Serine/threonine-protein phosphatase

Overview
NameSerine/threonine-protein phosphatase
Smed IDSMED30033348
Length (bp)3759
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase (SMED30033348) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30033348) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase (SMED30033348) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase (SMED30033348) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033348

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033348h1SMcG0001589 SmedASXL_009832SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033348h1SMcG0001589 SmedASXL_005540SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033348h1SMcG0001589 SmedASXL_009831SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30033348h1SMcG0001589 SmedASXL_002442SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30033348h1SMcG0001589 dd_Smed_v4_34984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033348h1SMcG0001589 dd_Smed_v4_34984_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30033348h1SMcG0001589 Contig30998newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033348h1SMcG0001589 Contig30998uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033348h1SMcG0001589 Contig40363uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30033348h1SMcG0001589 Contig40363newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
zeta neoblastSMED30033348h1SMcG0001589 dd_Smed_v4_34984_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033348h1SMcG0001589 SMED_31351_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30033348h1SMcG0001589 SMED_31351_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A443SI86 (Calcineurin-like protein phosphoesterase OS=Leptotrombidium deliense OX=299467 GN=B4U80_12887 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 8.055e-11
Identity = 47/165 (28.48%), Postives = 77/165 (46.67%), Query Frame = 1
Query:  667 VFADFMINSYPCQVMCYPQFIGFAVARGLYPK--RLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLR 1155
            ++AD++ + +P + MC   F+ +    G  P   +LK IF+    ++  ++     LFG   MD  ++H G     R   IF+YYD N +  LDF ++  M+K +       EN+E   +A  K MG           D+  IT P F+K +   +  G + L R
Sbjct:  233 IYADYIQHCWPSEFMCCHSFVKYMSKFGWNPSDGKLKSIFRAFDYSRNGHIGLYELLFGLAAMDQKTKHGGNAGALRLTYIFRYYDDNIDGSLDFSDVVRMIKDINAAKNKDENSEREAEARMKAMG-------KETADK--ITFPEFLKTVANNKFAGTSLLFR 388          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: V4C8S5 (Serine/threonine-protein phosphatase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_142980 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.647e-10
Identity = 52/169 (30.77%), Postives = 80/169 (47.34%), Query Frame = 1
Query:  649 IFIQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKN------DNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIM------GLLNKSHTNTPVDQQNITLPAFVKGLH 1119
            I  Q  ++ +FM  ++P Q+MC P F  +  A+G     +  IF+     K  YLTY++ L G   M+  ++H GM    R   IFKYYDKN      +N   D +  FC V +MR ++   E TE V+ +  K         +  + ++  P  +QN  LP +    H
Sbjct:   27 ILEQGMLYKEFMETTHPAQLMCLPVFRRYLAAKGAKLDEIDDIFRAFDLHKRKYLTYKDVLLGLAAMEPTTQHGGMPAEMRCRYIFKYYDKNLDNFLQENFEYDDIIWFCTV-QMRPEL---EQTELVQNSPIKCHHNEDTSAIFKQPNSRPPQTKQN-ALPKYELATH 190          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A443QW28 (Calcineurin-like protein phosphoesterase OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_00778 PE=4 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 2.183e-8
Identity = 38/123 (30.89%), Postives = 61/123 (49.59%), Query Frame = 1
Query:  667 VFADFMINSYPCQVMCYPQFIGFAVARGLYPK--RLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATK 1029
            +++DF+ + +P Q M Y  FI F    G +P   RL  IF+  +     YL++   L G   MD A++H G     R G IF+YYD N++  LD+ ++  M   + +      +   V + TK
Sbjct:  249 LYSDFLQHCFPSQYMSYASFIDFMARIGWHPTDIRLHPIFRAFNYKATGYLSFHELLLGLGAMDQATQHGGHPGELRCGYIFRYYDVNNDGILDYADIVRMTSDIFRGKDMEADDATVEKETK 371          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: A0A443QYY0 (Serine/threonine-protein phosphatase OS=Dinothrombium tinctorium OX=1965070 GN=B4U79_14204 PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.248e-7
Identity = 54/214 (25.23%), Postives = 90/214 (42.06%), Query Frame = 1
Query:  667 VFADFMINSYPCQVMCYPQFIGF--AVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRFSMPYLIKTRHLMGKYIENSQIVLLRELDTSAG---NGLIPYFINEAYS 1293
            ++ +F+ + YP   M +  F  +   +  G     L   ++  +  K  Y+T+  FL G   +D  +   G T   R G IF+YYD N +  LD  E+  +V  + +      + E V +  +K    L    ++      NI L  F KG+      G + L RFS P +++  +L   Y   SQ+ L   +D   G    G  P    + Y+
Sbjct:  239 IYGEFIQHCYPSHFMVFNSFADYMKKIGWGSNDLDLPSTYRAFAFNKTAYITFHEFLLGLAALDKHTHQGGHTGELRCGYIFRYYDLNSDGVLDHSEMIRLVTDILRLHNKPVDDESVEKEVEKNYAALGIQKSD------NINLELFTKGVGTLVFRGSSKLFRFSSP-ILQAINLKKCYDSISQLHLADGIDDGPGKRPKGTCPRCRTKKYT 445          
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Match: K1Q4I8 (Serine/threonine-protein phosphatase OS=Crassostrea gigas OX=29159 GN=CGI_10013947 PE=3 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.377e-6
Identity = 40/162 (24.69%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  580 KTSSQIGKNKSLLEQIVLETNTDIFIQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTN 1065
            + SSQ+   +++++   L        Q  ++ +FM    PC +M    F  + V +G   ++++ +F+     K+  L +++ L G   ++ +++H GM    R   IF++YD+N +  L F E  CMV+ +RK  G + + + V +  +K   L      N
Sbjct:  154 EDSSQLSAQEAVVKSAKLGKKE----QELLYYEFMDWCLPCSMMNKTVFKEYIVHKGAKAEQVEALFRSFDFHKKNVLQFKDILVGLAALEPSTQHGGMPAEVRCRYIFRFYDQNMDGFLQFEEFKCMVRDIRKIKGLSLDDDSVTEDAQKSAKLFGNETKN 311          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000031871.1 (SMESG000031871.1)

HSP 1 Score: 2052.33 bits (5316), Expect = 0.000e+0
Identity = 1034/1043 (99.14%), Postives = 1036/1043 (99.33%), Query Frame = 1
Query:  526 KKHNDSNLFEYKLVPISLKTSSQIGKNKSLLEQIVLETNTDIFIQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRFSMPYLIKTRHLMGKYIENSQIVLLRELDTSAGNGLIPYFINEAYSTEELFNNMIYYSKNYENLQELLQKMDDKNKLAITKFKAFNILSNFFNQIFYYLSEIAFDIYNSEGLFPLRNPLFLTLIMTTLAVVYPTLFANSALLWQQILAYFTTGLPTLIYASRQLMKKPIPGLTNSYQELKSKALSLRSNHWLTRRDKLVKRENEIEAKNSQNIGRIPKDLSQKSEEPKKNLKSKINDDDDISAFKNVKIQPPKESDSSEVKMSVKQPIINPKEKESKVPEIKIDLQKNIQQESLKNSPKKSDIPKDGVNQKEILKTTLPDDKKSDPSVGRQXXXXXXXXXXXXXXXEISAFKETPPFKIKDKEIRDKGKLLPKSADENVKVKLDNLPTQSKEKVIPNTEIRKHLNDIKTPVESGKVLTKLPEEKIKVKLDDLPTQTKEKVIAKTEISKPLNDIKKPVESILKIQVKDKQPSGKENSRIIQDLPKQNISDKDSLKEKKYIEDSSKVSNDNIILKIGTDLNKNRNVKENLPVDPKIQKPKDLENFKSKNNLKEDQDINSKYITQKNVDQKVSFKIQKDVSAKDNSQKLIVNQAQESVKFKTETPKPEAVIDSSKNKIQVQEKGKGNGMFFGIFQHNEQPSKLNDKPMESVQSEDRSNIDLSKSQINPKMNLDDSTHSNDKQSSFVAASDMPSHPKDKISSYWETDASCPSEDEENIKSNVEPPKFTDKKSPEVKTDIPAKSYRRFLECDKPAESKTKINSTLNKDRSSPGKCTKESELSENLQSPYFETDMESCSPSDTSRITDESKCADYVCKIKRENSDSSRCSFKGCRNSCK 3654
            KKHNDSNLFEYKLVPISLKTSSQIGKNKSLLEQIVLETNTDIFIQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRFSMPYLIKTRHLMGKYIENSQIVLLRELDTSAGNGLIPYFINEAYSTEELFNNMIYYSKNYENLQELLQKMDDKNKLAITKFKAFNILSNFFNQIFYYLSEIAFDIYNSEGLFPLRNPLFLTLIMTTLAVVYPTLFANSALLWQQILAYFTTGLPTLIYASRQLMKKPIPGL NSYQELKSKALSLRSNHWLTRRDKLVKRENEIEAKNSQNIGRIPKDLSQKSEEPKKNLKSKI DDDDISAFKNVKIQP KESDSSEVKMSVKQPIINPKEKESKVPEIKIDLQKNIQQESLKNSPKKSDIPKDGVNQKEILKTTLPDDKKSDPSVGRQKKSNDSDSNKSTVDNEISAFKETPPFKIKDKEIRDKGKLLPKSADENVKVKLDNLPTQSKEKVIPNTEIRK LNDIKTPVESGKVLTKLPEEKIKVKLDDLPTQTKEKVIAKTEISKPLNDIKKPVESILKIQVKDKQPSGKENSRIIQDLPKQNISDKDSLKEKKYIEDSSKVSNDNIILKIGTDLNKNRNVKENLPVDPKIQKPKDLENFKSKNNLKEDQDINSKYITQKNVDQKVSFKIQKDVSAKDNSQKLIVNQAQESVKFKTETPKPEAVIDSSKNKIQVQEKGKGNGMFFGIFQHNEQPSKLNDKPMESVQSEDRSNIDLSKSQINPKMNLDDSTHSNDKQSSFVAASDMPSHPKDKISSYWETDASCPSEDEENIKSNVEPPKFTDKKSPEVKT+IPAKSYRRFLECDKP+ESKTKINSTLNKD SSPGKCTKESELSENLQSPYFETDMESCSP DTSRITDESKC DYVCKIKRENSDSSRCSFKGCRNSCK
Sbjct:  173 KKHNDSNLFEYKLVPISLKTSSQIGKNKSLLEQIVLETNTDIFIQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRFSMPYLIKTRHLMGKYIENSQIVLLRELDTSAGNGLIPYFINEAYSTEELFNNMIYYSKNYENLQELLQKMDDKNKLAITKFKAFNILSNFFNQIFYYLSEIAFDIYNSEGLFPLRNPLFLTLIMTTLAVVYPTLFANSALLWQQILAYFTTGLPTLIYASRQLMKKPIPGLMNSYQELKSKALSLRSNHWLTRRDKLVKRENEIEAKNSQNIGRIPKDLSQKSEEPKKNLKSKIMDDDDISAFKNVKIQPTKESDSSEVKMSVKQPIINPKEKESKVPEIKIDLQKNIQQESLKNSPKKSDIPKDGVNQKEILKTTLPDDKKSDPSVGRQKKSNDSDSNKSTVDNEISAFKETPPFKIKDKEIRDKGKLLPKSADENVKVKLDNLPTQSKEKVIPNTEIRKPLNDIKTPVESGKVLTKLPEEKIKVKLDDLPTQTKEKVIAKTEISKPLNDIKKPVESILKIQVKDKQPSGKENSRIIQDLPKQNISDKDSLKEKKYIEDSSKVSNDNIILKIGTDLNKNRNVKENLPVDPKIQKPKDLENFKSKNNLKEDQDINSKYITQKNVDQKVSFKIQKDVSAKDNSQKLIVNQAQESVKFKTETPKPEAVIDSSKNKIQVQEKGKGNGMFFGIFQHNEQPSKLNDKPMESVQSEDRSNIDLSKSQINPKMNLDDSTHSNDKQSSFVAASDMPSHPKDKISSYWETDASCPSEDEENIKSNVEPPKFTDKKSPEVKTNIPAKSYRRFLECDKPSESKTKINSTLNKDPSSPGKCTKESELSENLQSPYFETDMESCSPLDTSRITDESKCVDYVCKIKRENSDSSRCSFKGCRNSCK 1215          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000072358.1 (SMESG000072358.1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.280e-9
Identity = 40/171 (23.39%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  655 IQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERL---DFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRF 1158
            +Q  V+  FM  +YPC  M YPQF  F + + +    +   F+    A E ++++ +FL    CMD+ + H G     R+  IF +YD++ +  +   D   +   + K + K    ++ + + Q   +I  +         V+   + L +F+  +      G + L RF
Sbjct:  194 LQKCVYKIFMNYNYPCSKMAYPQFEQFMINQKIDKGEISNYFRCFDVASEGFISFHHFLIAVGCMDINTVHGGQIGELRSRYIFSFYDEDKDGFITTYDIRRMIFDINKRKNKPCDEKSIDNILQDAIRIFDI--------KVNNVKVNLDSFLTAVGNLLFRGTSTLFRF 356          
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Match: SMESG000072358.1 (SMESG000072358.1)

HSP 1 Score: 60.8474 bits (146), Expect = 3.758e-9
Identity = 40/171 (23.39%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  655 IQNYVFADFMINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFLFGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERL---DFLELFCMVKKMRKKMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPELWGLTFLLRF 1158
            +Q  V+  FM  +YPC  M YPQF  F + + +    +   F+    A E ++++ +FL    CMD+ + H G     R+  IF +YD++ +  +   D   +   + K + K    ++ + + Q   +I  +         V+   + L +F+  +      G + L RF
Sbjct:  195 LQKCVYKIFMNYNYPCSKMAYPQFEQFMINQKIDKGEISNYFRCFDVASEGFISFHHFLIAVGCMDINTVHGGQIGELRSRYIFSFYDEDKDGFITTYDIRRMIFDINKRKNKPCDEKSIDNILQDAIRIFDI--------KVNNVKVNLDSFLTAVGNLLFRGTSTLFRF 357          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SI868.055e-1128.48Calcineurin-like protein phosphoesterase OS=Leptot... [more]
V4C8S52.647e-1030.77Serine/threonine-protein phosphatase OS=Lottia gig... [more]
A0A443QW282.183e-830.89Calcineurin-like protein phosphoesterase OS=Dinoth... [more]
A0A443QYY03.248e-725.23Serine/threonine-protein phosphatase OS=Dinothromb... [more]
K1Q4I81.377e-624.69Serine/threonine-protein phosphatase OS=Crassostre... [more]
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serine/threonine-protein phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000031871.10.000e+099.14SMESG000031871.1[more]
SMESG000072358.13.280e-923.39SMESG000072358.1[more]
SMESG000072358.13.758e-923.39SMESG000072358.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033348 ID=SMED30033348|Name=Serine/threonine-protein phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=3759bp
GTTCATAATAAGTTTGCCTCATGTTCATGGAGCTAGTGAAACGTTGAGGG
ATAATATTATTACAAAATTTAAAAAAACTGAATGAAACTGATGAAGCAAG
AATTGCAGAAAATGTTATGAAACTTCATCTTCCTATCAAAATAATTAATG
CTGCAAAACAAATTTACAAAGACTTTCAAGCAGCCGCTAAATATTATAAA
ATACATTAAGTCGAAGAAGTGTCTTTCGGGTCGCTCAAAAAAATTTTCTC
GGTGCACGACACCTCTGGTTATAGATTATAAAAATAACAAACTAAACCAA
ATAATAAATTGTCTAAAAATGTGTTGCAAAAGCAATTATTCTGAAGTAAG
AAATCTGTTTATTCTAACTGTCCCGGATTGATTGGCTACTATAAGCTTCG
TATTAAGTTCAAGGAAAAGATTTGGTGAAATTTTCGAAGTTTCTGAAATC
GATTTTTTATTAGCAAATGAACATCTAGCCATAATTTTTTCTAATTCAAA
AATAAAAATTTTGCACGTAAATGATAAAAAACATAATGATTCCAATCTCT
TTGAATATAAACTCGTCCCAATCAGTTTGAAAACTTCAAGTCAAATAGGT
AAAAACAAATCTTTACTTGAACAAATTGTCTTGGAAACTAATACAGATAT
ATTCATTCAAAATTATGTTTTTGCTGATTTTATGATTAACTCCTATCCGT
GTCAAGTTATGTGTTATCCTCAGTTTATAGGGTTCGCTGTTGCTAGGGGT
TTGTATCCGAAACGATTGAAACGAATATTCAAAGTTCTATCAGATGCTAA
AGAAATGTATTTAACTTATGAAAACTTTTTATTTGGCTGTATTTGCATGG
ATTTAGCATCAGAACATTCCGGTATGACCAGGGTAGCACGAGCTGGATTA
ATTTTCAAATATTATGACAAAAACGATAATGAGCGATTAGATTTTTTAGA
ATTGTTTTGTATGGTTAAGAAAATGAGAAAAAAAATGGGTTACGCTGAAA
ATACTGAAGAAGTTAGACAAGCAACTAAAAAGATTATGGGGTTACTCAAT
AAATCACACACAAATACACCAGTCGATCAACAAAACATAACGCTACCTGC
TTTTGTTAAGGGATTGCATTATCCTGAGTTGTGGGGTTTGACGTTTTTGT
TGCGCTTTTCTATGCCATATCTTATTAAAACCAGACATCTCATGGGGAAA
TATATAGAAAATTCACAAATCGTCCTGTTGAGAGAACTCGACACTTCGGC
AGGCAATGGACTGATTCCTTATTTTATCAACGAAGCATATTCCACTGAAG
AATTATTTAACAATATGATATATTATTCTAAAAACTATGAAAATCTTCAG
GAGTTATTACAGAAAATGGACGATAAGAATAAACTTGCAATAACAAAGTT
TAAAGCCTTTAATATTCTTTCGAATTTCTTCAATCAAATATTCTATTATC
TCTCAGAAATCGCGTTTGACATTTATAATTCTGAAGGATTATTTCCATTG
CGAAATCCGTTATTTCTCACATTGATAATGACAACATTGGCTGTTGTTTA
TCCTACCTTATTTGCTAATTCGGCTTTATTATGGCAGCAAATACTAGCAT
ATTTTACCACTGGTTTACCGACATTGATTTATGCTAGTCGCCAACTCATG
AAGAAACCAATACCGGGTTTAACGAATTCTTATCAAGAACTGAAATCTAA
AGCCCTTTCATTGAGATCGAATCATTGGTTGACTCGACGAGATAAATTGG
TTAAGCGTGAAAATGAAATTGAAGCAAAGAACTCTCAAAATATAGGAAGA
ATTCCGAAAGATTTGTCACAAAAATCAGAAGAACCTAAAAAGAATTTAAA
GAGCAAAATTAATGATGATGATGATATATCGGCTTTTAAAAACGTCAAAA
TTCAGCCACCCAAAGAAAGTGACAGTTCTGAAGTAAAAATGAGTGTGAAG
CAGCCAATTATTAATCCAAAAGAGAAGGAATCAAAAGTCCCGGAAATAAA
AATTGATTTACAAAAGAATATACAACAAGAATCCTTGAAGAATTCACCAA
AAAAGTCTGACATCCCTAAAGATGGGGTTAATCAAAAAGAGATTTTAAAG
ACTACTCTACCAGATGATAAAAAGTCAGATCCTTCTGTTGGACGACAGAA
AAAATCAAATGATTCAGATAGCAATAAATCTACAGTAGATAATGAAATTT
CAGCATTTAAAGAAACTCCACCATTTAAAATTAAAGATAAGGAAATTCGA
GACAAAGGGAAACTTTTACCAAAATCAGCCGATGAAAATGTTAAAGTCAA
ATTAGATAATTTACCAACCCAATCTAAAGAAAAGGTAATTCCTAACACAG
AAATACGAAAACATTTGAATGATATTAAAACTCCAGTTGAAAGCGGAAAA
GTTCTAACGAAACTACCAGAAGAAAAAATAAAAGTTAAATTGGATGACTT
ACCAACTCAAACTAAGGAGAAAGTTATTGCTAAGACAGAAATATCAAAAC
CATTAAATGATATAAAAAAACCAGTAGAATCAATTTTAAAAATTCAAGTA
AAAGACAAACAACCATCTGGTAAAGAGAATTCCCGAATTATACAAGACTT
ACCAAAACAAAATATTTCCGATAAAGACAGTTTGAAAGAAAAGAAATACA
TTGAAGATTCATCAAAAGTTTCAAACGACAACATAATTTTAAAAATTGGA
ACTGATTTGAACAAAAATCGTAATGTTAAAGAAAATCTTCCAGTTGATCC
AAAAATCCAAAAACCGAAAGATTTAGAAAATTTTAAATCAAAGAATAACC
TTAAAGAGGATCAAGATATCAATTCTAAGTATATTACACAAAAAAACGTT
GACCAAAAAGTGAGTTTTAAAATTCAAAAAGATGTTTCAGCGAAAGATAA
TAGTCAAAAATTAATAGTAAATCAAGCACAAGAAAGTGTTAAATTTAAAA
CCGAAACACCGAAACCGGAAGCGGTTATAGATAGTTCAAAGAATAAAATA
CAGGTTCAAGAGAAAGGTAAAGGTAATGGAATGTTTTTTGGAATTTTTCA
ACACAATGAACAGCCTTCGAAGTTAAATGATAAGCCTATGGAATCAGTTC
AATCCGAAGACAGATCAAATATTGACTTATCTAAAAGCCAAATTAACCCG
AAAATGAATTTAGATGATTCAACTCATTCCAATGATAAGCAAAGTTCTTT
TGTCGCTGCGTCAGACATGCCGAGTCATCCAAAAGACAAAATAAGTTCTT
ATTGGGAAACAGATGCTTCTTGTCCATCAGAGGATGAAGAAAATATCAAA
TCGAATGTTGAACCACCGAAATTTACTGATAAAAAAAGTCCTGAAGTGAA
AACCGATATTCCCGCTAAATCGTATAGGCGGTTTTTAGAGTGTGATAAAC
CAGCTGAATCCAAAACCAAGATAAATTCCACTTTAAACAAAGACCGATCA
AGTCCAGGAAAATGTACCAAGGAGTCTGAATTATCTGAAAATCTACAGAG
CCCTTATTTTGAAACTGATATGGAATCTTGTTCACCGTCGGATACGAGTA
GAATTACAGATGAATCGAAATGTGCAGATTATGTGTGCAAAATAAAACGG
GAAAACTCAGATTCAAGCCGTTGTTCATTTAAAGGATGTCGAAACTCATG
CAAGTAGCCATTGAGATTTTGGGATTTTTGATTTTTTTTTCTTTATATTT
ATCGTTATTTTAGGATTTTTATTTATGTTTTTCCTTATATTTATCATTTT
GGGATTTTA
back to top

protein sequence of SMED30033348-orf-1

>SMED30033348-orf-1 ID=SMED30033348-orf-1|Name=SMED30033348-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=992bp
MINSYPCQVMCYPQFIGFAVARGLYPKRLKRIFKVLSDAKEMYLTYENFL
FGCICMDLASEHSGMTRVARAGLIFKYYDKNDNERLDFLELFCMVKKMRK
KMGYAENTEEVRQATKKIMGLLNKSHTNTPVDQQNITLPAFVKGLHYPEL
WGLTFLLRFSMPYLIKTRHLMGKYIENSQIVLLRELDTSAGNGLIPYFIN
EAYSTEELFNNMIYYSKNYENLQELLQKMDDKNKLAITKFKAFNILSNFF
NQIFYYLSEIAFDIYNSEGLFPLRNPLFLTLIMTTLAVVYPTLFANSALL
WQQILAYFTTGLPTLIYASRQLMKKPIPGLTNSYQELKSKALSLRSNHWL
TRRDKLVKRENEIEAKNSQNIGRIPKDLSQKSEEPKKNLKSKINDDDDIS
AFKNVKIQPPKESDSSEVKMSVKQPIINPKEKESKVPEIKIDLQKNIQQE
SLKNSPKKSDIPKDGVNQKEILKTTLPDDKKSDPSVGRQKKSNDSDSNKS
TVDNEISAFKETPPFKIKDKEIRDKGKLLPKSADENVKVKLDNLPTQSKE
KVIPNTEIRKHLNDIKTPVESGKVLTKLPEEKIKVKLDDLPTQTKEKVIA
KTEISKPLNDIKKPVESILKIQVKDKQPSGKENSRIIQDLPKQNISDKDS
LKEKKYIEDSSKVSNDNIILKIGTDLNKNRNVKENLPVDPKIQKPKDLEN
FKSKNNLKEDQDINSKYITQKNVDQKVSFKIQKDVSAKDNSQKLIVNQAQ
ESVKFKTETPKPEAVIDSSKNKIQVQEKGKGNGMFFGIFQHNEQPSKLND
KPMESVQSEDRSNIDLSKSQINPKMNLDDSTHSNDKQSSFVAASDMPSHP
KDKISSYWETDASCPSEDEENIKSNVEPPKFTDKKSPEVKTDIPAKSYRR
FLECDKPAESKTKINSTLNKDRSSPGKCTKESELSENLQSPYFETDMESC
SPSDTSRITDESKCADYVCKIKRENSDSSRCSFKGCRNSCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 219..239
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 17..151
e-value: 1.3E-7
score: 33.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 866..890
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 622..651
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 512..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 367..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 456..498
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..402
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 426..440
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 794..894
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 908..935
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 911..935
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 809..844
NoneNo IPR availableTMHMMTMhelixcoord: 240..262
NoneNo IPR availableTMHMMTMhelixcoord: 304..323
NoneNo IPR availableTMHMMTMhelixcoord: 277..299
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 66..101
score: 8.711
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 24..59
score: 5.364
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 25..146