protein TASOR isoform X3

Overview
Nameprotein TASOR isoform X3
Smed IDSMED30033365
Length (bp)1425
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of protein TASOR isoform X3 (SMED30033365) t-SNE clustered cells

Violin plots show distribution of expression levels for protein TASOR isoform X3 (SMED30033365) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of protein TASOR isoform X3 (SMED30033365) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for protein TASOR isoform X3 (SMED30033365) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033365

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033365h1SMcG0001524 SmedASXL_007949SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymal cellSMED30033365h1SMcG0001524 dd_Smed_v4_2774_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033365 Contig107GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of protein TASOR isoform X3 vs. Ensembl Human
Match: TEX15 (testis expressed 15, meiosis and synapsis associated [Source:HGNC Symbol;Acc:HGNC:11738])

HSP 1 Score: 90.1225 bits (222), Expect = 2.806e-18
Identity = 53/201 (26.37%), Postives = 103/201 (51.24%), Query Frame = 1
Query:  124 ENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGK-RKMVPMYDP-KVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLA 720
            + ++   L+ +  ++  W   +  ++ N+  E+ F  KR E+RE   +    + +F FLA   +  + ++ + G+  +      LG+   G+++  + D+ LN + ++  + E ++++FK + GK +K+ P  D  KV L P+PNFD H+    P   +   +Q   S VY YE+S  L  PV +P+ C+P   +  + L 
Sbjct:   63 DTLNQCRLDVNCDLQSLWQFGDTKLVHNEELEKNFTAKRSEMRESGRHCRELEEQFCFLALPQSD-VAQIYQNGISTRASTLKILGNPLLGIYMFRHVDIALNYSHSQSITVE-SILIFKVLFGKVKKIQPSVDKNKVSLDPSPNFDCHMSRNAPSLKDTIELQAYSSAVYFYEYS-VLSKPVDKPRQCLPYAVVTVKFLG 260          
BLAST of protein TASOR isoform X3 vs. Ensembl Human
Match: TEX15 (testis expressed 15, meiosis and synapsis associated [Source:HGNC Symbol;Acc:HGNC:11738])

HSP 1 Score: 90.1225 bits (222), Expect = 2.807e-18
Identity = 53/201 (26.37%), Postives = 103/201 (51.24%), Query Frame = 1
Query:  124 ENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGK-RKMVPMYDP-KVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLA 720
            + ++   L+ +  ++  W   +  ++ N+  E+ F  KR E+RE   +    + +F FLA   +  + ++ + G+  +      LG+   G+++  + D+ LN + ++  + E ++++FK + GK +K+ P  D  KV L P+PNFD H+    P   +   +Q   S VY YE+S  L  PV +P+ C+P   +  + L 
Sbjct:   67 DTLNQCRLDVNCDLQSLWQFGDTKLVHNEELEKNFTAKRSEMRESGRHCRELEEQFCFLALPQSD-VAQIYQNGISTRASTLKILGNPLLGIYMFRHVDIALNYSHSQSITVE-SILIFKVLFGKVKKIQPSVDKNKVSLDPSPNFDCHMSRNAPSLKDTIELQAYSSAVYFYEYS-VLSKPVDKPRQCLPYAVVTVKFLG 264          
BLAST of protein TASOR isoform X3 vs. Ensembl Human
Match: TASOR (transcription activation suppressor [Source:HGNC Symbol;Acc:HGNC:30314])

HSP 1 Score: 62.003 bits (149), Expect = 2.010e-9
Identity = 56/208 (26.92%), Postives = 92/208 (44.23%), Query Frame = 1
Query:  139 TNLNHSVHIEDS----WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT-LIVFKYMLGKRKMVPMYDP-----------KVLLAPTPNFDSHVCE-ERPIPNEKHAIQYIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIF 708
             N+ HS ++E +    +N + A ++ N+  E+EF EKR E++            + FL  +    +  + E+GL +       LG  + GV++S  AD+      N  ++  +  +++FK M GK K +  YDP           K  L PTP  + HV +    I +      Y  +  Y YE+  DEL     RP+H  P   + F
Sbjct:  127 VNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQ-VQTICEKGLHVGQSKITILGSPSMGVYLSRYADLL---QANPLDTGAMGDVVIFKIMKGKIKSI--YDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQYYFYEYGFDELRR---RPRHVCPYAVVSF 325          
BLAST of protein TASOR isoform X3 vs. Ensembl Human
Match: TASOR (transcription activation suppressor [Source:HGNC Symbol;Acc:HGNC:30314])

HSP 1 Score: 61.6178 bits (148), Expect = 2.196e-9
Identity = 56/208 (26.92%), Postives = 92/208 (44.23%), Query Frame = 1
Query:  139 TNLNHSVHIEDS----WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT-LIVFKYMLGKRKMVPMYDP-----------KVLLAPTPNFDSHVCE-ERPIPNEKHAIQYIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIF 708
             N+ HS ++E +    +N + A ++ N+  E+EF EKR E++            + FL  +    +  + E+GL +       LG  + GV++S  AD+      N  ++  +  +++FK M GK K +  YDP           K  L PTP  + HV +    I +      Y  +  Y YE+  DEL     RP+H  P   + F
Sbjct:  127 VNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQ-VQTICEKGLHVGQSKITILGSPSMGVYLSRYADLL---QANPLDTGAMGDVVIFKIMKGKIKSI--YDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQYYFYEYGFDELRR---RPRHVCPYAVVSF 325          
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Match: BX649301.2 (transcription activation suppressor b [Source:NCBI gene;Acc:566775])

HSP 1 Score: 65.4698 bits (158), Expect = 9.578e-11
Identity = 59/207 (28.50%), Postives = 101/207 (48.79%), Query Frame = 1
Query:   97 ESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCE-ERPIPNEKHAIQYIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIFE 711
            ES E  ++++ +S+  L+ +     ++N   A +I N+  E+EF EK+ E+++           + FL  + N  +  + E+GL +     N LG+   GV++S  +D+          + EI  I+FK M GK K++    PK  L PT  FDSHV +    + +      +  +  Y YEF+ DEL     RP+H +P   + F+
Sbjct:  112 ESREFEDVVKLLSTFYLDATSRA--TFNYTKASLIHNELLEKEFIEKKRELKQNGRTEAELAESYAFLLPDRNK-VHFICEKGLSVGHSRINNLGNSAKGVYLSKYSDLLQMNPFEVGAAGEI--ILFKVMKGKVKIIENI-PKNTLEPTLKFDSHVYKNASKVTSLLSYRAFEHTQQYFYEFAYDELKS---RPRHVLPYAVVSFQ 309          
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Match: tasor2 (transcription activation suppressor family member 2 [Source:ZFIN;Acc:ZDB-GENE-041111-225])

HSP 1 Score: 65.0846 bits (157), Expect = 1.263e-10
Identity = 51/198 (25.76%), Postives = 85/198 (42.93%), Query Frame = 1
Query:  187 NAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHA--IQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFH 774
            +A +I N + ++ +   R E RE+ Y     +  FGFL  ++     K+ E GL +     + LG    GV+IS  +D CL+  R  ++ +   +++ K   GK K V     +    PTP FD HV E+    +   +  + + ++  Y YE           P+H  P   + F     S   +L +     T FH
Sbjct:   48 SAHLINNPASQQRYAAFRSEKREKGYSEQELEESFGFLLLDDINRARKVGETGLLVGRAKCSTLGDSLKGVYISKYSD-CLDLKR-WYDGKTGYIVLLKLTKGKVKEVKDNYTQNFTPPTPGFDCHVSEQLGAVSSTTSSFLAFERTQYYFYEICKGSSKTEACPRHACPFAIVAFSYGKMSTSTELEQKSQDKTVFH 243          
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Match: tasor2 (transcription activation suppressor family member 2 [Source:ZFIN;Acc:ZDB-GENE-041111-225])

HSP 1 Score: 65.0846 bits (157), Expect = 1.273e-10
Identity = 51/198 (25.76%), Postives = 85/198 (42.93%), Query Frame = 1
Query:  187 NAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHA--IQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFH 774
            +A +I N + ++ +   R E RE+ Y     +  FGFL  ++     K+ E GL +     + LG    GV+IS  +D CL+  R  ++ +   +++ K   GK K V     +    PTP FD HV E+    +   +  + + ++  Y YE           P+H  P   + F     S   +L +     T FH
Sbjct:   48 SAHLINNPASQQRYAAFRSEKREKGYSEQELEESFGFLLLDDINRARKVGETGLLVGRAKCSTLGDSLKGVYISKYSD-CLDLKR-WYDGKTGYIVLLKLTKGKVKEVKDNYTQNFTPPTPGFDCHVSEQLGAVSSTTSSFLAFERTQYYFYEICKGSSKTEACPRHACPFAIVAFSYGKMSTSTELEQKSQDKTVFH 243          
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Match: tasorb (transcription activation suppressor b [Source:ZFIN;Acc:ZDB-GENE-090311-29])

HSP 1 Score: 65.0846 bits (157), Expect = 1.343e-10
Identity = 58/207 (28.02%), Postives = 102/207 (49.28%), Query Frame = 1
Query:   97 ESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCE-ERPIPNEKHAIQYIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIFE 711
            ES E  ++++ +S+  L+ +     ++N   A +I N+  E+EF EK+ E+++           + FL ++ N  +  + E+GL +     N LG+   GV++S  +D+          + EI  I+FK M GK K++    PK  L PT  +DSHV +    + +      +  +  Y YEF+ DEL     RP+H +P   + F+
Sbjct:  112 ESREFEDVVKLLSTFYLDATSRA--TFNYTKASLIHNELLEKEFIEKKRELKQNGRTEAELAESYAFLLSDRNK-VHFICEKGLSVGHSRINNLGNSAKGVYLSKYSDLLQMNPFEVGAAGEI--ILFKVMKGKVKIIENI-PKNTLEPTLKYDSHVYKNASKVTSLLSYRAFEHTQQYFYEFAYDELKS---RPRHVLPYAVVSFQ 309          
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Match: tasorb (transcription activation suppressor b [Source:ZFIN;Acc:ZDB-GENE-090311-29])

HSP 1 Score: 65.0846 bits (157), Expect = 1.343e-10
Identity = 58/207 (28.02%), Postives = 102/207 (49.28%), Query Frame = 1
Query:   97 ESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCE-ERPIPNEKHAIQYIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIFE 711
            ES E  ++++ +S+  L+ +     ++N   A +I N+  E+EF EK+ E+++           + FL ++ N  +  + E+GL +     N LG+   GV++S  +D+          + EI  I+FK M GK K++    PK  L PT  +DSHV +    + +      +  +  Y YEF+ DEL     RP+H +P   + F+
Sbjct:  112 ESREFEDVVKLLSTFYLDATSRA--TFNYTKASLIHNELLEKEFIEKKRELKQNGRTEAELAESYAFLLSDRNK-VHFICEKGLSVGHSRINNLGNSAKGVYLSKYSDLLQMNPFEVGAAGEI--ILFKVMKGKVKIIENI-PKNTLEPTLKYDSHVYKNASKVTSLLSYRAFEHTQQYFYEFAYDELKS---RPRHVLPYAVVSFQ 309          
BLAST of protein TASOR isoform X3 vs. Ensembl Mouse
Match: Tex15 (testis expressed gene 15 [Source:MGI Symbol;Acc:MGI:1934816])

HSP 1 Score: 98.2117 bits (243), Expect = 3.040e-22
Identity = 56/200 (28.00%), Postives = 104/200 (52.00%), Query Frame = 1
Query:  127 NISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGK-RKMVPMYDP-KVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLA 720
             +    L+ S  ++ +W      +++N+  E++F  KR E+RE   +S   +  F FLA     ++D + + GL +   P   LG+   GV++  + D+ L+ A ++  + E ++++FK + G+ +K+ P  D  KV L P+PNFD H+    P   +   +Q   S+VY YE+ D    PV +P+ C+P   +  + + 
Sbjct:   65 TLKQCRLDMSCDLQFTWQFGETKLVRNEYLEKQFAAKRSEMREGGRHSRELEEHFCFLALPQADVMD-VYQNGLSVGTSPLRILGNPLLGVYLCRHVDIALSHACSRSVAVE-SIMIFKVLFGRIKKIQPSMDKNKVSLDPSPNFDCHMSRNMPSLKDTIELQAYNSMVYFYEY-DYFSRPVDKPRQCLPYAIVTVKCIG 261          
BLAST of protein TASOR isoform X3 vs. Ensembl Mouse
Match: Tex15 (testis expressed gene 15 [Source:MGI Symbol;Acc:MGI:1934816])

HSP 1 Score: 97.4413 bits (241), Expect = 6.812e-21
Identity = 56/194 (28.87%), Postives = 103/194 (53.09%), Query Frame = 1
Query:  145 LNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGK-RKMVPMYDP-KVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLA 720
            L+ S  ++ +W      +++N+  E++F  KR E+RE   +S   +  F FLA     ++D + + GL +   P   LG+   GV++  + D+ L+ A ++  + E ++++FK + G+ +K+ P  D  KV L P+PNFD H+    P   +   +Q   S+VY YE+ D    PV +P+ C+P   +  + + 
Sbjct:   71 LDMSCDLQFTWQFGETKLVRNEYLEKQFAAKRSEMREGGRHSRELEEHFCFLALPQADVMD-VYQNGLSVGTSPLRILGNPLLGVYLCRHVDIALSHACSRSVAVE-SIMIFKVLFGRIKKIQPSMDKNKVSLDPSPNFDCHMSRNMPSLKDTIELQAYNSMVYFYEY-DYFSRPVDKPRQCLPYAIVTVKCIG 261          
BLAST of protein TASOR isoform X3 vs. Ensembl Mouse
Match: Tasor (transcription activation suppressor [Source:MGI Symbol;Acc:MGI:1921694])

HSP 1 Score: 60.8474 bits (146), Expect = 2.635e-9
Identity = 55/207 (26.57%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  142 NLNHSVHIEDS----WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT-LIVFKYMLGKRKMVPMYDP-----------KVLLAPTPNFDSHVCEERPIPNEKHAIQ-YIKSLVYLYEFSDELYDPV-IRPKHCVPIGALIF 708
            N+ HS ++E S    +N + A +I N+  E+EF EKR E++            + FL  +    +  + E+GL++       LG  + G+++   AD+      N   +  +  +++FK M GK K +  YDP           K  L PTP  + HV +         A + Y  +  Y YE+    +D V  RP+H  P   + F
Sbjct:  123 NILHSSYLEPSSVTYFNYRRACLIHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQ-VQSICEKGLQVGQSKITVLGSPSMGIYLCRYADLL---QANPLEAGAVGDVVIFKIMKGKIKSI--YDPLSVKSLESMLSKNALDPTPKHECHVSKNASRITSLLAYRAYELTQYYFYEYG---FDEVRRRPRHVCPYAVVSF 320          
BLAST of protein TASOR isoform X3 vs. UniProt/SwissProt
Match: sp|Q9UK61|TASOR_HUMAN (Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=1 SV=3)

HSP 1 Score: 62.003 bits (149), Expect = 9.817e-9
Identity = 56/208 (26.92%), Postives = 92/208 (44.23%), Query Frame = 1
Query:  139 TNLNHSVHIEDS----WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT-LIVFKYMLGKRKMVPMYDP-----------KVLLAPTPNFDSHVCEERPIPNEKHAIQ-YIKSLVYLYEFS-DELYDPVIRPKHCVPIGALIF 708
             N+ HS ++E +    +N + A ++ N+  E+EF EKR E++            + FL  +    +  + E+GL +       LG  + GV++S  AD+      N  ++  +  +++FK M GK K +  YDP           K  L PTP  + HV +         A + Y  +  Y YE+  DEL     RP+H  P   + F
Sbjct:  127 VNILHSSYLEPTSVTNFNYRRACLVHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQ-VQTICEKGLHVGQSKITILGSPSMGVYLSRYADLL---QANPLDTGAMGDVVIFKIMKGKIKSI--YDPMGVKSLESMLNKSALDPTPKHECHVSKNANRITSLLAYRAYELTQYYFYEYGFDELRR---RPRHVCPYAVVSF 325          
BLAST of protein TASOR isoform X3 vs. UniProt/SwissProt
Match: sp|Q69ZR9|TASOR_MOUSE (Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 1.949e-8
Identity = 55/207 (26.57%), Postives = 91/207 (43.96%), Query Frame = 1
Query:  142 NLNHSVHIEDS----WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT-LIVFKYMLGKRKMVPMYDP-----------KVLLAPTPNFDSHVCEERPIPNEKHAIQ-YIKSLVYLYEFSDELYDPV-IRPKHCVPIGALIF 708
            N+ HS ++E S    +N + A +I N+  E+EF EKR E++            + FL  +    +  + E+GL++       LG  + G+++   AD+      N   +  +  +++FK M GK K +  YDP           K  L PTP  + HV +         A + Y  +  Y YE+    +D V  RP+H  P   + F
Sbjct:  123 NILHSSYLEPSSVTYFNYRRACLIHNELLEKEFTEKRRELKFDGRLDKELSESYAFLMVDRYQ-VQSICEKGLQVGQSKITVLGSPSMGIYLCRYADLL---QANPLEAGAVGDVVIFKIMKGKIKSI--YDPLSVKSLESMLSKNALDPTPKHECHVSKNASRITSLLAYRAYELTQYYFYEYG---FDEVRRRPRHVCPYAVVSF 320          
BLAST of protein TASOR isoform X3 vs. TrEMBL
Match: A0A1I8HB87 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 7.926e-40
Identity = 74/211 (35.07%), Postives = 116/211 (54.98%), Query Frame = 1
Query:   82 DEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEA--RNKFNSEEITLIVFKYMLGKRKMVPMYDPK--VLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGAL 702
            + + + S+   ++      + LN      D W L    +++N  FE EF+E+R E   +    D     +GFLA  +  L+D    EGL+++  P N LG+C SGVH+ ++ DVCL EA      + E+I L+ FK+M G+ + V    PK   ++AP+P F+ H+ + RP   +  + QY++SL YLYEF +  Y PV RP+ C P+ AL
Sbjct:   12 EAVNLGSDYATQIFRGFVDSFLNPPSATLDQWRLVKLEMLENGYFEEEFSERRAEFSRQGLAQDELSTHYGFLAAASEELVDLTLREGLKVRFCPINSLGYCISGVHLCVHGDVCLQEAALETGDDGEQIVLVAFKFMFGRTRRVTPVTPKDMAIIAPSPGFNCHIPDVRPGRTDSLSDQYLRSLAYLYEFENSFYHPVPRPRQCSPLAAL 222          
BLAST of protein TASOR isoform X3 vs. TrEMBL
Match: A0A1I8H7Z4 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 8.377e-40
Identity = 74/211 (35.07%), Postives = 116/211 (54.98%), Query Frame = 1
Query:   82 DEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEA--RNKFNSEEITLIVFKYMLGKRKMVPMYDPK--VLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGAL 702
            + + + S+   ++      + LN      D W L    +++N  FE EF+E+R E   +    D     +GFLA  +  L+D    EGL+++  P N LG+C SGVH+ ++ DVCL EA      + E+I L+ FK+M G+ + V    PK   ++AP+P F+ H+ + RP   +  + QY++SL YLYEF +  Y PV RP+ C P+ AL
Sbjct:   12 EAVNLGSDYATQIFRGFVDSFLNPPSATLDQWRLVKLEMLENGYFEEEFSERRAEFSRQGLAQDELSTHYGFLAAASEELVDLTLREGLKVRFCPINSLGYCISGVHLCVHGDVCLQEAALETGDDGEQIVLVAFKFMFGRTRRVTPVTPKDMAIIAPSPGFNCHIPDVRPGRTDSLSDQYLRSLAYLYEFENSFYHPVPRPRQCSPLAAL 222          
BLAST of protein TASOR isoform X3 vs. TrEMBL
Match: A0A267GDX0 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000758g2 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.740e-39
Identity = 74/211 (35.07%), Postives = 116/211 (54.98%), Query Frame = 1
Query:   82 DEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEA--RNKFNSEEITLIVFKYMLGKRKMVPMYDPK--VLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGAL 702
            + + + S+   ++      + LN      D W L    +++N  FE EF+E+R E   +    D     +GFLA  +  L+D    EGL+++  P N LG+C SGVH+ ++ DVCL EA      + E+I L+ FK+M G+ + V    PK   ++AP+P F+ H+ + RP   +  + QY++SL YLYEF +  Y PV RP+ C P+ AL
Sbjct:   12 EAVNLGSDYATQIFRGFVDSFLNPPSATLDQWRLVKLEMLENGYFEEEFSERRAEFSRQGLAQDELSTHYGFLAAASEELVDLTLREGLKVRFCPINSLGYCISGVHLCVHGDVCLQEAALETGDDGEQIVLVAFKFMFGRTRRVTPVTPKDMAIIAPSPGFNCHIPDVRPGRTDSLSDQYLRSLAYLYEFENSFYHPVPRPRQCSPLAAL 222          
BLAST of protein TASOR isoform X3 vs. TrEMBL
Match: A0A267ESJ1 (DUF3715 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032307g1 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.380e-38
Identity = 74/211 (35.07%), Postives = 116/211 (54.98%), Query Frame = 1
Query:   82 DEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEA--RNKFNSEEITLIVFKYMLGKRKMVPMYDPK--VLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGAL 702
            + + + S+   ++      + LN      D W L    +++N  FE EF+E+R E   +    D     +GFLA  +  L+D    EGL+++  P N LG+C SGVH+ ++ DVCL EA      + E+I L+ FK+M G+ + V    PK   ++AP+P F+ H+ + RP   +  + QY++SL YLYEF +  Y PV RP+ C P+ AL
Sbjct:   24 EAVNLGSDYATQIFRGFVDSFLNPPSATLDQWRLVKLEMLENGYFEEEFSERRAEFSRQGLAQDELSTHYGFLAAASEELVDLTLREGLKVRFCPINSLGYCISGVHLCVHGDVCLQEAALETGDDGEQIVLVAFKFMFGRTRRVTPVTPKDMAIIAPSPGFNCHIPDVRPGRTDSLSDQYLRSLAYLYEFENSFYHPVPRPRQCSPLAAL 234          
BLAST of protein TASOR isoform X3 vs. TrEMBL
Match: A0A1I8FKM2 (DUF3715 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.721e-27
Identity = 56/152 (36.84%), Postives = 86/152 (56.58%), Query Frame = 1
Query:  226 FNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEA--RNKFNSEEITLIVFKYMLGKRKMVPMYDPK--VLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVI 669
            F E    +  +    D     +GFLA  +  L+D    EGL+++  P N LG+C SGVH+ ++ DVCL EA      + E+I L+ FK+M G+ + V    PK   ++AP+P F+ H+ + RP   +  + QY++SL YLYEF +  Y PV+
Sbjct:   15 FREAGRVLARQGLAQDELSTHYGFLAAASEELVDLTLREGLKVRFCPINSLGYCISGVHLCVHGDVCLQEAALETGDDGEQIVLVAFKFMFGRTRRVTPVTPKDMAIIAPSPGFNCHIPDVRPGRTDSLSDQYLRSLAYLYEFENSFYHPVV 166          
BLAST of protein TASOR isoform X3 vs. Ensembl Cavefish
Match: ENSAMXT00000010285.2 (pep primary_assembly:Astyanax_mexicanus-2.0:20:23449006:23497796:1 gene:ENSAMXG00000010014.2 transcript:ENSAMXT00000010285.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.567e-14
Identity = 51/183 (27.87%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  169 DSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGK-RKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSD--ELYDPVIRPKHCVPIGALIF 708
            ++W  K+  ++QN+ F +E++EKR E+R +  +    + R+ +L  ++     ++   GL  + +    LG  + GV++  + DV L  A +   + +  LIVFK + GK +K+ P  D      P   FD H+ +E     E  + Q + S V+L++++D  EL     RP+ C+P   + F
Sbjct:    7 NAWLWKDVKLVQNEEFLKEYSEKRSEMRTKGRHGREMEERYCYLVASHE-TTTQIYRHGLRTETQQQYSLGKPSHGVYLFRHVDVALKHAASSSLTAK-NLIVFKVLFGKVKKVTPTSDWNRTPDPMVTFDCHMSKEAVSHRESLSQQVLGSSVFLFDYNDNQELNS---RPRQCLPYAVVSF 184          
BLAST of protein TASOR isoform X3 vs. Ensembl Cavefish
Match: tasorb (protein TASOR-like [Source:NCBI gene;Acc:103032451])

HSP 1 Score: 61.2326 bits (147), Expect = 1.644e-9
Identity = 57/207 (27.54%), Postives = 96/207 (46.38%), Query Frame = 1
Query:   97 ESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIK-SLVYLYEFS-DELYDPVIRPKHCVPIGALIFE 711
            +S E  EL++ +SS  L+       ++    A +I N+  E+EF EK+ E+++           + FL  + N     + E+GL +     + LG+   GV++S  +D+      +   S +I  I+FK M G+ K +    PK  L P P FD HV +         + +  + +  Y YEF+ DEL     RP+H  P   + F+
Sbjct:  116 DSREFEELVKVLSSFYLDAPS--RGAFTYTKACLIHNELLEKEFVEKKRELKQAGRTEAELTESYAFLLPDTNK-THWICEKGLSVGHARLSNLGNPAKGVYLSKYSDLLQINPFDAGASGDI--IIFKVMKGRLKSIFENMPKSNLEPAPKFDCHVHKNASKVTSLLSYRAFELTQQYFYEFAFDELKS---RPRHVCPYAVVSFQ 314          
BLAST of protein TASOR isoform X3 vs. Ensembl Cavefish
Match: tasor2 (transcription activation suppressor family member 2 [Source:ZFIN;Acc:ZDB-GENE-041111-225])

HSP 1 Score: 61.2326 bits (147), Expect = 1.724e-9
Identity = 47/193 (24.35%), Postives = 82/193 (42.49%), Query Frame = 1
Query:  175 WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEE--RPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTE 747
            +   +A++I +   +  ++  R E ++  Y     +  FGFL  +     + LA+ GL +       LG  + GV+IS  +D CL+  R  ++ +   +++ K   G+ K V     +    PT  FD HV ++           + + ++  YLYE  D    P   P+H  P   + F     S  L L E
Sbjct:   36 FTYSSAYLINSAKLQERYSAFRAEKQKNGYSKGELEESFGFLLFDEKSRANTLADNGLMVGQGTCTILGDSSKGVYISKYSD-CLDLKR-WYDGKTGYIVLLKLTKGRVKEVTENYTQNFTPPTAGFDCHVSDQLGAVCATTSSFLAFERTQYYLYELLDGGNKPEPCPRHVCPFAVVAFSYGKTSTSLQLKE 226          
BLAST of protein TASOR isoform X3 vs. Ensembl Nematostella
Match: EDO37875 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ9])

HSP 1 Score: 61.2326 bits (147), Expect = 7.341e-10
Identity = 55/199 (27.64%), Postives = 87/199 (43.72%), Query Frame = 1
Query:  142 NLNHSVHIEDSWN---LKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDP----KVLLAPTPNFDSHVCE--ERPIPNEKHAIQYIKSLVYLYEFSDELYD-PVIRPKHCVPIGALIF 708
            N+  +V    SW+   ++N   + N     EF+ K+  +R     +   D +  FL  ++   +  + E GL         LG  + GV+    ADV   + R     +E  L+VFK   GK K  P+++     + LL PTPN+D HV +      P    +  Y  +  Y +EF +E  D  V RP+H +P   L  
Sbjct:  101 NVEVAVRDPGSWSSIKIENLEFVHNDKLSSEFSAKKKSMR--LAETKGNDDKLAFLFKSSRTEVKDICENGLATGSSKTVTLGDPSMGVYACRYADVV--QKRPFQAGDEGYLLVFKVCKGKVK--PVFETPCGSETLLEPTPNYDCHVSKTMHNLPPQPPFSSLYYSTQYYFFEFDEEGADFHVKRPRHVLPYAVLTL 293          
BLAST of protein TASOR isoform X3 vs. Ensembl Medaka
Match: tasorb (protein TASOR [Source:NCBI gene;Acc:101164979])

HSP 1 Score: 65.0846 bits (157), Expect = 1.201e-10
Identity = 59/214 (27.57%), Postives = 105/214 (49.07%), Query Frame = 1
Query:   97 ESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEIT----LIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSL----VYLYEFS-DELYDPVIRPKHCVPIGALIFE 711
            +S E  +LI+ ISS NL+ S     S++   A +I N+  E+EF EKR E+++      +    + FL  + + L   + E+GL +       LG+ + GV++S  +D+       + N  E+     +I+FK M G+ K +    PK  + P+P FD H+ +   I N   ++   ++      + +EF+ DE+     RP+H  P   + F+
Sbjct:  110 DSREFEDLIKLISSFNLDPSSRTAFSYS--KARLIHNELLEKEFIEKRREMKQEGRTEQDLAESYCFLFPDKSKL-QWVCEKGLSVGHCRITTLGNPSMGVYLSKYSDLL------QINPFEVGSFGDMIIFKIMRGRIKHIHENMPKNAIEPSPKFDCHLSK---IANRVTSLLSYRAFELTQQFFFEFAFDEIK---ARPRHVCPYAVVSFQ 308          
BLAST of protein TASOR isoform X3 vs. Ensembl Medaka
Match: ENSORLT00000032425.1 (protein TASOR [Source:NCBI gene;Acc:101174829])

HSP 1 Score: 59.3066 bits (142), Expect = 6.759e-9
Identity = 49/213 (23.00%), Postives = 98/213 (46.01%), Query Frame = 1
Query:   88 IQIESNETYELIENISSTNLNHSVHIEDS---WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHA--IQYIKSLVYLYEFSDELYDPV-IRPKHCVPIGALIF 708
            + I  +E+ ++  N   T L  +   E+S   +  K+A +++N + E ++N  R   +   Y  D     +GFL  ++    + L E G+       + LG  + G++ISM +D CL++ R  ++ +   + + +   GK+K V     +    PT  FD HV ++    + K +  + + ++  Y+YE  D+  +   + P    P   + F
Sbjct:   13 VLIPVSESADIFRNTILTALQSAHLYEESKQFFRYKSAVLVKNPALEEKYNAFRTNRKNAGYTEDELKESYGFLLFDDASKANALGETGVLTGNSSCSILGDPSKGIYISMYSD-CLDQNR-WYHGKSGYIAIIRLTKGKQKKVLENYTERFTEPTVGFDCHVSDQLASVSAKTSSFLAFERTQYYMYELLDDTSNRTGVSPAASCPFAIVSF 223          
BLAST of protein TASOR isoform X3 vs. Ensembl Medaka
Match: ENSORLT00000035887.1 (protein TASOR [Source:NCBI gene;Acc:101174829])

HSP 1 Score: 59.3066 bits (142), Expect = 7.374e-9
Identity = 49/213 (23.00%), Postives = 98/213 (46.01%), Query Frame = 1
Query:   88 IQIESNETYELIENISSTNLNHSVHIEDS---WNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHA--IQYIKSLVYLYEFSDELYDPV-IRPKHCVPIGALIF 708
            + I  +E+ ++  N   T L  +   E+S   +  K+A +++N + E ++N  R   +   Y  D     +GFL  ++    + L E G+       + LG  + G++ISM +D CL++ R  ++ +   + + +   GK+K V     +    PT  FD HV ++    + K +  + + ++  Y+YE  D+  +   + P    P   + F
Sbjct:   13 VLIPVSESADIFRNTILTALQSAHLYEESKQFFRYKSAVLVKNPALEEKYNAFRTNRKNAGYTEDELKESYGFLLFDDASKANALGETGVLTGNSSCSILGDPSKGIYISMYSD-CLDQNR-WYHGKSGYIAIIRLTKGKQKKVLENYTERFTEPTVGFDCHVSDQLASVSAKTSSFLAFERTQYYMYELLDDTSNRTGVSPAASCPFAIVSF 223          
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Match: SMESG000032082.1 (SMESG000032082.1)

HSP 1 Score: 748.043 bits (1930), Expect = 0.000e+0
Identity = 360/362 (99.45%), Postives = 362/362 (100.00%), Query Frame = 1
Query:   76 HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNEGNFKRAAIYNQNKSIKQSKNSTNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL 1161
            HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDE+YDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNEGNFKRAAIY+QNKSIKQSKNSTNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL
Sbjct:   20 HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDEIYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNEGNFKRAAIYSQNKSIKQSKNSTNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL 381          
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Match: SMESG000032082.1 (SMESG000032082.1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 341/362 (94.20%), Postives = 343/362 (94.75%), Query Frame = 1
Query:   76 HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNEGNFKRAAIYNQNKSIKQSKNSTNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL 1161
            HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDE+YDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNE                   +STNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL
Sbjct:   20 HVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDEIYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNPRLPKPPWSEAYSKFNNE-------------------DSTNFLQKISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTGISLYGGQKYNQLMSNKPL 362          
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Match: SMESG000032087.1 (SMESG000032087.1)

HSP 1 Score: 280.796 bits (717), Expect = 2.961e-90
Identity = 161/380 (42.37%), Postives = 228/380 (60.00%), Query Frame = 1
Query:   52 NLQDVKPYHVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNS-EEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSFMSNSKNP-RLPKPPWSEAYSKF--NNEGNFKRAAIYNQNKSIKQSKNSTNFLQKISDSEQ-------WRPINYGDVF-----------------NQSVGESLILKPQGRERLVDRVGMWKDNKAERTNKWKTG 1107
            ++ D   Y++ E+   S ETY++ + +S T +++S     SW+L+ A +I N  FEREF EK  E+ E++ YS++WDVR+GFLAT    +IDK+A +GLE+KM PYNYLG+  +GVHIS NADVCL EAR K  S +E+ LI+FKYMLGKRK+VPM+DPKVLLAPTP FDSH+CEERP P E  +IQYIKSLV+LYEF++   DPVIRP+HC P  A+IF+     + LD+   E         N F     +P  L KP    A   F      ++K+++  N +    +   +T   +++ D E+       W+ INYG  +                 +++ GES++LKP  RER  +R   W ++ +   +K   G
Sbjct:    6 SVLDSNAYYISEVPGNSRETYDMFQKLSKTFVDNSFDFSQSWDLQKALVITNPLFEREFKEKSKELEEKSSYSEHWDVRYGFLATIKEKMIDKVAHDGLEVKMCPYNYLGYNVAGVHISQNADVCLTEARGKIVSGDELVLILFKYMLGKRKIVPMHDPKVLLAPTPKFDSHICEERPDPKENDSIQYIKSLVFLYEFANGNLDPVIRPRHCCPSAAMIFKYKPMYDKLDVIGVEE--------NKFSVTYPSPLALLKPVSQHAPVSFWDRQYSDYKKSSTQNLDAEDSRKVIATEINKELYDIEKPTTVDDTWKTINYGPAYPNDGGYRDMYSSNPKGISRNGGESMLLKPMERERSTERNKKWSESSSRGVSKSNRG 377          
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Match: SMESG000028557.1 (SMESG000028557.1)

HSP 1 Score: 56.6102 bits (135), Expect = 3.027e-8
Identity = 63/232 (27.16%), Postives = 110/232 (47.41%), Query Frame = 1
Query:  172 SWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEG-LEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEE------RPIPNEK-HAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAP------SEILDLTESESLDTPFHAINSFMSNSKNPRLPKP 825
            S     A+ I N      +++KR E++   + S  +   +GF+   +   + K+ +EG +++   P +YLG C  GV +S +AD+    +  +F+   I L+V  YM G+   V +YD    + P P +D H+  +         P++  H+ Q     V+LYE+S++  + V  P     IGA+ F    P      S+I   T+S +   P   I  F ++SK+P   +P
Sbjct:   51 SMKFHQAWSITNIDSRSSYSKKRAELKT-IFKSTEY---YGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI----SNPEFHKSGIILVV-NYMRGQVNYV-LYDSSP-MDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQ-----VFLYEYSEDC-EIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRI--FEASSKSPPAKRP 263          
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Match: SMESG000028557.1 (SMESG000028557.1)

HSP 1 Score: 56.225 bits (134), Expect = 3.435e-8
Identity = 63/232 (27.16%), Postives = 110/232 (47.41%), Query Frame = 1
Query:  172 SWNLKNAFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAEEG-LEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYMLGKRKMVPMYDPKVLLAPTPNFDSHVCEE------RPIPNEK-HAIQYIKSLVYLYEFSDELYDPVIRPKHCVPIGALIFESLAP------SEILDLTESESLDTPFHAINSFMSNSKNPRLPKP 825
            S     A+ I N      +++KR E++   + S  +   +GF+   +   + K+ +EG +++   P +YLG C  GV +S +AD+    +  +F+   I L+V  YM G+   V +YD    + P P +D H+  +         P++  H+ Q     V+LYE+S++  + V  P     IGA+ F    P      S+I   T+S +   P   I  F ++SK+P   +P
Sbjct:   51 SMKFHQAWSITNIDSRSSYSKKRAELKT-IFKSTEY---YGFVYVKSEYELKKIVKEGNIKVHNVPVSYLGKCEMGVSLSQHADI----SNPEFHKSGIILVV-NYMRGQVNYV-LYDSSP-MDPQPKYDCHMLRQSLTVDSSTTPHKAFHSTQ-----VFLYEYSEDC-EIVPFPSQITIIGAVKFSWHGPSICKEISKIRTPTKSVTEKNPVKRI--FEASSKSPPAKRP 263          
The following BLAST results are available for this feature:
BLAST of protein TASOR isoform X3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TEX152.806e-1826.37testis expressed 15, meiosis and synapsis associat... [more]
TEX152.807e-1826.37testis expressed 15, meiosis and synapsis associat... [more]
TASOR2.010e-926.92transcription activation suppressor [Source:HGNC S... [more]
TASOR2.196e-926.92transcription activation suppressor [Source:HGNC S... [more]
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BX649301.29.578e-1128.50transcription activation suppressor b [Source:NCBI... [more]
tasor21.263e-1025.76transcription activation suppressor family member ... [more]
tasor21.273e-1025.76transcription activation suppressor family member ... [more]
tasorb1.343e-1028.02transcription activation suppressor b [Source:ZFIN... [more]
tasorb1.343e-1028.02transcription activation suppressor b [Source:ZFIN... [more]
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Tex153.040e-2228.00testis expressed gene 15 [Source:MGI Symbol;Acc:MG... [more]
Tex156.812e-2128.87testis expressed gene 15 [Source:MGI Symbol;Acc:MG... [more]
Tasor2.635e-926.57transcription activation suppressor [Source:MGI Sy... [more]
back to top
BLAST of protein TASOR isoform X3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9UK61|TASOR_HUMAN9.817e-926.92Protein TASOR OS=Homo sapiens OX=9606 GN=TASOR PE=... [more]
sp|Q69ZR9|TASOR_MOUSE1.949e-826.57Protein TASOR OS=Mus musculus OX=10090 GN=Tasor PE... [more]
back to top
BLAST of protein TASOR isoform X3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HB877.926e-4035.07DUF3715 domain-containing protein OS=Macrostomum l... [more]
A0A1I8H7Z48.377e-4035.07DUF3715 domain-containing protein OS=Macrostomum l... [more]
A0A267GDX09.740e-3935.07DUF3715 domain-containing protein OS=Macrostomum l... [more]
A0A267ESJ11.380e-3835.07DUF3715 domain-containing protein (Fragment) OS=Ma... [more]
A0A1I8FKM21.721e-2736.84DUF3715 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000010285.21.567e-1427.87pep primary_assembly:Astyanax_mexicanus-2.0:20:234... [more]
tasorb1.644e-927.54protein TASOR-like [Source:NCBI gene;Acc:103032451... [more]
tasor21.724e-924.35transcription activation suppressor family member ... [more]
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO378757.341e-1027.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of protein TASOR isoform X3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tasorb1.201e-1027.57protein TASOR [Source:NCBI gene;Acc:101164979][more]
ENSORLT00000032425.16.759e-923.00protein TASOR [Source:NCBI gene;Acc:101174829][more]
ENSORLT00000035887.17.374e-923.00protein TASOR [Source:NCBI gene;Acc:101174829][more]
back to top
BLAST of protein TASOR isoform X3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032082.10.000e+099.45SMESG000032082.1[more]
SMESG000032082.10.000e+094.20SMESG000032082.1[more]
SMESG000032087.12.961e-9042.37SMESG000032087.1[more]
SMESG000028557.13.027e-827.16SMESG000028557.1[more]
SMESG000028557.13.435e-827.16SMESG000028557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033365 ID=SMED30033365|Name=protein TASOR isoform X3|organism=Schmidtea mediterranea sexual|type=transcript|length=1425bp
ATTTTCTACCTATATTGTATTTAAAATTTTTAGTATTTAATGTTATCTTT
AAATCTTCAAGATGTTAAACCTTATCATGTTGATGAAATTCAAATAGAAA
GTAATGAAACTTATGAACTAATTGAAAATATAAGTTCTACAAATCTAAAT
CATTCTGTACATATAGAGGACTCGTGGAATTTAAAAAATGCTTTTATCAT
CCAAAATAAAAGTTTTGAGCGAGAATTCAATGAAAAGCGGGATGAAATAA
GAGAACGAGCTTATTATTCTGATAATTGGGATGTTCGATTTGGATTTCTC
GCAACAAATAATAATGGATTAATAGACAAATTAGCAGAAGAAGGATTGGA
AATTAAAATGCGTCCTTATAACTATCTAGGTCATTGTACATCTGGTGTAC
ACATAAGTATGAATGCCGATGTCTGTTTGAATGAAGCTCGCAATAAATTC
AATTCAGAGGAAATTACTTTAATAGTCTTCAAATACATGCTCGGTAAAAG
AAAAATGGTTCCCATGTATGATCCAAAAGTTCTTCTAGCGCCTACTCCGA
ATTTCGATTCCCATGTCTGTGAAGAACGTCCTATTCCCAATGAAAAACAT
GCTATACAGTACATTAAATCGCTAGTCTATCTCTATGAATTTTCCGATGA
GCTTTATGATCCTGTTATTCGACCTAAACACTGTGTTCCGATAGGAGCCT
TGATTTTTGAAAGTTTGGCACCGTCGGAAATATTAGATTTGACTGAATCT
GAATCGTTGGATACACCTTTCCATGCTATAAACTCGTTTATGTCAAATTC
AAAAAATCCTCGCCTCCCGAAACCTCCCTGGAGTGAAGCATATTCAAAAT
TTAATAATGAAGGAAACTTTAAACGAGCAGCAATATACAATCAAAACAAA
TCAATCAAGCAATCAAAAAATTCAACGAATTTCCTCCAGAAAATATCCGA
TTCTGAGCAGTGGAGGCCAATAAATTATGGTGACGTTTTTAATCAATCAG
TTGGTGAATCACTCATTCTAAAACCACAGGGTCGCGAAAGACTTGTCGAT
AGGGTTGGAATGTGGAAGGACAATAAAGCCGAGAGAACTAACAAATGGAA
AACTGGCATTTCACTGTATGGTGGACAAAAGTATAATCAATTGATGAGCA
ACAAACCTCTTTAAAATCCTTAATTGTTTTATGCTGTTCTTGTTCAGGAT
TTGAATCGCGTTGTGTTACACAAGCTGCATTCATAACAAGATTGTTTGGC
GTCAAATTTGTATTTATTGTTATATTGTATTGTGTTATTTAAATGTAATT
TAAATTATCATTATGTGAAATATAATAATCTTAGCCCTAATAATATCGAC
CGGGGGATTTGTTGTCTCCATTTGCTCAATTTAGGATCATCGTCTATCGC
AATTGGTCGATGGAAATTGTGTGAC
back to top

protein sequence of SMED30033365-orf-1

>SMED30033365-orf-1 ID=SMED30033365-orf-1|Name=SMED30033365-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=375bp
MLSLNLQDVKPYHVDEIQIESNETYELIENISSTNLNHSVHIEDSWNLKN
AFIIQNKSFEREFNEKRDEIRERAYYSDNWDVRFGFLATNNNGLIDKLAE
EGLEIKMRPYNYLGHCTSGVHISMNADVCLNEARNKFNSEEITLIVFKYM
LGKRKMVPMYDPKVLLAPTPNFDSHVCEERPIPNEKHAIQYIKSLVYLYE
FSDELYDPVIRPKHCVPIGALIFESLAPSEILDLTESESLDTPFHAINSF
MSNSKNPRLPKPPWSEAYSKFNNEGNFKRAAIYNQNKSIKQSKNSTNFLQ
KISDSEQWRPINYGDVFNQSVGESLILKPQGRERLVDRVGMWKDNKAERT
NKWKTGISLYGGQKYNQLMSNKPL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR026616TEX15
IPR022188DUF3715
IPR012317Poly(ADP-ribose)pol_cat_dom
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0007129synapsis
GO:0007140male meiotic nuclear division
GO:0010569regulation of double-strand break repair via homologous recombination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.90.228.10coord: 16..201
e-value: 8.9E-6
score: 27.5
IPR022188Protein of unknown function DUF3715PFAMPF12509DUF3715coord: 84..217
e-value: 1.3E-18
score: 67.4
IPR026616Testis-expressed sequence 15 proteinPANTHERPTHR22380FAMILY NOT NAMEDcoord: 15..218