26S proteasome non-ATPase regulatory subunit 11

Overview
Name26S proteasome non-ATPase regulatory subunit 11
Smed IDSMED30033354
Length (bp)1345
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 26S proteasome non-ATPase regulatory subunit 11 (SMED30033354) t-SNE clustered cells

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 11 (SMED30033354) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 26S proteasome non-ATPase regulatory subunit 11 (SMED30033354) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 26S proteasome non-ATPase regulatory subunit 11 (SMED30033354) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033354

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30033354SMESG000048466.1 dd_Smed_v4_2135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30033354SMESG000048466.1 dd_Smed_v4_2135_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Match: PSMD11 (proteasome 26S subunit, non-ATPase 11 [Source:HGNC Symbol;Acc:HGNC:9556])

HSP 1 Score: 434.876 bits (1117), Expect = 3.947e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Match: PSMD11 (proteasome 26S subunit, non-ATPase 11 [Source:HGNC Symbol;Acc:HGNC:9556])

HSP 1 Score: 434.876 bits (1117), Expect = 3.947e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Match: PSMD11 (proteasome 26S subunit, non-ATPase 11 [Source:HGNC Symbol;Acc:HGNC:9556])

HSP 1 Score: 434.876 bits (1117), Expect = 3.947e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Match: PSMD11 (proteasome 26S subunit, non-ATPase 11 [Source:HGNC Symbol;Acc:HGNC:9556])

HSP 1 Score: 146.362 bits (368), Expect = 1.785e-42
Identity = 63/88 (71.59%), Postives = 82/88 (93.18%), Query Frame = 3
Query:  558 KIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLN 821
            K Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN
Sbjct:    2 KTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLN 89          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Match: PSMD11 (proteasome 26S subunit, non-ATPase 11 [Source:HGNC Symbol;Acc:HGNC:9556])

HSP 1 Score: 95.5153 bits (236), Expect = 2.389e-22
Identity = 52/153 (33.99%), Postives = 78/153 (50.98%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGD------------------------------------------EIALCKECIEWTINERRNYLRQNLEAKLMGIYY 449
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG                                           E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEFLFVTGHLILWVCSMLCFVSGDCQWSLESSLHQGHKLILVFEVELCLECIEWAKSEKRTFLRQALEARLVSLYF 180          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Match: rpn-6.1 (Probable 26S proteasome regulatory subunit rpn-6.1 [Source:UniProtKB/Swiss-Prot;Acc:Q20938])

HSP 1 Score: 340.887 bits (873), Expect = 1.496e-113
Identity = 198/395 (50.13%), Postives = 280/395 (70.89%), Query Frame = 3
Query:  120 NLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGD-EIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKS-LIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            NLV    S DD   +K+KE++I+ LG   ++N  + +L N+I  +RPFL  + KAK+ KLVR LVD  L+++   GD ++ L KECI+W   + R +LRQ L A+L+ +Y    ++  AL + + L++ELKK+DDK +LVEV+L ESK YY+LSN+ R++A+LT ARTTAN IY  P++QA+LDLQSGILHAADE+DFKTA+SYFYEAFEG+D+VD K S L ALKYML+ K+ML+  +EV  +L+ KL LK+ G D+DAM+ IA+AA KRSL  +      +   L  DPV+ KH +SL + +L ++L ++IEPYS VQI+++A  I +    VE+KLSQMILD+KL+G L+Q  G+LI+F+    D+ Y+ AL+ IH +  VVD LY  A ++
Sbjct:   45 NLVKSPASGDDD--IKKKEDSIMELGNILAQNKQTEELRNMIEQTRPFLVSLGKAKAAKLVRDLVDLCLKIDDQDGDIKVGLVKECIQWATEQNRTFLRQTLTARLVRLYNDLQRYTQALPLAADLIRELKKVDDKDVLVEVELEESKAYYNLSNIGRARASLTGARTTANAIYVNPRMQAALDLQSGILHAADEKDFKTAFSYFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKLALKYNGSDLDAMKAIAAAAQKRSLKDFQVAFGSFPQELQMDPVVRKHFHSLSERMLEKDLCRIIEPYSFVQIEHVAQQIGIDRSKVEKKLSQMILDQKLSGSLDQGEGMLIVFEIAVPDEAYQTALDTIHAMGEVVDALYSNASKI 437          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Match: rpn-6.1 (Probable 26S proteasome regulatory subunit rpn-6.1 [Source:UniProtKB/Swiss-Prot;Acc:Q20938])

HSP 1 Score: 340.117 bits (871), Expect = 1.622e-113
Identity = 198/395 (50.13%), Postives = 280/395 (70.89%), Query Frame = 3
Query:  120 NLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGD-EIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKS-LIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            NLV    S DD   +K+KE++I+ LG   ++N  + +L N+I  +RPFL  + KAK+ KLVR LVD  L+++   GD ++ L KECI+W   + R +LRQ L A+L+ +Y    ++  AL + + L++ELKK+DDK +LVEV+L ESK YY+LSN+ R++A+LT ARTTAN IY  P++QA+LDLQSGILHAADE+DFKTA+SYFYEAFEG+D+VD K S L ALKYML+ K+ML+  +EV  +L+ KL LK+ G D+DAM+ IA+AA KRSL  +      +   L  DPV+ KH +SL + +L ++L ++IEPYS VQI+++A  I +    VE+KLSQMILD+KL+G L+Q  G+LI+F+    D+ Y+ AL+ IH +  VVD LY  A ++
Sbjct:   27 NLVKSPASGDDD--IKKKEDSIMELGNILAQNKQTEELRNMIEQTRPFLVSLGKAKAAKLVRDLVDLCLKIDDQDGDIKVGLVKECIQWATEQNRTFLRQTLTARLVRLYNDLQRYTQALPLAADLIRELKKVDDKDVLVEVELEESKAYYNLSNIGRARASLTGARTTANAIYVNPRMQAALDLQSGILHAADEKDFKTAFSYFYEAFEGYDSVDEKVSALTALKYMLLCKVMLDLPDEVNSLLSAKLALKYNGSDLDAMKAIAAAAQKRSLKDFQVAFGSFPQELQMDPVVRKHFHSLSERMLEKDLCRIIEPYSFVQIEHVAQQIGIDRSKVEKKLSQMILDQKLSGSLDQGEGMLIVFEIAVPDEAYQTALDTIHAMGEVVDALYSNASKI 419          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Match: rpn-6.2 (Probable 26S proteasome regulatory subunit rpn-6.2 [Source:UniProtKB/Swiss-Prot;Acc:P34481])

HSP 1 Score: 226.483 bits (576), Expect = 2.066e-69
Identity = 141/387 (36.43%), Postives = 235/387 (60.72%), Query Frame = 3
Query:  162 LKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTG--------DEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTK-KSLIALKYMLMSKIMLNCSEEVPQILTGK-LTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAK 1292
            +K  E+ ILS     +K      +  L+ + R F + V KA++ KL+R +V+  L ++   G        ++I L   CI W  + +R +LR++L+A+L+ +Y     F  A  +   L KELKKL+D+ LL+EV + ESK  ++L+NL ++K AL +A+T  N  +  P+LQAS+D+QSG+L++A+ERD+KT++SYFYEAFEGF ++  K  +  ALKYM++ KIMLN +E++  +L  K +        I A+R +A A  KRSL  +++ L ++K  L  D V++ H  +L  N+L + + ++IEPYS +++ Y+A +I + +  VER +++MILDKKL G ++Q    ++++        +  +L+ I  L+  VD  Y + K
Sbjct:   27 VKRCEDLILSYSRQLAKEKDITGIRTLVESIRSFYDLVGKARASKLIRDIVEHALTIDQGVGPALDHGKKEKIDLLTNCIGWATSNKREFLRRSLQARLIRLYNDIRDFTNAQKLAQDLSKELKKLEDRELLIEVSVEESKSSFNLNNLAKAKTALLTAKTNTNSAFASPQLQASVDMQSGVLYSAEERDYKTSFSYFYEAFEGFASIGDKINATSALKYMILCKIMLNETEQLAGLLAAKEIVAYQKSPRIIAIRSMADAFRKRSLKDFVKALAEHKIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMILDKKLMGSIDQHGDTVVVYPKADAANQFTRSLKTIRELTKTVDVSYSRTK 413          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Match: rpn-6.2 (Probable 26S proteasome regulatory subunit rpn-6.2 [Source:UniProtKB/Swiss-Prot;Acc:P34481])

HSP 1 Score: 151.369 bits (381), Expect = 3.749e-43
Identity = 79/212 (37.26%), Postives = 133/212 (62.74%), Query Frame = 3
Query:  669 LQSGILHAADERDFKTAYSYFYEAFEGFDAVDTK-KSLIALKYMLMSKIMLNCSEEVPQILTGK-LTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            +QSG+L++A+ERD+KT++SYFYEAFEGF ++  K  +  ALKYM++ KIMLN +E++  +L  K +        I A+R +A A  KRSL  +++ L ++K  L  D V++ H  +L  N+L + + ++IEPYS +++ Y+A +I + +  VER +++MILDKKL G ++Q    ++++        +  +L+ I  L+  VD  Y + K  
Sbjct:    1 MQSGVLYSAEERDYKTSFSYFYEAFEGFASIGDKINATSALKYMILCKIMLNETEQLAGLLAAKEIVAYQKSPRIIAIRSMADAFRKRSLKDFVKALAEHKIELVEDKVVAVHSQNLERNMLEKEISRVIEPYSEIELSYIARVIGMTVPPVERAIARMILDKKLMGSIDQHGDTVVVYPKADAANQFTRSLKTIRELTKTVDVSYSRTKHF 212          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Match: csn-2 (COP9 signalosome complex subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:O01422])

HSP 1 Score: 79.7221 bits (195), Expect = 8.890e-16
Identity = 54/195 (27.69%), Postives = 97/195 (49.74%), Query Frame = 3
Query:  675 SGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESG------------VLILFDDNADDQG 1223
             G +H  D R F  A++ F+EAF+ +D   + +    LKY++++ +++    ++    + +        +I AM ++  A     + ++ +I+  ++D++ ADP I +H   L +N+  Q L++LI PY+ V+I YL+  + +    V   L   ILD  L   +N+ESG            V  L   NA DQG
Sbjct:  241 GGKMHLRDGR-FLDAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLIKS--DINPFDSQEAKPFKNEPEIVAMTQMVQAYQDNDIQAFEQIMAAHQDSIMADPFIREHTEELMNNIRTQVLLRLIRPYTNVRISYLSQKLKVSQKEVIHLLVDAILDDGLEAKINEESGMIEMPKNKKKMMVTSLVVPNAGDQG 432          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Match: Rpn6 (gene:FBgn0028689 transcript:FBtr0087474)

HSP 1 Score: 429.869 bits (1104), Expect = 2.598e-148
Identity = 220/390 (56.41%), Postives = 302/390 (77.44%), Query Frame = 3
Query:  132 QDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q+ + +D E ++ KE  IL  GE Y +   + +L++LI  +RPFL+ +SKAK+ KLVRSLVD +L+M+  TG E+ LCK+CIEW   E+R +LRQ+LEA+L+ +Y+  + +  AL +G+ LL+ELKKLDDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPK+Q +LDLQSGILHAADERDFKTA+SYFYEAFEGFD+VD+ K+L +LKYML+ KIML  S++V Q+++GKL + ++GRDIDAM+ +A A++KRSL+ +   L++YK  L  D ++  HL +LYD +L QNL ++IEPYSRVQ+ ++A  I LP+  VE+KLSQMILDKK +G L+Q  GVLI+F++   D+ Y+  LE I ++  VVD LY KAK+L+
Sbjct:   50 QEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQKAKKLS 439          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Match: Rpn6 (gene:FBgn0028689 transcript:FBtr0087475)

HSP 1 Score: 429.098 bits (1102), Expect = 3.854e-148
Identity = 220/390 (56.41%), Postives = 302/390 (77.44%), Query Frame = 3
Query:  132 QDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q+ + +D E ++ KE  IL  GE Y +   + +L++LI  +RPFL+ +SKAK+ KLVRSLVD +L+M+  TG E+ LCK+CIEW   E+R +LRQ+LEA+L+ +Y+  + +  AL +G+ LL+ELKKLDDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPK+Q +LDLQSGILHAADERDFKTA+SYFYEAFEGFD+VD+ K+L +LKYML+ KIML  S++V Q+++GKL + ++GRDIDAM+ +A A++KRSL+ +   L++YK  L  D ++  HL +LYD +L QNL ++IEPYSRVQ+ ++A  I LP+  VE+KLSQMILDKK +G L+Q  GVLI+F++   D+ Y+  LE I ++  VVD LY KAK+L+
Sbjct:   33 QEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQKAKKLS 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Match: Rpn6 (gene:FBgn0028689 transcript:FBtr0306558)

HSP 1 Score: 429.098 bits (1102), Expect = 3.854e-148
Identity = 220/390 (56.41%), Postives = 302/390 (77.44%), Query Frame = 3
Query:  132 QDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q+ + +D E ++ KE  IL  GE Y +   + +L++LI  +RPFL+ +SKAK+ KLVRSLVD +L+M+  TG E+ LCK+CIEW   E+R +LRQ+LEA+L+ +Y+  + +  AL +G+ LL+ELKKLDDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPK+Q +LDLQSGILHAADERDFKTA+SYFYEAFEGFD+VD+ K+L +LKYML+ KIML  S++V Q+++GKL + ++GRDIDAM+ +A A++KRSL+ +   L++YK  L  D ++  HL +LYD +L QNL ++IEPYSRVQ+ ++A  I LP+  VE+KLSQMILDKK +G L+Q  GVLI+F++   D+ Y+  LE I ++  VVD LY KAK+L+
Sbjct:   33 QEGAENDEERIRIKEQGILQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMDAGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALGAQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTSLKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLADFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHVAESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERVLETIQSMGKVVDTLYQKAKKLS 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0339550)

HSP 1 Score: 74.7146 bits (182), Expect = 3.410e-14
Identity = 76/320 (23.75%), Postives = 146/320 (45.62%), Query Frame = 3
Query:  273 VSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRN------YLRQNLEAKLMGIYYLKSQFEAALNI-GSAXXXXXXXXXXXXXXXXXQLLES-----KIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            V++  S K + S++D+     +ST   +AL +   E T++  R+      + + N   KL  +Y+ +S F     I             +  L    QLLE      ++Y    N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + ++     ++ +  IL +++ N+ AD  I +H+  L  N+  Q LIKLI PY  + I ++A  +++    VE  L   ILD  + G ++Q + VL L
Sbjct:  104 VTRNHSEKSINSILDY-----ISTSKNMALLQNFYETTLDALRDAKNDRLWFKTN--TKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQL 412          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Match: alien (gene:FBgn0013746 transcript:FBtr0343095)

HSP 1 Score: 74.7146 bits (182), Expect = 3.410e-14
Identity = 76/320 (23.75%), Postives = 146/320 (45.62%), Query Frame = 3
Query:  273 VSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRN------YLRQNLEAKLMGIYYLKSQFEAALNI-GSAXXXXXXXXXXXXXXXXXQLLES-----KIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            V++  S K + S++D+     +ST   +AL +   E T++  R+      + + N   KL  +Y+ +S F     I             +  L    QLLE      ++Y    N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + ++     ++ +  IL +++ N+ AD  I +H+  L  N+  Q LIKLI PY  + I ++A  +++    VE  L   ILD  + G ++Q + VL L
Sbjct:  104 VTRNHSEKSINSILDY-----ISTSKNMALLQNFYETTLDALRDAKNDRLWFKTN--TKLGKLYFDRSDFTKLQKILKQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTVQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVNSYQNNDINEFETILRQHRSNIMADQFIREHIEDLLRNIRTQVLIKLIRPYKNIAIPFIANALNIEPAEVESLLVSCILDDTIKGRIDQVNQVLQL 412          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Match: psmd11a (proteasome 26S subunit, non-ATPase 11a [Source:NCBI gene;Acc:503934])

HSP 1 Score: 433.335 bits (1113), Expect = 9.272e-150
Identity = 220/393 (55.98%), Postives = 304/393 (77.35%), Query Frame = 3
Query:  123 LVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +V +D+  DD E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVE+QLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ +++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L +YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILD+K +G L+Q  GVLI+FD+   D+ Y+ +LE I N+S VVD LY KAK+LT
Sbjct:   29 IVKRDVQDDDEEAVRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDMFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLQELKKMDDKALLVELQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNSPEDVQSLISGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTEYKAELRDDPIISTHLTKLYDNLLEQNLIRVIEPFSRVQIEHISELIKLSKGDVERKLSQMILDQKFHGILDQGEGVLIVFDEPPVDKTYEASLETIQNMSKVVDSLYNKAKKLT 421          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Match: psmd11a (proteasome 26S subunit, non-ATPase 11a [Source:NCBI gene;Acc:503934])

HSP 1 Score: 433.335 bits (1113), Expect = 9.272e-150
Identity = 220/393 (55.98%), Postives = 304/393 (77.35%), Query Frame = 3
Query:  123 LVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +V +D+  DD E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVE+QLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ +++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L +YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILD+K +G L+Q  GVLI+FD+   D+ Y+ +LE I N+S VVD LY KAK+LT
Sbjct:   29 IVKRDVQDDDEEAVRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDMFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLQELKKMDDKALLVELQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNSPEDVQSLISGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTEYKAELRDDPIISTHLTKLYDNLLEQNLIRVIEPFSRVQIEHISELIKLSKGDVERKLSQMILDQKFHGILDQGEGVLIVFDEPPVDKTYEASLETIQNMSKVVDSLYNKAKKLT 421          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Match: psmd11b (proteasome 26S subunit, non-ATPase 11b [Source:NCBI gene;Acc:322265])

HSP 1 Score: 427.557 bits (1098), Expect = 1.831e-147
Identity = 220/396 (55.56%), Postives = 302/396 (76.26%), Query Frame = 3
Query:  114 YQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            + ++V +D+  DD E ++ KE +IL LG   +K   + +L  L+   RPFL  +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL + S LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ +++ ALKYML+ KIML+  EEV  +++GKL L++ GR  DA++ IA A+  RSL+ + + L +Y   L  DP+I+ HL  LYDNLL QNLI++IEP+SRVQI ++AGLI L  + VERKLSQMILDKK +G L+Q   VLI+F++   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   27 FHSIVRRDVQEDDEEAVRVKEQSILELGSLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALQLESQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAVTALKYMLLCKIMLSLPEEVQALISGKLGLRYAGRQTDALKCIAQASKNRSLADFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHIAGLIKLSKNDVERKLSQMILDKKFHGILDQGEDVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Match: psmd11b (proteasome 26S subunit, non-ATPase 11b [Source:NCBI gene;Acc:322265])

HSP 1 Score: 427.557 bits (1098), Expect = 1.831e-147
Identity = 220/396 (55.56%), Postives = 302/396 (76.26%), Query Frame = 3
Query:  114 YQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            + ++V +D+  DD E ++ KE +IL LG   +K   + +L  L+   RPFL  +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL + S LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ +++ ALKYML+ KIML+  EEV  +++GKL L++ GR  DA++ IA A+  RSL+ + + L +Y   L  DP+I+ HL  LYDNLL QNLI++IEP+SRVQI ++AGLI L  + VERKLSQMILDKK +G L+Q   VLI+F++   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   27 FHSIVRRDVQEDDEEAVRVKEQSILELGSLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALQLESQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAVTALKYMLLCKIMLSLPEEVQALISGKLGLRYAGRQTDALKCIAQASKNRSLADFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHIAGLIKLSKNDVERKLSQMILDKKFHGILDQGEDVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:415145])

HSP 1 Score: 83.1889 bits (204), Expect = 8.358e-17
Identity = 57/216 (26.39%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+    N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++ +  VE  L Q ILD  +NG ++Q + +L L
Sbjct:  200 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTINGRIDQVNQLLEL 411          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 441.81 bits (1135), Expect = 6.226e-153
Identity = 228/395 (57.72%), Postives = 304/395 (76.96%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q++V +DI   D E L+ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ K++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+++ + L  YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQID+++ LI LP   VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 QSIVKRDIQESDEEALRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIDHISSLIKLPKPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 424.476 bits (1090), Expect = 3.516e-146
Identity = 225/395 (56.96%), Postives = 301/395 (76.20%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q++V +DI   D E L+ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ K++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+++ + L  YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQ+ +L  L D   + VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 QSIVKRDIQESDEEALRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQVIFLL-LYDFQPE-VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 420          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Match: psmd11 (proteasome 26S subunit, non-ATPase 11 [Source:NCBI gene;Acc:100492225])

HSP 1 Score: 416.387 bits (1069), Expect = 2.387e-143
Identity = 220/390 (56.41%), Postives = 292/390 (74.87%), Query Frame = 3
Query:  132 QDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +DI   D E L+ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ K++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+++ + L  YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQ+             VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:    8 RDIQESDEEALRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQVS-----TKYHQPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 392          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:548537])

HSP 1 Score: 80.8777 bits (198), Expect = 5.023e-16
Identity = 56/216 (25.93%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+    N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++ +  VE  L Q ILD  ++G ++Q + +L L
Sbjct:  145 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLEL 356          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:548537])

HSP 1 Score: 81.2629 bits (199), Expect = 5.269e-16
Identity = 56/216 (25.93%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+    N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++ +  VE  L Q ILD  ++G ++Q + +L L
Sbjct:  200 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLEL 411          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 435.647 bits (1119), Expect = 1.133e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 435.647 bits (1119), Expect = 1.133e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 266.159 bits (679), Expect = 3.279e-87
Identity = 130/230 (56.52%), Postives = 168/230 (73.04%), Query Frame = 3
Query:  612 ARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            ARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR                     + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:    1 ARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGR---------------------QALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 209          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 173.326 bits (438), Expect = 6.327e-52
Identity = 89/170 (52.35%), Postives = 117/170 (68.82%), Query Frame = 3
Query:  792 YMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            YML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQ D            VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:    1 YMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQAD------------VERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 158          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Match: Psmd11 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 11 [Source:MGI Symbol;Acc:MGI:1916327])

HSP 1 Score: 169.088 bits (427), Expect = 2.298e-50
Identity = 84/158 (53.16%), Postives = 115/158 (72.78%), Query Frame = 3
Query:  828 EEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:    3 EDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 160          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Match: sp|F6XBL2|PSD11_XENTR (26S proteasome non-ATPase regulatory subunit 11 OS=Xenopus tropicalis OX=8364 GN=psmd11 PE=3 SV=2)

HSP 1 Score: 441.81 bits (1135), Expect = 3.298e-152
Identity = 228/395 (57.72%), Postives = 304/395 (76.96%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            Q++V +DI   D E L+ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ K++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+++ + L  YK  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQID+++ LI LP   VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 QSIVKRDIQESDEEALRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLVSLYFDTKRYQEALQLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPKAITALKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLANFEKALTDYKAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIDHISSLIKLPKPEVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Match: sp|Q8BG32|PSD11_MOUSE (26S proteasome non-ATPase regulatory subunit 11 OS=Mus musculus OX=10090 GN=Psmd11 PE=1 SV=3)

HSP 1 Score: 435.647 bits (1119), Expect = 7.928e-150
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYSKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Match: sp|F1LMZ8|PSD11_RAT (26S proteasome non-ATPase regulatory subunit 11 OS=Rattus norvegicus OX=10116 GN=Psmd11 PE=1 SV=2)

HSP 1 Score: 434.876 bits (1117), Expect = 1.896e-149
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Match: sp|O00231|PSD11_HUMAN (26S proteasome non-ATPase regulatory subunit 11 OS=Homo sapiens OX=9606 GN=PSMD11 PE=1 SV=3)

HSP 1 Score: 434.876 bits (1117), Expect = 1.896e-149
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Match: sp|Q2KI42|PSD11_BOVIN (26S proteasome non-ATPase regulatory subunit 11 OS=Bos taurus OX=9913 GN=PSMD11 PE=2 SV=3)

HSP 1 Score: 434.876 bits (1117), Expect = 1.896e-149
Identity = 222/395 (56.20%), Postives = 305/395 (77.22%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL++GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN  E+V  +++GKL L++ GR  +A++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVKRDIQENDEEAVQVKEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Match: A0A0X3P4M1 (26S proteasome non-ATPase regulatory subunit 11A OS=Schistocephalus solidus OX=70667 GN=PS11A PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.241e-165
Identity = 247/397 (62.22%), Postives = 317/397 (79.85%), Query Frame = 3
Query:  111 NYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            NY  LV  D+  DD  L+K+KENAIL LG +Y+K   + +L++LI   RPFL ++SKAK+G++VR+LVD +L++EV TG EI LC+ECIEW  NERR +L+Q LEA+LMG+YY   ++E AL +GS LL+ELKKLDDK LLVEVQL+ES++YY + NLQ+S+AALTS+RTTAN IYCPP+LQASLDL SGILHAADERDFKTAYSYFYEAFEGFD++++ +++ AL YML+SKIM  C EEVP IL+ KL   +  R ++AMRE+A  A  RSL+ ++ + E YK  L  DPVIS+HL S YD LLGQNLIKLIEPYSRVQI+++A LI+LPL  VE+KLSQMILDK+LNG L+Q SG+L+L D+  D + YKVALE +H+LS+V+D L+ KAK+L 
Sbjct:   23 NYVRLVSTDVPDDDEALIKDKENAILELGAYYAKEKKAKELADLIQLIRPFLKKISKAKAGRIVRTLVDLFLDLEVGTGREIELCQECIEWAANERRTFLKQALEARLMGLYYENGRYEEALQLGSTLLRELKKLDDKILLVEVQLMESQVYYRVGNLQKSRAALTSSRTTANSIYCPPRLQASLDLLSGILHAADERDFKTAYSYFYEAFEGFDSINSPRAVDALTYMLLSKIMTKCPEEVPVILSSKLASPYNQRPVEAMREVALTAKNRSLAEFLRLRETYKAELLGDPVISQHLNSFYDTLLGQNLIKLIEPYSRVQINHIAELINLPLGNVEKKLSQMILDKQLNGILDQGSGMLVLRDEPYDSRDYKVALETVHSLSSVLDLLFQKAKKLA 419          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Match: A0A094ZNR5 (26S proteasome non-ATPase regulatory subunit 11 OS=Schistosoma haematobium OX=6185 GN=MS3_04609 PE=4 SV=1)

HSP 1 Score: 470.315 bits (1209), Expect = 4.229e-161
Identity = 243/396 (61.36%), Postives = 312/396 (78.79%), Query Frame = 3
Query:  111 NYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            NYQN+V  DI  D+  + K KE AIL LG   ++   +  L +LI+ +RPFL  +SKAK+G+LVR+LVD +L++E  TG E+ LC+EC+EW   E+R +LRQ LEA+LMG+YY    +E AL +GS LL+ELKKLDDK LLVEVQL+ES++YY L NLQR++AALTSARTTANGIYCPP+LQA+LDL SGILHAADERDFKTAYSYFYEAFEGFD++ +K+++ ALKYML+SKIMLN ++E+P ILT KL LK+T RDIDAMRE+  AA +RSL  ++ + EKYK  L+ DPVIS+HL+S YD L GQNL+KLIEPYSRVQID++A LI++PL+TVE+KLSQMILD + NG L+Q SGVL+L +   D + Y +AL  I +L  +VD L+ K  +L
Sbjct:   20 NYQNIVRNDIEPDEASI-KAKEQAILELGNLLAEKKDAKGLGDLILVTRPFLKLMSKAKAGRLVRTLVDLFLDLEGGTGREVDLCRECVEWANQEKRIFLRQALEARLMGLYYDNGSYEEALKLGSNLLRELKKLDDKALLVEVQLMESRVYYRLGNLQRARAALTSARTTANGIYCPPRLQANLDLLSGILHAADERDFKTAYSYFYEAFEGFDSISSKRAIDALKYMLLSKIMLNSADEIPGILTSKLALKYTSRDIDAMREVGIAAKERSLGDFLLLQEKYKTELSGDPVISRHLHSFYDTLFGQNLLKLIEPYSRVQIDHIAKLINIPLETVEKKLSQMILDNQHNGILDQGSGVLVLREPECDGKDYPLALSAIQSLGGIVDMLFQKTTKL 414          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Match: A0A183K5J1 (PCI domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10265 PE=4 SV=1)

HSP 1 Score: 469.929 bits (1208), Expect = 7.459e-161
Identity = 242/396 (61.11%), Postives = 312/396 (78.79%), Query Frame = 3
Query:  111 NYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            NYQN+V  D+  D+  + K KE AIL LG   ++   +  L +LI+ +RPFL  +SKAK+G+LVR+LVD +L++E  TG E+ LC+EC+EW   E+R +LRQ LEA+LMG+YY    +E AL +GS LL+ELKKLDDK LLVEVQL+ES++YY L NLQR++AALTSARTTANGIYCPP+LQA+LDL SGILHAADERDFKTAYSYFYEAFEGFD++ +K+++ ALKYML+SKIMLN ++E+P ILT KL LK+T RDIDAMRE+  AA +RSL  ++ + EKYK  L+ DPVIS+HL+S YD L GQNL+KLIEPYSRVQID++A LI++PL+TVE+KLSQMILD + NG L+Q SGVL+L +   D + Y +AL  I +L  +VD L+ K  +L
Sbjct:   20 NYQNIVRNDVEPDEASI-KAKEQAILELGNLLAEKKDAKGLGDLILVTRPFLKLMSKAKAGRLVRTLVDLFLDLEGGTGREVDLCRECVEWANQEKRIFLRQALEARLMGLYYDNGSYEEALKLGSNLLRELKKLDDKALLVEVQLMESRVYYRLGNLQRARAALTSARTTANGIYCPPRLQANLDLLSGILHAADERDFKTAYSYFYEAFEGFDSISSKRAIDALKYMLLSKIMLNSADEIPGILTSKLALKYTSRDIDAMREVGIAAKERSLGDFLLLQEKYKTELSGDPVISRHLHSFYDTLFGQNLLKLIEPYSRVQIDHIAKLINIPLETVEKKLSQMILDNQHNGILDQGSGVLVLREPECDGKDYPLALSAIQSLGGIVDMLFQKTTKL 414          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Match: A0A3S1CB99 (PCI domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_004214 PE=4 SV=1)

HSP 1 Score: 468.003 bits (1203), Expect = 8.328e-160
Identity = 240/401 (59.85%), Postives = 317/401 (79.05%), Query Frame = 3
Query:   99 TEVLNYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            TE+L+   +V QD+   D E +K KE AIL +G+ Y+  N + +L+NLI   RPFLN VSKAK+ KLVR+LVD +L+ME  TG E+ LCKECI+W  +E+R +LRQ LEA+L+ +Y+   +++ AL  GS LL+ELKKLDDK LLVEVQLLESK+Y++LSNL +++AALTS RTTANGIYCPPKLQA+LD QSGILHAADE+DFKTAYSYFYEAFEG+D++D+ K++ +LKYML+ KIMLN ++EV  I++GKL LK+TG DIDAM+ IA A++KRSL+ + + L  YK  L  DP++  HL +LYDNLL QNL ++IEP+S+VQ+ ++A LI LP+ TVE+KLSQMILDKK +G L+Q +GVLI+F+++  D+ Y  ALE IHN+  VVD LY KAK+LT
Sbjct:   35 TEILS--TIVKQDVPQADDEAIKVKEQAILEMGKLYADQNKAGELANLIKCVRPFLNMVSKAKAAKLVRALVDLFLDMEAGTGSEVELCKECIQWAKDEKRTFLRQALEARLISLYFDTERYQEALQQGSVLLRELKKLDDKALLVEVQLLESKVYHALSNLPKARAALTSGRTTANGIYCPPKLQAALDQQSGILHAADEKDFKTAYSYFYEAFEGYDSIDSPKAVTSLKYMLLCKIMLNIADEVQAIVSGKLALKYTGPDIDAMKSIAQASHKRSLADFQKTLVTYKIQLEDDPIVKAHLMTLYDNLLEQNLCRIIEPFSKVQVQHVANLIKLPVTTVEKKLSQMILDKKFHGILDQGAGVLIVFEESTTDKTYGNALETIHNMGKVVDALYQKAKKLT 433          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Match: C1LJ59 (Putative 26S proteasome non-ATPase regulatory subunit 11 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 466.848 bits (1200), Expect = 1.403e-159
Identity = 243/407 (59.71%), Postives = 318/407 (78.13%), Query Frame = 3
Query:   84 RFKVMTEVL--NYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            RFK + + L  NYQN+V  D+ SD+   +K KE AIL LG+  +    +  L++LI+ +RPFL  +SKAK+G+LVR+LVD +L++E  TG EI LC++C+EW   E R +LRQ LE +LMG+YY    +E AL +GS LL+ELKKLDDK LLVEVQL+ES++YY L NLQR++A+LTSARTTANGIYCPP+LQA+LDL SGILHAADERDFKTA+SYFYEAFEGFD++ +K+++ ALKYML+SKIMLN ++E+P ILT KL LK+T RDIDAMRE+  AA +RSL  ++ + EKYK  L+ DPVIS+HL+S YD L GQNL+KLIEPYSRVQID++A LI++PL+TVE+KLSQMILD + NG L+Q SGVL+L +   + + Y +AL  I +L  +VD L+ K  +L
Sbjct:   14 RFKDVDDKLIQNYQNIVRSDVGSDE-AAIKSKEQAILELGDLLAAKKDAKGLADLILITRPFLKLISKAKAGRLVRTLVDLFLDLEGRTGQEIDLCRDCVEWANKENRIFLRQALETRLMGLYYENENYEEALKLGSKLLRELKKLDDKALLVEVQLMESRVYYRLGNLQRARASLTSARTTANGIYCPPRLQANLDLLSGILHAADERDFKTAFSYFYEAFEGFDSISSKRAIDALKYMLLSKIMLNSADEIPGILTSKLALKYTSRDIDAMREVGIAAKERSLGDFLLLQEKYKAELSGDPVISRHLHSFYDTLFGQNLLKLIEPYSRVQIDHIAKLINIPLETVEKKLSQMILDNEHNGILDQGSGVLVLREPECEGKDYPLALSAIQSLGGIVDMLFQKTTKL 419          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:103047433])

HSP 1 Score: 434.106 bits (1115), Expect = 3.437e-150
Identity = 222/395 (56.20%), Postives = 302/395 (76.46%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +D+  DD E ++ KE +IL LG   +K   + +L  L+   RPFL  +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +F+ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ +++ ALKYML+ KIMLN  EEV  +++GKL L++ GR  DA++ +A A+  RSL+ + + L +Y   L  DP+I+ HL  LYDNLL QNLI++IEP+SRVQI +++GLI L    VERKLSQMILDKK +G L+Q  GVLI+F++   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVRRDVQQDDEEAVRVKEQSILELGTLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLISLYFDTKRFQEALQLGSQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIMLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKALTEYTKELRDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQITHISGLIKLSKGDVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Match: psmd11a (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:103047553])

HSP 1 Score: 426.787 bits (1096), Expect = 2.503e-147
Identity = 220/393 (55.98%), Postives = 299/393 (76.08%), Query Frame = 3
Query:  123 LVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +V +D+   D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL +GSALL+ELKK+DDK LLVEVQLLESK Y++LSN  +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ +++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  D+++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SR QI++++ LI L    VERKLSQMILDKK  G L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   29 IVKRDVQDSDEEAVRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSALLQELKKMDDKALLVEVQLLESKTYHALSNPPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPRAITALKYMLLCKIMLNAPEDVQALISGKLALRYAGRQTDSLKCVAQASKNRSLAEFEKALTDYRAELRDDPIISMHLAKLYDNLLEQNLIRVIEPFSRAQIEHISSLIRLSKGDVERKLSQMILDKKFYGILDQGEGVLIVFDEPPVDKTYEAALETIQNMSRVVDSLYNKAKKLT 421          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Match: psmd11a (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:103047553])

HSP 1 Score: 380.948 bits (977), Expect = 1.167e-129
Identity = 202/393 (51.40%), Postives = 278/393 (70.74%), Query Frame = 3
Query:  123 LVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +V +D+   D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW  +E+R +LRQ LEA+L+ +Y+   +++ AL +GSALL+ELKK+DDK LLVEVQLLESK Y++LSN  +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG D++D+ +++ ALKYML+ KIMLN  E+V  +++GKL L++ GR  D+++ +A A+  RSL+ + + L  Y+  L  DP+IS HL  LYDNLL QNLI++IEP+SR Q+                              L+Q  GVLI+FD+   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   29 IVKRDVQDSDEEAVRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALQLGSALLQELKKMDDKALLVEVQLLESKTYHALSNPPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGNDSIDSPRAITALKYMLLCKIMLNAPEDVQALISGKLALRYAGRQTDSLKCVAQASKNRSLAEFEKALTDYRAELRDDPIISMHLAKLYDNLLEQNLIRVIEPFSRAQVR----------------------------ILDQGEGVLIVFDEPPVDKTYEAALETIQNMSRVVDSLYNKAKKLT 393          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Match: ENSAMXT00000041821.1 (pep primary_assembly:Astyanax_mexicanus-2.0:2:25664637:25672110:1 gene:ENSAMXG00000029910.1 transcript:ENSAMXT00000041821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 170.629 bits (431), Expect = 2.378e-49
Identity = 122/391 (31.20%), Postives = 179/391 (45.78%), Query Frame = 3
Query:  129 LQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            L ++  DD  ++  KE  IL +    +    +  L  L+   RPFL  +SKAK+                    EI LC ECIEW    RR+++++        +Y  +                               L+ K    + +L +++AALTSART AN IYCPPKLQ +LD+QS I+HAA+ +D+KT Y  F+EAFE +D +D+              IMLN  EEV   ++GKL L + G   DA++ +A A   RSL+                            N   QNLI++IEP+SRVQI + +GLI L    VER                    +LI+F++   D+ Y+ A++ I N+S VV  +  K K++T
Sbjct:    2 LANVQQDDKGVVCVKEQTILEVDTLLANTEQAAGLRGLLKFVRPFLISISKAKA--------------------EIKLCLECIEWA-KSRRSWIKK--------LYLWR----------------------------FNCLKVK---PIMHLGKARAALTSARTIANAIYCPPKLQTALDMQSDIIHAAERKDWKTVYFCFFEAFEVYDFIDSP-----------GPIMLNLPEEVQAWISGKLALLYAGGQTDALKCVAQANKNRSLA----------------------------NFQKQNLIRVIEPFSRVQITHTSGLIKLSKGDVERTF------------------ILIIFEEPLVDKTYEAAIKTIQNMSKVVYSVEKKIKKIT 275          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:103027287])

HSP 1 Score: 83.1889 bits (204), Expect = 7.279e-17
Identity = 57/216 (26.39%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+    N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++ +  VE  L Q ILD  +NG ++Q + +L L
Sbjct:  200 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTINGRIDQVNQLLEL 411          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Sea Lamprey
Match: psmd11b (proteasome 26S subunit, non-ATPase 11b [Source:NCBI gene;Acc:322265])

HSP 1 Score: 432.18 bits (1110), Expect = 4.923e-150
Identity = 225/395 (56.96%), Postives = 303/395 (76.71%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
              LV +D+  +D E ++ KE +IL LG   +K   + +L  L+   RPFLN VSKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   ++  AL +GS LL+ELKKLDDK LLVEVQL+ESK Y++LSNL R++AALTSARTTANGIYCPPK+QA+LD+QSGI+HAA+E+D+KTAYSYFYEAFEG+D++D+ +++ ALKYML+ KIMLN  E+V  I++GKL L++ GR  DAM+ IA A+  RSLS + + L +YK+ L  DP+I+ HL  LY NLL +NLI++IEP+SRVQID++A LI L  + VE+KLSQMILDKK  G L+Q  GVLI++++   D+ Y+ ALE I ++S VVD LY KAK+LT
Sbjct:   31 HQLVKRDVEDEDEEAIRVKEQSILELGGLLAKTGQAAELGGLLKFVRPFLNSVSKAKAARLVRSLLDMFLDMEAATGQEVDLCLECIEWAKAEKRTFLRQALEARLVALYFDTKRYPEALQLGSQLLRELKKLDDKALLVEVQLMESKTYHALSNLPRARAALTSARTTANGIYCPPKMQAALDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSIDSPRAITALKYMLLCKIMLNTPEDVQNIVSGKLALRYAGRKTDAMKSIAQASKDRSLSDFNKALCEYKEELQNDPIIATHLEKLYQNLLEKNLIRVIEPFSRVQIDHVATLIKLKKNLVEKKLSQMILDKKFYGILDQGEGVLIVWEEPPVDKTYESALETIQSMSKVVDALYNKAKKLT 425          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001532.1 (pep scaffold:Pmarinus_7.0:GL477608:3889:17671:-1 gene:ENSPMAG00000001377.1 transcript:ENSPMAT00000001532.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.424e-17
Identity = 57/216 (26.39%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+  + N+  DP I +H+  L  N+  Q LIKLI PY+R+ I +++  +++ +  VE  L Q ILD  +NG ++Q + +L L
Sbjct:  206 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDINEFEKILKTNRSNIMDDPFIREHIEELLRNIRTQVLIKLIMPYTRIHIPFISKELNIDVSDVESLLVQCILDNTINGRIDQVNQLLEL 417          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Yeast
Match: RPN6 (Essential, non-ATPase regulatory subunit of the 26S proteasome lid; required for the assembly and activity of the 26S proteasome; the human homolog (S9 protein) partially rescues Rpn6p depletion; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000002255])

HSP 1 Score: 265.003 bits (676), Expect = 1.014e-84
Identity = 165/382 (43.19%), Postives = 244/382 (63.87%), Query Frame = 3
Query:  168 EKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDT----KKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLK-HTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRL 1298
            E+E +IL LG+ Y        L   I  S  ++ Q +K+K+ K++++L++ + ++  S  D+I +C++ IE+   E+R +L+ +L  KL  ++Y K Q++ +L + + LL+E KKLDDK  LV+V LLESK+Y+ L NL +SKA+LT+ART AN IYCP +  A LDL SGILH  D +D+KTA+SYF+E+FE +  + T    +K+   LKYML+SKIMLN  ++V  IL  K T + +  R IDAM+ +A A N RSL  +   L++Y+  L  D +   H  +LYD LL  NL K+IEP+  V+I +++ +I L    VE KLSQMILDK   G L+Q +G L +++    D  Y  ALE++  L+ VVDQL+ KA  L
Sbjct:   53 EQETSILELGQLYVTMGAKDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIKLATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYCPTQTVAELDLMSGILHCED-KDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKNILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKIIEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLNKVVDQLFEKASVL 433          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Nematostella
Match: EDO31601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXG5])

HSP 1 Score: 414.461 bits (1064), Expect = 3.791e-143
Identity = 225/393 (57.25%), Postives = 294/393 (74.81%), Query Frame = 3
Query:  123 LVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            +V +D+  +D E +K KE +IL+L    S+   + +L  LI   RPFL  VSKAK+ KLVR+LVD +L+ME +TG E+ LCKECI W+  E+R +LRQ LEA+L+G+Y    Q+  AL+ GS LLKELKKLDDK LLVEVQLLESK+Y+ LSN+ +S+AALTSARTTANGIYCPPKLQA+LDLQSGILHA +E+DFKTAYSYFYEAFEG D++D+ K++ ALKYML+ KIMLN  ++V  I++ KL L+++G  + AMR IA+A++ RSLS + + L  YK  LT DP+I  HL +LYDNLL QNL+++IEPYSRV+            D VE+KLSQMILDKKL+G L+Q SGVLI+FDD   D+ Y+  LE++  +   VD LY KA++L+
Sbjct:   26 IVKRDVGPEDEEGIKSKEQSILALASLLSRKGEAEELGGLIKFIRPFLQMVSKAKAAKLVRTLVDLFLDMESTTGMEVDLCKECINWSKQEKRTFLRQALEARLVGLYLDTKQYTEALHTGSKLLKELKKLDDKVLLVEVQLLESKVYHELSNIPKSRAALTSARTTANGIYCPPKLQAALDLQSGILHA-EEKDFKTAYSYFYEAFEGMDSIDSPKAMAALKYMLLCKIMLNSPDDVQSIISRKLALRYSGPQLVAMRTIANASHNRSLSEFQQALATYKKELTEDPIIRTHLDALYDNLLSQNLLRIIEPYSRVE------------DLVEKKLSQMILDKKLHGILDQGSGVLIVFDDAFPDKTYENTLELVQEMGMAVDALYTKAQKLS 405          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Nematostella
Match: EDO47654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLS7])

HSP 1 Score: 81.2629 bits (199), Expect = 9.887e-17
Identity = 74/312 (23.72%), Postives = 151/312 (48.40%), Query Frame = 3
Query:  273 VSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNL----EAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            V++  S K + S++D+     +ST  ++ L +   E T++  R+     L      KL  +YY +++F     I   L +  + +           LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E D++ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+  + N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++  + VE  L   ILD  ++G ++Q + +L L
Sbjct:  103 VTRNHSEKSINSILDY-----ISTSKQMELLQNFYETTLDALRDAKNDRLWFKTNTKLGKLYYDRNEFNRLSKILKQLHQSCQVIAGDYA------LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGDYERAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNDDINEFEKILKTNRKNIMDDPFIREHIEDLLRNIRTQVLIKLIKPYTRIHIPFISKELNIDSEEVESLLVSCILDSTIHGRIDQVNQLLEL 399          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Nematostella
Match: EDO36846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI2])

HSP 1 Score: 52.373 bits (124), Expect = 2.346e-7
Identity = 45/188 (23.94%), Postives = 92/188 (48.94%), Query Frame = 3
Query:  702 RDFKTAYSYFYEAFEGFDAVDTKKSL----IALKYMLMSKIMLNCSEEVPQILTG---KLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEI 1244
            R +K+A  YF +A   FD  D  + L    +A+   L +    +  E   ++L+    KL L+   +    +R++    ++   ++ +++L+  KDN   D  +++H+  LY  +  + LI+   PY    +  +A   +  +  +E +LSQ+ILD ++N  ++  + VL   D +     ++ ALE+
Sbjct:  244 RKYKSAARYFLQA--SFDHCDCPELLSSNNVAIYGGLCALASFDRQELQKKVLSSSSFKLFLELEPQ----LRDVLYKFHESQYATCLKLLDDLKDNFMLDMYLAQHITKLYSQIRKRALIQYFSPYVSADMSKMAHAFNTTVHQLEDELSQLILDGQINARIDSHNKVLYARDVDQRSTTFEKALEM 425          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Medaka
Match: ENSORLT00000023519.2 (26S proteasome non-ATPase regulatory subunit 11A [Source:NCBI gene;Acc:101174330])

HSP 1 Score: 433.335 bits (1113), Expect = 3.601e-149
Identity = 223/395 (56.46%), Postives = 302/395 (76.46%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +DI   D E ++ KE +IL LG   +K   + +L  L+   RPFLN +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECI+W   E+R +LRQ LEA+L+ +Y+    ++ AL +GS LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ K++ ALKYML+ KIMLN  +EV  +++GKL L++ GR  ++++ +A A+ KRSL+ + E L +YK  L  D +IS HL  LYD LL QNLI++IEP+SRVQI +++ LI LP   VERKLSQMILDKK +G L+Q  GVLI+FD+ A D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   74 HSIVKRDIQDTDEEAVRVKEQSILELGGLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIDWAKAEKRTFLRQALEARLVSLYFDTKSYQEALQLGSQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPKAITALKYMLLCKIMLNLPDEVQSLISGKLALRYAGRQTESLKCVAQASKKRSLADFEETLTEYKTELRDDTIISTHLTKLYDKLLEQNLIRVIEPFSRVQIAHISSLIHLPKGDVERKLSQMILDKKFHGILDQGEGVLIVFDEPAVDKTYETALETIQNMSKVVDSLYNKAKKLT 468          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Medaka
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:101174707])

HSP 1 Score: 429.098 bits (1102), Expect = 3.782e-148
Identity = 218/395 (55.19%), Postives = 304/395 (76.96%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +D+  +D E ++ KE +IL LG   +K   + +L  L+   RPFL  +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +G+ LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ +++ ALKYML+ KI+LN  EEV  +++GKL L++ GR  DA++ +A A+  RSL+ + ++L +YK  L  DP+I+ HL  LYDNLL QNLI++IEP+SRVQI++++ LI L    VERKLSQMILDKK +G L+Q  GVLI+F++   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVRRDVQENDEEAVRVKEQSILELGTLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALALGTQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIVLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKVLTEYKAELKDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQIEHISSLIKLSKGDVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 422          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Medaka
Match: psmd11b (26S proteasome non-ATPase regulatory subunit 11B [Source:NCBI gene;Acc:101174707])

HSP 1 Score: 416.772 bits (1070), Expect = 2.224e-143
Identity = 215/395 (54.43%), Postives = 298/395 (75.44%), Query Frame = 3
Query:  117 QNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
             ++V +D+  +D E ++ KE +IL LG   +K   + +L  L+   RPFL  +SKAK+ +LVRSL+D +L+ME +TG E+ LC ECIEW   E+R +LRQ LEA+L+ +Y+   +++ AL +G+ LL+ELKK+DDK LLVEVQLLESK Y++LSNL +++AALTSARTTAN IYCPPKLQA+LD+QSGI+HAA+E+D+KTAYSYF+EAFEG+D++D+ +++ ALKYML+ KI+LN  EEV  +++GKL L++ GR  DA++ +A A+  RSL+ + ++L +YK  L  DP+I+ HL  LYDNLL QNLI++IEP+SRVQ+    G        VERKLSQMILDKK +G L+Q  GVLI+F++   D+ Y+ ALE I N+S VVD LY KAK+LT
Sbjct:   28 HSIVRRDVQENDEEAVRVKEQSILELGTLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATGQEVELCLECIEWAKAEKRTFLRQALEARLISLYFDTKRYQEALALGTQLLQELKKMDDKALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQAALDMQSGIIHAAEEKDWKTAYSYFFEAFEGYDSIDSPRAITALKYMLLCKIVLNLPEEVQALISGKLALRYAGRQTDALKCVAQASKNRSLADFEKVLTEYKAELKDDPIINTHLAKLYDNLLEQNLIRVIEPFSRVQVRTYFG-------DVERKLSQMILDKKFHGILDQGEGVLIIFEEPPVDKTYEAALETIQNMSKVVDSLYNKAKKLT 415          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Medaka
Match: cops2 (COP9 signalosome subunit 2 [Source:NCBI gene;Acc:101171063])

HSP 1 Score: 80.8777 bits (198), Expect = 5.138e-16
Identity = 56/216 (25.93%), Postives = 112/216 (51.85%), Query Frame = 3
Query:  549 LESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLIL 1196
            LE ++Y +  N ++ KA    +    + I   P +   +    G +H   E +F+ A++ F+EAF+ +D   + +    LKY++++ +++     +    + +        +I AM  + SA     ++ + +IL+    N+  DP I +H+  L  N+  Q LIKLI+PY+R+ I +++  +++ +  VE  L Q ILD  ++G ++Q + +L L
Sbjct:  237 LEIQMYTAQKNNKKLKALYEQSLHIKSAI-PHPLIMGVIRECGGKMHLR-EGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSG--INPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVCDVESLLVQCILDNTIHGRIDQVNQLLEL 448          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Planmine SMEST
Match: SMESG000048466.1 (SMESG000048466.1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 401/402 (99.75%), Postives = 402/402 (100.00%), Query Frame = 3
Query:   96 MTEVLNYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSAXXXXXXXXXXXXXXXXXQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 1301
            MTEVLNYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSALLKELKKLDDKGLLVEVQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLK+TGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT
Sbjct:    1 MTEVLNYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLIIASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINERRNYLRQNLEAKLMGIYYLKSQFEAALNIGSALLKELKKLDDKGLLVEVQLLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAADERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKYTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKRLT 402          
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Planmine SMEST
Match: SMESG000023422.1 (SMESG000023422.1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.827e-14
Identity = 53/198 (26.77%), Postives = 103/198 (52.02%), Query Frame = 3
Query:  705 DFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQILTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVISKHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMILDKKLNGFLNQESGVLILFDDNADDQGYKVALEII-------HNL-STVVDQ 1274
            +F  A++ F+EAF+ +D   +++    LKY+++S ++   +  +    + ++       +I AM  + SA     + ++   L + +D +  DP I +H+  L  N+    LI L++PY  V+I++LA  +++  + VE  L   I D  + G ++Q+S +L++ D+   +  YK   ++I       HNL S VVD 
Sbjct:  249 EFDKAHTDFFEAFKNYDESGSQRRTQCLKYLVLSNMLTKSA--INPFDSQEIKPYRDNPEIVAMTNLVSAYQINDIKTFESTLTENEDTIMQDPFIREHIEELLRNIRIDVLIGLVKPYKTVRIEFLAQRLNISTNEVESLLVSCIADNVIKGKIDQKSDILVI-DEPRKEAKYKSLDKLISEIDKLHHNLVSRVVDH 443          
The following BLAST results are available for this feature:
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMD113.947e-15056.20proteasome 26S subunit, non-ATPase 11 [Source:HGNC... [more]
PSMD113.947e-15056.20proteasome 26S subunit, non-ATPase 11 [Source:HGNC... [more]
PSMD113.947e-15056.20proteasome 26S subunit, non-ATPase 11 [Source:HGNC... [more]
PSMD111.785e-4271.59proteasome 26S subunit, non-ATPase 11 [Source:HGNC... [more]
PSMD112.389e-2233.99proteasome 26S subunit, non-ATPase 11 [Source:HGNC... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpn-6.11.496e-11350.13Probable 26S proteasome regulatory subunit rpn-6.1... [more]
rpn-6.11.622e-11350.13Probable 26S proteasome regulatory subunit rpn-6.1... [more]
rpn-6.22.066e-6936.43Probable 26S proteasome regulatory subunit rpn-6.2... [more]
rpn-6.23.749e-4337.26Probable 26S proteasome regulatory subunit rpn-6.2... [more]
csn-28.890e-1627.69COP9 signalosome complex subunit 2 [Source:UniPro... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rpn62.598e-14856.41gene:FBgn0028689 transcript:FBtr0087474[more]
Rpn63.854e-14856.41gene:FBgn0028689 transcript:FBtr0087475[more]
Rpn63.854e-14856.41gene:FBgn0028689 transcript:FBtr0306558[more]
alien3.410e-1423.75gene:FBgn0013746 transcript:FBtr0339550[more]
alien3.410e-1423.75gene:FBgn0013746 transcript:FBtr0343095[more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd11a9.272e-15055.98proteasome 26S subunit, non-ATPase 11a [Source:NCB... [more]
psmd11a9.272e-15055.98proteasome 26S subunit, non-ATPase 11a [Source:NCB... [more]
psmd11b1.831e-14755.56proteasome 26S subunit, non-ATPase 11b [Source:NCB... [more]
psmd11b1.831e-14755.56proteasome 26S subunit, non-ATPase 11b [Source:NCB... [more]
cops28.358e-1726.39COP9 signalosome subunit 2 [Source:NCBI gene;Acc:4... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd116.226e-15357.72proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
psmd113.516e-14656.96proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
psmd112.387e-14356.41proteasome 26S subunit, non-ATPase 11 [Source:NCBI... [more]
cops25.023e-1625.93COP9 signalosome subunit 2 [Source:NCBI gene;Acc:5... [more]
cops25.269e-1625.93COP9 signalosome subunit 2 [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmd111.133e-15056.20proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd111.133e-15056.20proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd113.279e-8756.52proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd116.327e-5252.35proteasome (prosome, macropain) 26S subunit, non-A... [more]
Psmd112.298e-5053.16proteasome (prosome, macropain) 26S subunit, non-A... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F6XBL2|PSD11_XENTR3.298e-15257.7226S proteasome non-ATPase regulatory subunit 11 OS... [more]
sp|Q8BG32|PSD11_MOUSE7.928e-15056.2026S proteasome non-ATPase regulatory subunit 11 OS... [more]
sp|F1LMZ8|PSD11_RAT1.896e-14956.2026S proteasome non-ATPase regulatory subunit 11 OS... [more]
sp|O00231|PSD11_HUMAN1.896e-14956.2026S proteasome non-ATPase regulatory subunit 11 OS... [more]
sp|Q2KI42|PSD11_BOVIN1.896e-14956.2026S proteasome non-ATPase regulatory subunit 11 OS... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P4M11.241e-16562.2226S proteasome non-ATPase regulatory subunit 11A O... [more]
A0A094ZNR54.229e-16161.3626S proteasome non-ATPase regulatory subunit 11 OS... [more]
A0A183K5J17.459e-16161.11PCI domain-containing protein OS=Schistosoma curas... [more]
A0A3S1CB998.328e-16059.85PCI domain-containing protein OS=Elysia chlorotica... [more]
C1LJ591.403e-15959.71Putative 26S proteasome non-ATPase regulatory subu... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmd11b3.437e-15056.2026S proteasome non-ATPase regulatory subunit 11B [... [more]
psmd11a2.503e-14755.9826S proteasome non-ATPase regulatory subunit 11A [... [more]
psmd11a1.167e-12951.4026S proteasome non-ATPase regulatory subunit 11A [... [more]
ENSAMXT00000041821.12.378e-4931.20pep primary_assembly:Astyanax_mexicanus-2.0:2:2566... [more]
cops27.279e-1726.39COP9 signalosome subunit 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
psmd11b4.923e-15056.96proteasome 26S subunit, non-ATPase 11b [Source:NCB... [more]
ENSPMAT00000001532.11.424e-1726.39pep scaffold:Pmarinus_7.0:GL477608:3889:17671:-1 g... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
RPN61.014e-8443.19Essential, non-ATPase regulatory subunit of the 26... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO316013.791e-14357.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476549.887e-1723.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368462.346e-723.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000023519.23.601e-14956.4626S proteasome non-ATPase regulatory subunit 11A [... [more]
psmd11b3.782e-14855.1926S proteasome non-ATPase regulatory subunit 11B [... [more]
psmd11b2.224e-14354.4326S proteasome non-ATPase regulatory subunit 11B [... [more]
cops25.138e-1625.93COP9 signalosome subunit 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of 26S proteasome non-ATPase regulatory subunit 11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048466.10.000e+099.75SMESG000048466.1[more]
SMESG000023422.12.827e-1426.77SMESG000023422.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033354 ID=SMED30033354|Name=26S proteasome non-ATPase regulatory subunit 11|organism=Schmidtea mediterranea sexual|type=transcript|length=1345bp
TTATGATATAATCTAAATTTTACGATTTCTCTCGTTTGTTTGAATAATTG
TAAACTTCTTTTTCATAAATTGCTTAATAATACAGATTTAAAGTTATGAC
AGAGGTTCTAAATTACCAAAATTTGGTGCTACAAGACATTAGTTCAGATG
ACTTTGAACTATTGAAAGAAAAAGAAAATGCAATTCTTTCTCTCGGAGAA
CATTATTCAAAAAATAACATGTCTATGGATTTATCAAATTTAATTATAGC
TTCTCGTCCATTTTTAAACCAAGTTAGTAAAGCAAAGTCAGGGAAACTGG
TTAGGTCACTTGTAGATTTTTATTTGGAAATGGAAGTTAGCACTGGTGAC
GAAATAGCTTTGTGCAAAGAATGTATTGAATGGACTATTAATGAAAGGAG
GAATTATTTGCGACAAAATTTAGAGGCCAAATTAATGGGAATTTATTATT
TGAAAAGTCAATTTGAAGCAGCTCTTAATATTGGAAGTGCATTACTTAAA
GAGTTGAAGAAACTAGACGATAAAGGATTACTCGTAGAAGTTCAGCTGTT
AGAGAGTAAAATATACTATAGTTTATCGAATCTACAGCGCTCTAAAGCAG
CTTTAACTTCTGCCAGGACTACTGCAAATGGAATTTATTGCCCTCCAAAA
TTACAAGCTTCATTAGATTTGCAAAGTGGAATTTTGCATGCGGCAGATGA
GCGTGATTTCAAAACTGCCTATTCGTATTTTTATGAAGCTTTTGAGGGGT
TTGATGCAGTCGACACAAAAAAGTCATTAATTGCATTGAAATATATGTTG
ATGTCAAAGATCATGTTAAACTGCAGTGAAGAAGTTCCACAAATCCTCAC
TGGAAAATTAACCCTGAAACACACGGGACGAGATATCGATGCAATGCGAG
AAATTGCCAGTGCTGCAAATAAGCGTTCTTTATCGAGTTATATTGAAATT
TTAGAAAAGTATAAAGACAATTTGACTGCTGATCCTGTTATATCGAAACA
TCTTTATTCTCTTTATGATAATTTGCTAGGACAAAATTTAATCAAATTGA
TTGAGCCATATTCCCGTGTGCAAATCGATTATTTGGCTGGCTTGATCGAC
CTGCCTTTGGATACAGTAGAGCGGAAATTGTCTCAAATGATTTTGGACAA
GAAACTGAATGGTTTCCTAAATCAGGAAAGTGGAGTATTGATTCTTTTCG
ATGACAATGCGGATGATCAAGGATATAAAGTGGCATTGGAAATAATCCAT
AATCTCAGCACGGTTGTCGACCAATTGTATGTCAAGGCTAAAAGACTTAC
CTAAGTTATTATTTAATTAGTTAATAAATTTGTTGCTGTTTTTTC
back to top

protein sequence of SMED30033354-orf-1

>SMED30033354-orf-1 ID=SMED30033354-orf-1|Name=SMED30033354-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=403bp
MTEVLNYQNLVLQDISSDDFELLKEKENAILSLGEHYSKNNMSMDLSNLI
IASRPFLNQVSKAKSGKLVRSLVDFYLEMEVSTGDEIALCKECIEWTINE
RRNYLRQNLEAKLMGIYYLKSQFEAALNIGSALLKELKKLDDKGLLVEVQ
LLESKIYYSLSNLQRSKAALTSARTTANGIYCPPKLQASLDLQSGILHAA
DERDFKTAYSYFYEAFEGFDAVDTKKSLIALKYMLMSKIMLNCSEEVPQI
LTGKLTLKHTGRDIDAMREIASAANKRSLSSYIEILEKYKDNLTADPVIS
KHLYSLYDNLLGQNLIKLIEPYSRVQIDYLAGLIDLPLDTVERKLSQMIL
DKKLNGFLNQESGVLILFDDNADDQGYKVALEIIHNLSTVVDQLYVKAKR
LT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR040773Rpn6_N
IPR040780Rpn6_C_helix
IPR036390WH_DNA-bd_sf
IPR000717PCI_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0000502proteasome complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00753PINTcoord: 301..384
e-value: 1.1E-16
score: 71.5
NoneNo IPR availableGENE3DG3DSA:1.25.40.570coord: 26..402
e-value: 9.0E-145
score: 484.4
NoneNo IPR availablePANTHERPTHR10678:SF226S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 11coord: 10..401
NoneNo IPR availablePANTHERPTHR1067826S PROTEASOME NON-ATPASE REGULATORY SUBUNIT 11/COP9 SIGNALOSOME COMPLEX SUBUNIT 2coord: 10..401
IPR000717Proteasome component (PCI) domainSMARTSM00088PINT_4coord: 301..384
e-value: 1.1E-16
score: 71.5
IPR000717Proteasome component (PCI) domainPFAMPF01399PCIcoord: 265..367
e-value: 1.8E-18
score: 67.0
IPR000717Proteasome component (PCI) domainPROSITEPS50250PCIcoord: 204..372
score: 18.887
IPR04077326S proteasome regulatory subunit Rpn6, N-terminalPFAMPF18055RPN6_Ncoord: 7..109
e-value: 8.4E-30
score: 103.5
IPR0407806S proteasome subunit Rpn6, C-terminal helix domainPFAMPF18503RPN6_C_helixcoord: 374..399
e-value: 1.0E-8
score: 34.7
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 296..374