.56%), Postives = 224/513 (43.66%), Query Frame = 1
Query:  541 VIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSA--VRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGH---------LVGSKIGPRSTVYSE----PELNEKARLEFED-IEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEP------------YRHLHIYLGISEL--EGDLNMY----QIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQF------PSSENELLNKFSRMLPD------QRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFL 1941
            V+I+Y+T+ +  +L W     T       ++S    IN RSL PCQ+ P   +T+ A I  P     +MS   V   +T ++  +       +P+P   +++A G+         +  +K GP   V       P + ++A  E    +   +  + EL GPY +   DLLILP  F   G++NP ++FL+  +L GD S    +AHEISH+W G L+    W   W++EG + Y+E  I  + +   P             R L  Y  +S    E D N+     +    P+ E        +G+     +++V Y KG  LL ++  ++G +   R+L  Y+  ++ + V++++    FF+Y + K       ++   + +W   PG +P     L       + N L+ A +   +F       +  N+ +N   R  P+             +   ++   L  ++L+ +   Y  + T N E+ H W  L +++ + P +D V  FL
Sbjct:   19 VVIKYHTSPEGQSLSWA----TDQDGRPCVFSPGAYINNRSLMPCQEPPIAMSTWQAAIHVPHGCMALMSGNPVTMETTATDTDKGRYCTMDVPLPCSTLAMAVGYFESMEGRSAICPTKDGPAEPVECRMIAVPSIIDRASDELLSYVPGFIEASCELLGPYPFSRLDLLILPKCFACMGLKNPNLVFLSQSVLAGDGSIRVRVAHEISHAWFGLLIGAKDWTEEWLSEGFSTYIEERIQARAEKVNPGCAKKKNNSLRELRQLLRYRALSAEMDETDENLQCLRSRASLSPNEEAKPFTVVKNGQICSKKWTQVHYLKGYFLLHHMAAMVGLENFERFLYEYVQHYQGQLVTSED----FFQYFVCKFPNVSQSVKDEFFLEWLESPG-LP---KCLRSKKFNVKENALIAAALKQFEFWRKQDNINKRNKTMNIKRRKQPEAEPLEHSEQIVLMLEKLVERDALMHTTLRQLNRCYNFS-TRNCEIRHRWCELVVKNKFTPFLDDVKHFL 518          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Match: EDO26623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBI5])

HSP 1 Score: 104.76 bits (260), Expect = 4.043e-25
Identity = 58/144 (40.28%), Postives = 79/144 (54.86%), Query Frame = 1
Query: 1309 YGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLR-WLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFS 1737
            +  +   TKLV +L   DPDD+FS VPYEKGS  L YLE L+G  ++   + + YI  ++ K+ +TDEWKTF F Y  +K  +    LE + W+ W  KPG  P+      D S+   C  L + WI      +SE E LN FS
Sbjct:    4 FADNMSLTKLVVSLKDTDPDDAFSSVPYEKGSCFLVYLEQLLGGPEVFEPFFRKYIDTYKYKTCTTDEWKTFLFDYFKDKTNI----LETVDWEAWLRKPGMPPVNMIERYDSSLADACISLCQKWIN-----ASEKE-LNSFS 137          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Match: EDO38460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU3])

HSP 1 Score: 100.523 bits (249), Expect = 9.108e-22
Identity = 97/427 (22.72%), Postives = 179/427 (41.92%), Query Frame = 1
Query:  298 VDKSHFNWKLDFENEQISGS---VVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTM--GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL----VGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQ--------LNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE-WKTF 1521
            +D+ HF+ K+D        +   +VHN +          L+V +++I++        + Q+   K     V+      + S + V I Y          + +   T   G++  F+ +Q + + AR  +PC D P +K T++ TI    D   + +     S + +  R   FEQ + + +YLV+   G        ++   +  VYS  E  +           +L + ++     Y     D++ LP   P G MEN  +I      L  +K             IAHE++H W GN+VT + WD  W+NE    +   +  +   ++EP  H+  +  +  +E  + +  +     H     VP +   +  + F  + Y KG+ +L  LE +IG D  +  L+ Y+      + +TD+ W++F
Sbjct:   45 LDRDHFHGKVDIYINVFKATKIIIVHNRR----------LNVSDIDIRKTGSQGSLGIRQHFPFKKNQFYVMEAEQSLEPSLYVVSISYKGFYSKGLRGFYRSSFTQNNGQRVYFVATQFEPVKAREAFPCFDEPGMKATFNITIAHRPDYVALSNMPIYQSKIIDGQRHDYFEQSVVMSTYLVAFTVGDFYYKETVTENNVKMRVYSRREALDTTEYAIRVGRDVLKLFDQYYDMGYSLTKLDMIGLPEFGP-GAMENWGLIKYRESYLLWNKESSEDAKYNVARIIAHELAHQWFGNIVTMAWWDDLWLNEA---FATLMAYKGADAAEPSWHVDQHFLVDTVEVAMTLDGL--ASSHPIR--VPVISPDEIGEIFDAISYSKGATVLRMLEYIIGNDTFIDGLRRYLKTHAYGNANTDDLWESF 453          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Match: EDO47790 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL33])

HSP 1 Score: 98.9821 bits (245), Expect = 3.681e-21
Identity = 88/320 (27.50%), Postives = 146/320 (45.62%), Query Frame = 1
Query:  610 GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIE-APSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVS-IACGHLVGSKIGPRSTV---YSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMENPCIIFL--TPCLLTGDKSQLNY-------IAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE-WKTF 1521
            GK  +   +Q Q  +AR  +PC D P +K T++ TIE  P  + +    + K+ T +     H FE+ + +P+YL++ + C   V      R  +   Y+ P+  E+         KIL   E      Y     D++ +P  F  G MEN  ++    T  L     S  +Y       IAHE++H W GNLVT   WD  W+NEG  +++E   + K+   EP   +     I++ +   ++  ++    H   K+  N H  + ++ F  + Y KGS +L  LE  +G++K  + L  Y+      +  TD+ WK  
Sbjct:  207 GKNVTIATTQFQPTDARKAFPCLDEPALKATFNITIEHRPDFIAISNMPIWKNETRNGRTVDH-FEKTVVMPTYLLAMVVCDFGVKETKSARGVMMRYYAPPDKVEQLNYAASIGNKILDDFEHYYNISYPLPKADMIAIP-DFAAGAMENWGLMTYRETALLWKEGTSSESYKQRVAAVIAHELAHQWFGNLVTMEWWDDLWLNEGFASFVEYKGVNKV---EPTWGMDDQFVITDSDTAFSLDGLV--SSHPI-KVAVN-HPAEINEIFDSISYNKGSCILRMLEDFLGENKFKKGLTRYLKRHAYGNAETDDLWKAL 517          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Match: lta4h (leukotriene A4 hydrolase [Source:NCBI gene;Acc:101172215])

HSP 1 Score: 436.417 bits (1121), Expect = 7.574e-143
Identity = 238/620 (38.39%), Postives = 352/620 (56.77%), Query Frame = 1
Query:  259 NDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKL--GGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQ---HKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKM-LRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSR-----MLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHK 2082
            +D  S+++    +    + + ++DF    I+G+V   V+ L      L LD R+L +  +  + +   F   +     G +L I L     R +  ++ + Y T+  ++ALQW+ PE T GKK  +L+SQ QA + RS+ PCQDTP VK TY A +  P DL  VMSAVR       +      ++F Q +P+PSYL++I  G L   +IGPRS V+SE E  +KA  EF + E +L  AE+L GPY W   D+L+LPPSFPYGGMENPC+ F TP LL GDKS    IAHEISHSWTGNLVTN TW+HFW+NEGHT YLER+I  ++   E +R      G  +L+  +N     +GP++  T LVP+L   DPDD+FS VPYEKG  LL++LE L+G  ++ + ++K+YI  +   SV+TD+WK + F Y   K++ E   L  + W+ W + PG  P++     D ++   C  L + W        + ++ L+ FS      +   Q   F  +L  +    LP + +K M  +YGL   TNSE+   W  LC+RS +  AV    +    QGR+K+ + L++ +++++  +   V+ F   + AMHP+T G + K
Sbjct:    2 SDPCSFSSPSRCVTKHLNLHLRVDFRRRVIAGTVELTVEALEDNFSLLTLDTRDLNVVSVSANQQPARFTLASKHSFKGTQLDITLPFHLSRGQHVIVQVVYETSPSASALQWLTPEQTAGKKQPYLFSQCQAHHCRSMVPCQDTPSVKHTYYAQVSVPKDLVAVMSAVRDGQEEDPEDSSRIVYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEFVDKAAFEFSETETMLKTAEDLAGPYVWGQYDILVLPPSFPYGGMENPCLTFATPTLLAGDKSLSTVIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRQMY-GEQFRQFKAMGGWKDLQDSVN----TFGPNNPLTNLVPSLQDVDPDDAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLYAYGSVTTDDWKNYLFTYF--KDQAE--ALNRVDWNAWMFTPGMPPVKPQ--YDTTLADACIALSQRWT------KAGDQDLDGFSESDVKTLSSHQLIEFLSLL--LHENPLPLTHVKKMQEVYGLNTCTNSEIRFRWLKLCVRSKWEEAVPLALKMATEQGRMKFTRPLFREVFNFNKYRDEAVQVFAAHRTAMHPVTAGLVAK 602          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:101154957])

HSP 1 Score: 98.5969 bits (244), Expect = 1.409e-20
Identity = 105/417 (25.18%), Postives = 180/417 (43.17%), Query Frame = 1
Query:  328 DFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNED------VLFQYVNGKLGGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMT--MGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQHKFEQ-KIPIPSYLVSIACGHLVGSKIGPRST---VYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTG-DKSQL------NYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLET-LIGKDKMLRWLKTYIAAFRLKSVSTD 1506
            D +N   +G  V N+ VL++ ++ ++L   NL I       +D       + QY   K   ++ +  +   K  ++ V+ + Y+    ST   +     T   G KH    +Q + ++AR  +PC D P  K T+   I    +   + +  + +S  L + + Q +FE+  + + +YLV+    +    +     T   VYS PE  E  R   E   K+L          Y  +  DL+ +P  F  G MEN   I F    LL G D S L      + +AHE++H W GNLVT   W+  W+NEG   Y++ L L+++        L + +    ++ D     +I         + P+      ++ F  V YEKG+ +L  L   L G+ +  + +  Y+  F   +  T+
Sbjct:  193 DLDNMTFAGIAVINMSVLHNTNR-IVLHGLNLNISNATFKIDDGPASNVTVLQY---KANQQIAVKFTEDLKAGQYCVLTLTYSANLSSTYDGFYSSSYTDKSGTKHILAATQFEPLSARKAFPCFDEPAFKATFLIKINRKQNYTTLSNMPQSESRLLPSGLFQDEFERTSVNMSTYLVAFVVANFSAVRKNVSETLVSVYSVPEKTEHTRYALEAASKLLEFYNTFFDIDYPLKKLDLVAIP-DFLAGAMENWGLITFRETTLLVGKDSSPLEKQVVASVVAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYLSLQRVFPELQAEILFLSVRFRVMDKD----ALISSHPVSTAVVTPD----QVEEMFDSVSYEKGASILLMLNAYLPGEQQFRKGIIQYLKQFSGSNTETN 596          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:101154957])

HSP 1 Score: 98.2117 bits (243), Expect = 1.645e-20
Identity = 105/417 (25.18%), Postives = 180/417 (43.17%), Query Frame = 1
Query:  328 DFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNED------VLFQYVNGKLGGKLVIPLSLGTKRSKFQVI-IEYNTTNDSTALQWMKPEMT--MGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQHKFEQ-KIPIPSYLVSIACGHLVGSKIGPRST---VYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMEN-PCIIFLTPCLLTG-DKSQL------NYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLET-LIGKDKMLRWLKTYIAAFRLKSVSTD 1506
            D +N   +G  V N+ VL++ ++ ++L   NL I       +D       + QY   K   ++ +  +   K  ++ V+ + Y+    ST   +     T   G KH    +Q + ++AR  +PC D P  K T+   I    +   + +  + +S  L + + Q +FE+  + + +YLV+    +    +     T   VYS PE  E  R   E   K+L          Y  +  DL+ +P  F  G MEN   I F    LL G D S L      + +AHE++H W GNLVT   W+  W+NEG   Y++ L L+++        L + +    ++ D     +I         + P+      ++ F  V YEKG+ +L  L   L G+ +  + +  Y+  F   +  T+
Sbjct:  194 DLDNMTFAGIAVINMSVLHNTNR-IVLHGLNLNISNATFKIDDGPASNVTVLQY---KANQQIAVKFTEDLKAGQYCVLTLTYSANLSSTYDGFYSSSYTDKSGTKHILAATQFEPLSARKAFPCFDEPAFKATFLIKINRKQNYTTLSNMPQSESRLLPSGLFQDEFERTSVNMSTYLVAFVVANFSAVRKNVSETLVSVYSVPEKTEHTRYALEAASKLLEFYNTFFDIDYPLKKLDLVAIP-DFLAGAMENWGLITFRETTLLVGKDSSPLEKQVVASVVAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYLSLQRVFPELQAEILFLSVRFRVMDKD----ALISSHPVSTAVVTPD----QVEEMFDSVSYEKGASILLMLNAYLPGEQQFRKGIIQYLKQFSGSNTETN 597          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Match: enpep (glutamyl aminopeptidase [Source:NCBI gene;Acc:101155001])

HSP 1 Score: 86.6557 bits (213), Expect = 6.096e-17
Identity = 84/315 (26.67%), Postives = 130/315 (41.27%), Query Frame = 1
Query:  643 QAINARSLYPCQDTPFVKTTYSATIEAPSDLEVV--MSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL-VGSKIGPRST---VYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDL-LILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQ--------LNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHI---YLGISELEGDLNMYQII--YGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVST-DEWKTF 1521
            +  +AR  +PC D P  K TY+ +I    D   +  M    K   L  +  +  F++ +P+ +YLV  A        KI  R     +Y++P     A       + I    EE    + + I  L  I  P F  G MEN   + +    LL  D+           + IAHE+ H W GN+VT   WD  W+NEG  ++ E + +EK + S   R + I    L +   +  L+ + II       E T +            F  + Y KG+ +L  LE  +G+D      + Y+  F  K+  T D W + 
Sbjct:  224 EPTDARKSFPCFDEPNKKATYNISITHHKDYRALSNMPQEVKCRLLPGNKLKTSFQKSVPMSTYLVCFAVHQFEFVEKISKRGIPLRIYAQPSQLGTAEFAANTTKVIFDYFEEYFDMF-YSISKLDQIAIPDFGTGAMENWGLVTYRETNLLYDDRESSSSNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYIGVEKAEPSWGMRDIMIISDVLPVMVNDALLSSHPIIVDVSTPAEITSV------------FDAISYSKGASVLRMLEDWMGRDAFRDGCRKYLKDFYFKNAKTADFWASL 525          
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Match: enpep (glutamyl aminopeptidase [Source:NCBI gene;Acc:101155001])

HSP 1 Score: 86.2705 bits (212), Expect = 7.217e-17
Identity = 83/315 (26.35%), Postives = 130/315 (41.27%), Query Frame = 1
Query:  643 QAINARSLYPCQDTPFVKTTYSATIEAPSDLEVV--MSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHL-VGSKIGPRST---VYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDL-LILPPSFPYGGMEN-PCIIFLTPCLLTGDKSQ--------LNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHI---YLGISELEGDLNMYQII--YGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVST-DEWKTF 1521
            +  +AR  +PC D P  K TY+ +I    D   +  M    +   L  +  +  F++ +P+ +YLV  A        KI  R     +Y++P     A       + I    EE    + + I  L  I  P F  G MEN   + +    LL  D+           + IAHE+ H W GN+VT   WD  W+NEG  ++ E + +EK + S   R + I    L +   +  L+ + II       E T +            F  + Y KG+ +L  LE  +G+D      + Y+  F  K+  T D W + 
Sbjct:  224 EPTDARKSFPCFDEPNKKATYNISITHHKDYRALSNMPQEGQPEVLPGNKLKTSFQKSVPMSTYLVCFAVHQFEFVEKISKRGIPLRIYAQPSQLGTAEFAANTTKVIFDYFEEYFDMF-YSISKLDQIAIPDFGTGAMENWGLVTYRETNLLYDDRESSSSNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYIGVEKAEPSWGMRDIMIISDVLPVMVNDALLSSHPIIVDVSTPAEITSV------------FDAISYSKGASVLRMLEDWMGRDAFRDGCRKYLKDFYFKNAKTADFWASL 525          
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Match: SMESG000014392.1 (SMESG000014392.1)

HSP 1 Score: 1279.62 bits (3310), Expect = 0.000e+0
Identity = 616/618 (99.68%), Postives = 618/618 (100.00%), Query Frame = 1
Query:  244 MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRMLPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKIIFPR 2097
            MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLN+FSRMLPDQRYYFFQVLN+IQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKIIFPR
Sbjct:    1 MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNRFSRMLPDQRYYFFQVLNEIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQKFAMHPITRGEIHKIIFPR 618          
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Match: SMESG000049276.1 (SMESG000049276.1)

HSP 1 Score: 503.442 bits (1295), Expect = 3.266e-171
Identity = 250/459 (54.47%), Postives = 322/459 (70.15%), Query Frame = 1
Query:  244 MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPG 1608
            M  S ND  SYANSED++ +   F+W +DF+ + I GSV   +K L     +L LD + L+IK++ +   +  F  V+ K   LG  L IP+  G    KF V I+Y TT + TALQW+ PE T+GKKH +L+SQ QAI+ARSL+PCQD+P VK+TYSA ++AP+   V+MSA++ +  T   +   HKFEQK+ I SYLV+I CG+L G K+  RSTV+SEPE+ EKA  EF D E +L IAE +CG Y W I DLL+LPPSFPYGGMENPC+ F+TP LL GDKS +  +AHEI+HSWTGNLVTN TW+ FW+NEGHT Y+ERLI+EK   SE  RHL I +GI+EL+  LN     YG  H+F +LVP L   DPDDSFSRVPYEKGS LLF+LE + GKD+MLRWLK Y   ++ KS++TDEWK FF+KYMI+KE +  +KL+ + W   F + G
Sbjct:    1 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPI--GISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA----YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKGFMEDG 453          
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Match: SMESG000053576.1 (SMESG000053576.1)

HSP 1 Score: 452.595 bits (1163), Expect = 2.535e-151
Identity = 246/517 (47.58%), Postives = 314/517 (60.74%), Query Frame = 1
Query:  244 MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQ--FPSSENELLNKFSRMLPDQRYYFFQV 1776
            M  S ND  SYANSED++ +   F+W +DF+ + I GSV   +K L     +L LD + L+IK++ +   +  F  V+ K   LG  L IP+  G    KF V I+Y TT + TALQW+ PE T+GKKH +L+SQ QAI+ARSL+PCQD+P VK+TYSA ++AP+   V+MSA++ +  T   +   HKFEQK+ I SYLV+I CG+L G K+  RSTV+SEPE+ EKA  EF D E +L IAE +CG Y W I DLL+LPPSFPYGGMENPC+ F+TP LL GDKS +  +AHEI+HSWTGNLVTN TW+ FW+NEGHT Y+ERLI+EK   SE  RHL I +GI+EL+  LN     YG  H+F +LVP L   DPDDSFSRVPYEKGS LLF+LE + GKD                                              W  WFY    IP++H    D     E   L   WI  +     S + +LL ++   LP Q+YYF QV
Sbjct:    1 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPI--GISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA----YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKD----------------------------------------------WKKWFYGRWKIPVDHVLKRDHGDASE--RLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQV 463          
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Match: SMESG000039842.1 (SMESG000039842.1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.083e-19
Identity = 90/395 (22.78%), Postives = 167/395 (42.28%), Query Frame = 1
Query:  397 ELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLS--LGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVRKSST-LSNDVRQHKFEQKIPIPSYLVSIACGHL----VGSKIGPRSTVYSEPELNEKARLEFEDIEKIL-VIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLN---------YIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGIS--ELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLK-SVSTDEWKTF 1521
            E++L+  +L I   +++NE     YVN     +++IPLS  L   ++K  ++      ++         +    ++     +Q +A +AR  +PC D P +K T+  T+  P     + +   K  T +S  + + ++E+   + +YL++   G L         G R  VY+  + + + R   +   + L   A      Y     DL+ +P  F  G MEN  ++     +L  D+ + +          + HE +H W GNLVT   W   W+NEG   ++E L ++       Y    I+   S  E    LN+  +      + T   P+    + D+ F  + Y KG+ ++  L   +  +K  + L  Y+   R + +V+ D W   
Sbjct:   47 EIVLNATSLSITNAMVNNEKCSVTYVNEY--DRIIIPLSKPLLPGKAKLDLLFSGTLNDEMKGFYRSTYKTDSNEEIRMAVTQFEASDARRAFPCWDEPNIKATFDITLVVPKTKTALSNMPEKCRTEVSGSLVKIEYEKSPIMSTYLLAFVIGELDYVESHDSNGVRVRVYTAKDKSNRGRFALDVCCRTLPFYATYFDIVYPLPKMDLVAIP-DFAAGAMENWGLVTYRETMLLVDEHESSSLSKQIVALVVGHECAHMWFGNLVTMDWWTDLWLNEGFATWIEYLCVDYC-----YPEFDIWTNFSSDEYARALNLDALRSSHPIQVTVHKPS----EIDEIFDAISYSKGACVIRMLNDYLTNEKFKKGLSIYLKRHRYQNAVTADLWAAL 429          
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Match: SMESG000026219.1 (SMESG000026219.1)

HSP 1 Score: 86.6557 bits (213), Expect = 4.011e-17
Identity = 81/328 (24.70%), Postives = 141/328 (42.99%), Query Frame = 1
Query:  610 GKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSA-VRKSSTLSNDVRQHKFEQKIPIPSYLVSIAC---------GHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCG-PYEWEICDLLILPPSFPYGGMENPCII---FLTPCL------LTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSS-EPYRHLHIYLGISELEGD--LNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDE-WKTF 1521
            G + + + +  +   AR  +PC D P+ K  +S  +    D   + +  +R +  L+N +    +E  + + +YLV+            G+   +K   R  +Y+  +  +      E  +K+L   E L G  Y     D++ +P  F  G MEN  +I   F T  L      +    S    I+HEI+H W GN+VT   W+  W+NEG   Y E L  + +        H ++   +  L  D  LN + I           VP    ++ +  F ++ Y KG+ L+  LE ++G + +   LK Y+  +R ++  +D  W  F
Sbjct:  218 GVEKTLITTHMEPTFARQAFPCFDEPYFKANFSLRMVRDKDHHSLFNMPLRSTEKLANGLYCDSYETSVKMSTYLVAYMLLPLDYISLDGYASLNKTKIR--IYAPKDQKDYTSFALEIAQKVLPFFENLFGIDYPLPKLDMIAIP-DFSAGAMENWGLITYKFFTLLLNPKSPKIQHKTSIAKIISHEIAHQWFGNIVTMDWWNDLWLNEGFATYSEYLAGDYINREWGMIGHFYLEQFVDALNFDSLLNSHPI----------QVPVKDPQEIESIFDQISYGKGASLVRMLEGVLGLETLKVGLKIYLQRYRYQTAVSDNLWTAF 532          
The following BLAST results are available for this feature:
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LTA4H7.456e-14640.90leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
LTA4H5.734e-14242.08leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
LTA4H1.913e-12445.81leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
RNPEP1.664e-9632.87arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGN... [more]
RNPEP2.697e-8244.00arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ltah-1.13.053e-13537.76Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.13.053e-13537.76Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.16.689e-13437.76Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.16.689e-13437.76Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.16.689e-13437.76Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106021.182e-12535.44gene:FBgn0032721 transcript:FBtr0089314[more]
CG106021.182e-12535.44gene:FBgn0032721 transcript:FBtr0089315[more]
CG106021.606e-12435.44gene:FBgn0032721 transcript:FBtr0347402[more]
CG463393.792e-1923.80gene:FBgn0285963 transcript:FBtr0472698[more]
CG463394.026e-1923.80gene:FBgn0285963 transcript:FBtr0472697[more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h8.131e-13738.67leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h1.699e-13638.67leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
rnpep3.987e-10432.80arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
rnpep3.987e-10432.80arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
rnpepl12.001e-7028.73arginyl aminopeptidase like 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd372.081e-14039.38CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd373.302e-12337.30CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd375.770e-12037.12CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd375.079e-11738.17CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd378.525e-11738.47CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lta4h1.072e-14540.00leukotriene A4 hydrolase [Source:MGI Symbol;Acc:MG... [more]
Rnpep7.667e-9835.67arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
Rnpep1.693e-8132.51arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
Rnpepl12.054e-6931.03arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
Aopep1.817e-2422.10aminopeptidase O [Source:MGI Symbol;Acc:MGI:191931... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SZH7|LKHA4_BOVIN2.118e-14540.40Leukotriene A-4 hydrolase OS=Bos taurus OX=9913 GN... [more]
sp|P09960|LKHA4_HUMAN3.581e-14540.90Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 ... [more]
sp|Q6S9C8|LKHA4_CHILA3.698e-14540.83Leukotriene A-4 hydrolase OS=Chinchilla lanigera O... [more]
sp|P24527|LKHA4_MOUSE7.500e-14540.00Leukotriene A-4 hydrolase OS=Mus musculus OX=10090... [more]
sp|P19602|LKHA4_CAVPO7.753e-14340.67Leukotriene A-4 hydrolase OS=Cavia porcellus OX=10... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0R3553.702e-16543.58Leukotriene A-4 hydrolase OS=Fasciola hepatica OX=... [more]
A0A504X7M04.781e-16443.51Leukotriene A-4 hydrolase OS=Fasciola gigantica OX... [more]
A0A5K3FS521.372e-16142.03Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PPR41.978e-16142.09Leuk-A4-hydro_C domain-containing protein OS=Schis... [more]
A0A0X3PWM75.560e-16142.30Leukotriene A-4 hydrolase OS=Schistocephalus solid... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h3.661e-11635.17leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h1.191e-11234.10leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h4.756e-10934.25leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
rnpep3.239e-10032.17arginyl aminopeptidase [Source:NCBI gene;Acc:10304... [more]
rnpep3.125e-9532.54arginyl aminopeptidase [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007860.15.307e-6355.00pep scaffold:Pmarinus_7.0:GL477456:228700:267302:1... [more]
ENSPMAT00000007859.11.434e-2736.32pep scaffold:Pmarinus_7.0:GL477456:174117:191217:1... [more]
ENSPMAT00000007869.11.976e-1923.88pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1... [more]
ANPEP3.888e-1524.85alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
lnpep8.374e-1522.50leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
LAP26.944e-11035.55Leucyl aminopeptidase yscIV with epoxide hydrolase... [more]
AAP18.059e-1424.29Arginine/alanine amino peptidase; overproduction s... [more]
APE25.031e-1222.86Aminopeptidase yscII; may have a role in obtaining... [more]
TMA1089.003e-821.82Ribosome-associated, nascent chain binding factor;... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO334931.492e-14739.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417323.578e-3624.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266234.043e-2540.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384609.108e-2222.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477903.681e-2127.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h7.574e-14338.39leukotriene A4 hydrolase [Source:NCBI gene;Acc:101... [more]
lnpep1.409e-2025.18leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
lnpep1.645e-2025.18leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
enpep6.096e-1726.67glutamyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
enpep7.217e-1726.35glutamyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Leukotriene A-4 hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014392.10.000e+099.68SMESG000014392.1[more]
SMESG000049276.13.266e-17154.47SMESG000049276.1[more]
SMESG000053576.12.535e-15147.58SMESG000053576.1[more]
SMESG000039842.13.083e-1922.78SMESG000039842.1[more]
SMESG000026219.14.011e-1724.70SMESG000026219.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033366 ID=SMED30033366|Name=Leukotriene A-4 hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2516bp
ATAAATTTGGTATATTGCAACTGGTAAAATATATTATAAACTCGCATTCA
AACTCCAACTATAGCAACATCTTTGTGTGTGTCTGTGTGTAATGTATGCA
ATCACAAGTGACCAATGGAAAACAATCCAGACCAGCCATTCATTGCTCAC
CATTTGTGTGTTTGTGCATTGCATTACACACCTACTCACTTTCACTTTGG
TTCAAATTGATTCGTTTGCCATTTGTTTGTCATTTGAAACAAAATGGAAT
TCTCTCAAAATGACAAAACTTCTTATGCAAATTCCGAAGATTTTATCGTT
GACAAATCTCATTTCAATTGGAAATTAGATTTTGAAAATGAGCAAATATC
CGGCTCCGTTGTACACAATGTGAAAGTGCTCAATTCTGCATCAAAGGAAT
TGATTCTCGATGTTCGCAATCTAGAGATCAAACGGATCGTCATCGATAAT
GAAGATGTACTGTTTCAATATGTAAATGGAAAGCTGGGGGGTAAGTTGGT
GATCCCATTATCTCTCGGAACAAAAAGATCAAAGTTCCAGGTAATCATTG
AGTATAATACAACAAACGATTCTACTGCGTTGCAATGGATGAAACCTGAA
ATGACCATGGGAAAGAAACATTCTTTTCTCTATAGTCAGTCTCAAGCTAT
TAACGCACGTAGCCTTTATCCATGCCAAGATACTCCGTTTGTTAAGACCA
CGTATAGCGCAACAATTGAAGCGCCAAGCGACCTTGAAGTGGTAATGAGT
GCTGTTAGGAAGTCTAGCACACTATCTAATGATGTCAGGCAACATAAATT
TGAACAAAAAATTCCTATCCCATCATATTTAGTATCTATCGCATGTGGCC
ATTTAGTTGGCTCTAAGATTGGTCCTAGAAGCACTGTTTACAGTGAACCA
GAATTAAATGAGAAAGCTAGATTGGAATTCGAAGATATTGAAAAAATTCT
TGTTATTGCTGAAGAATTATGTGGGCCATATGAATGGGAGATTTGTGATT
TGCTAATTTTGCCTCCTTCGTTTCCATATGGAGGCATGGAGAATCCTTGT
ATAATATTTCTGACGCCTTGCTTGCTGACGGGAGATAAATCGCAACTTAA
TTACATCGCTCATGAAATTTCCCATTCCTGGACTGGAAATTTGGTCACAA
ATAGCACATGGGATCACTTCTGGGTGAATGAAGGCCATACAAATTATTTG
GAGAGACTGATTCTAGAGAAACTTCAATCATCAGAACCATATCGGCATTT
GCATATCTATCTTGGAATTTCTGAATTGGAAGGAGATTTGAATATGTATC
AGATAATTTACGGTCCTGATCATGAATTCACAAAACTTGTACCGAATCTT
CACGGCAAAGATCCCGACGATTCATTCTCTCGAGTACCCTACGAGAAAGG
CTCATTACTTTTATTTTATCTAGAGACATTAATCGGAAAAGATAAGATGC
TGCGATGGCTCAAAACATATATTGCTGCGTTTCGCTTGAAATCGGTATCG
ACAGATGAATGGAAAACCTTTTTCTTCAAATACATGATTGAAAAAGAAAA
GGTTGAACCATCCAAGCTGGAGGGAATCAAATGGGATGATTGGTTCTACA
AACCGGGCCCAATTCCCATTGAACATCATTCATTGCTTGATGATTCAATG
ATTCAAGAGTGCAACGAGCTGGTAAAAGCGTGGATTGGTTTCCACCAATT
CCCATCCAGTGAAAATGAATTACTCAATAAATTTTCTCGAATGCTTCCGG
ATCAAAGATATTATTTTTTCCAGGTTTTGAATGATATTCAAGGAGTCCAA
TTGCCAGAATCATCCCTGAAAGTGATGGGAAATATTTATGGCCTGACAAA
TACAACGAATTCTGAACTCCTCCACGGCTGGTCCTTACTCTGTTTGCGAT
CGCATTACATGCCTGCCGTCGATCAGGTATTCGAATTTCTCAACAGCCAA
GGTCGTCTAAAGTATAATAAAGTTCTTTACAAACATCTTTATGATTGGGA
TGATACCAAATCAAGAACTGTGGAGAACTTTCATATACAAAAGTTTGCCA
TGCATCCCATTACAAGAGGAGAGATCCACAAGATTATTTTTCCACGATTG
AATTAATGAACTATGAGCTCTGAACGTATTCATGACATTTTATGATTCTT
ATACTTTTATATATTGATTAGTGTATTTGGTAAAAATCAAATTAGTAGTG
TGTTGTGTCAGTTCTGGATCAAACCACTGTATAGCTTACGCAATCATGGG
GCAGCCATTAAATGATATGACCATGTACACTATGAGTAACCTTAAGGAGT
TTATGTCATACATATGGTAATGAAATCGTTACATAATCAACAGATTTTAC
ATAACACTTGCGCTGCAAAAATATTTTGTTTCAATGAGGTTGCCATTATT
TTGGATTTTTTATTGAAGTTTCATTTTTAAATGTCAATTGTGAATTTATT
ATATAATGTGGGTGGAGATTCGTGAATATGATTGGTTGAATGCTAGTTGT
TAAAAGCTATGATGGC
back to top

protein sequence of SMED30033366-orf-1

>SMED30033366-orf-1 ID=SMED30033366-orf-1|Name=SMED30033366-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=621bp
MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSAS
KELILDVRNLEIKRIVIDNEDVLFQYVNGKLGGKLVIPLSLGTKRSKFQV
IIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFV
KTTYSATIEAPSDLEVVMSAVRKSSTLSNDVRQHKFEQKIPIPSYLVSIA
CGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEI
CDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNL
VTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLN
MYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKD
KMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDW
FYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQFPSSENELLNKFSRM
LPDQRYYFFQVLNDIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLC
LRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDWDDTKSRTVENFHIQK
FAMHPITRGEIHKIIFPRLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003503ventral epidermis progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR014782Peptidase_M1_dom
IPR015211Peptidase_M1_C
IPR016024ARM-type_fold
IPR001345PG/BPGM_mutase_AS
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0005488binding
GO:0003824catalytic activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
GO:0006508proteolysis