Obg-like ATPase 1

Overview
NameObg-like ATPase 1
Smed IDSMED30033346
Length (bp)1406
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Obg-like ATPase 1 (SMED30033346) t-SNE clustered cells

Violin plots show distribution of expression levels for Obg-like ATPase 1 (SMED30033346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Obg-like ATPase 1 (SMED30033346) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Obg-like ATPase 1 (SMED30033346) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033346h1SMcG0018436 SmedASXL_018998SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30033346h1SMcG0018436 dd_Smed_v4_2199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30033346h1SMcG0018436 dd_Smed_v4_2199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033346h1SMcG0018436 dd_Smed_v4_2199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033346h1SMcG0018436 dd_Smed_v4_2199_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Match: OLA1 (Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:28833])

HSP 1 Score: 534.258 bits (1375), Expect = 0.000e+0
Identity = 272/393 (69.21%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:   24 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 416          
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Match: OLA1 (Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:28833])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 272/393 (69.21%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Match: OLA1 (Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:28833])

HSP 1 Score: 327.02 bits (837), Expect = 1.383e-109
Identity = 157/234 (67.09%), Postives = 187/234 (79.91%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYV 771
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y+
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYI 237          
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Match: OLA1 (Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:28833])

HSP 1 Score: 301.982 bits (772), Expect = 1.703e-100
Identity = 160/233 (68.67%), Postives = 184/233 (78.97%), Query Frame = 1
Query:  553 VDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    6 IDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 238          
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Match: OLA1 (Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:28833])

HSP 1 Score: 180.259 bits (456), Expect = 7.254e-55
Identity = 84/112 (75.00%), Postives = 97/112 (86.61%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHIN 408
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHIS 115          
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Match: ola-1 (Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91917])

HSP 1 Score: 473.396 bits (1217), Expect = 7.016e-166
Identity = 245/395 (62.03%), Postives = 301/395 (76.20%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK    +K  L+GR+ T LKVGI+G+PNVGKSTFFNVLTKS+A AENFPFCTIDPNESRV V DDRFDWL   + P S+ PA+L+V DIAGLVKGA EG GLGNAFLSH++  DA+FH+ R F+ +DV HVEG+V+P+RDLEII+ EL  KD ++I   +DK+EK F R  DK  K E DT+++V+K + ++KKPVR   W   +IE+LN HLF+TAKP +YL+N+SE  Y++KKNKWL KIK+W+D  D GA +IPFS   ELK  +M ++E  +Y KE G  S L KI+ TGYKALQL+YFFT G+DEVKAWTIQ GT AP+AAG+IHTD EKGFIMAEVM   D    G E   KA GKY+Q+G+ YIV+DGD+IFFKFNAGAGL  KK
Sbjct:    1 MPPKKNVVEEKPALIGRLGTNLKVGILGLPNVGKSTFFNVLTKSEAQAENFPFCTIDPNESRVAVQDDRFDWLVNHYKPASKVPAFLNVTDIAGLVKGASEGQGLGNAFLSHVSACDALFHLCRAFDDDDVTHVEGEVDPVRDLEIISNELFAKDLQFIDGPLDKVEKLFTRANDKTKKIEYDTLVRVKKCL-EEKKPVRQELWNEKEIEILNKHLFLTAKPIVYLVNLSEKDYIRKKNKWLPKIKAWIDTNDAGAVLIPFSGAFELKLLDMPEDERQKYLKEQGVTSNLDKIVHTGYKALQLEYFFTSGEDEVKAWTIQVGTPAPKAAGRIHTDFEKGFIMAEVMKVADLIELGDEAKCKAGGKYRQQGKTYIVQDGDVIFFKFNAGAGLQAKK 394          
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Match: ola-1 (Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91917])

HSP 1 Score: 473.396 bits (1217), Expect = 7.016e-166
Identity = 245/395 (62.03%), Postives = 301/395 (76.20%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK    +K  L+GR+ T LKVGI+G+PNVGKSTFFNVLTKS+A AENFPFCTIDPNESRV V DDRFDWL   + P S+ PA+L+V DIAGLVKGA EG GLGNAFLSH++  DA+FH+ R F+ +DV HVEG+V+P+RDLEII+ EL  KD ++I   +DK+EK F R  DK  K E DT+++V+K + ++KKPVR   W   +IE+LN HLF+TAKP +YL+N+SE  Y++KKNKWL KIK+W+D  D GA +IPFS   ELK  +M ++E  +Y KE G  S L KI+ TGYKALQL+YFFT G+DEVKAWTIQ GT AP+AAG+IHTD EKGFIMAEVM   D    G E   KA GKY+Q+G+ YIV+DGD+IFFKFNAGAGL  KK
Sbjct:    1 MPPKKNVVEEKPALIGRLGTNLKVGILGLPNVGKSTFFNVLTKSEAQAENFPFCTIDPNESRVAVQDDRFDWLVNHYKPASKVPAFLNVTDIAGLVKGASEGQGLGNAFLSHVSACDALFHLCRAFDDDDVTHVEGEVDPVRDLEIISNELFAKDLQFIDGPLDKVEKLFTRANDKTKKIEYDTLVRVKKCL-EEKKPVRQELWNEKEIEILNKHLFLTAKPIVYLVNLSEKDYIRKKNKWLPKIKAWIDTNDAGAVLIPFSGAFELKLLDMPEDERQKYLKEQGVTSNLDKIVHTGYKALQLEYFFTSGEDEVKAWTIQVGTPAPKAAGRIHTDFEKGFIMAEVMKVADLIELGDEAKCKAGGKYRQQGKTYIVQDGDVIFFKFNAGAGLQAKK 394          
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Match: ola-1 (Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Acc:P91917])

HSP 1 Score: 164.851 bits (416), Expect = 3.272e-49
Identity = 82/124 (66.13%), Postives = 95/124 (76.61%), Query Frame = 1
Query:  880 MSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M ++E  +Y KE G  S L KI+ TGYKALQL+YFFT G+DEVKAWTIQ GT AP+AAG+IHTD EKGFIMAEVM   D    G E   KA GKY+Q+G+ YIV+DGD+IFFKFNAGAGL  KK
Sbjct:    1 MPEDERQKYLKEQGVTSNLDKIVHTGYKALQLEYFFTSGEDEVKAWTIQVGTPAPKAAGRIHTDFEKGFIMAEVMKVADLIELGDEAKCKAGGKYRQQGKTYIVQDGDVIFFKFNAGAGLQAKK 124          
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277300:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 55.4546 bits (132), Expect = 4.172e-8
Identity = 32/118 (27.12%), Postives = 60/118 (50.85%), Query Frame = 1
Query:   82 GDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHML 435
            G E ++ I    ++     G+VG PN GKS+    +++++    ++PF T+ P+   V   D  F+               ++V DI GL++ +H   GLG +FL HI   ++++++L
Sbjct:  173 GGEGEELIYDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYED--FEQ--------------IAVADIPGLIEDSHLNKGLGISFLKHIERCESLWYVL 274          
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Match: M01E5.2 (pep chromosome:WBcel235:I:13277061:13280175:-1 gene:WBGene00010805.1 transcript:M01E5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M01E5.2)

HSP 1 Score: 55.4546 bits (132), Expect = 4.172e-8
Identity = 32/118 (27.12%), Postives = 60/118 (50.85%), Query Frame = 1
Query:   82 GDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHML 435
            G E ++ I    ++     G+VG PN GKS+    +++++    ++PF T+ P+   V   D  F+               ++V DI GL++ +H   GLG +FL HI   ++++++L
Sbjct:  173 GGEGEELIYDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYED--FEQ--------------IAVADIPGLIEDSHLNKGLGISFLKHIERCESLWYVL 274          
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0474138)

HSP 1 Score: 517.309 bits (1331), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 311/395 (78.73%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK DEP++  L+GRI T L++GIVG+PNVGKSTFFNVLT+S A AENFPFCTI PNESRVPVPD+RFD+L E+H P S  PAYL+VVDIAGLVKGA EG GLGN FLSHI+  DAIFH+ R FE  DV HVEG+V+P+RDLEII+EELRLKD+E ++K +DKLEK   RGGDKKLKPE D+M+K++ I+ D K+ +RF DW  +DIE LN +LF+T+KP IYL+N+S+  +++KKNKWL KIK W+D+ DPGA +IPFS   E +     + E   Y  E    S L KI+ TGYK LQL+YFFT G DEVKAWTIQ GTKAPQAAG+IHTD EKGFIMAEVM++EDFK EGSE   KA GKY+Q+GR Y VEDGDIIFFKFNAGAGL   K
Sbjct:    1 MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0089385)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 311/395 (78.73%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK DEP++  L+GRI T L++GIVG+PNVGKSTFFNVLT+S A AENFPFCTI PNESRVPVPD+RFD+L E+H P S  PAYL+VVDIAGLVKGA EG GLGN FLSHI+  DAIFH+ R FE  DV HVEG+V+P+RDLEII+EELRLKD+E ++K +DKLEK   RGGDKKLKPE D+M+K++ I+ D K+ +RF DW  +DIE LN +LF+T+KP IYL+N+S+  +++KKNKWL KIK W+D+ DPGA +IPFS   E +     + E   Y  E    S L KI+ TGYK LQL+YFFT G DEVKAWTIQ GTKAPQAAG+IHTD EKGFIMAEVM++EDFK EGSE   KA GKY+Q+GR Y VEDGDIIFFKFNAGAGL   K
Sbjct:    1 MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0089383)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 311/395 (78.73%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK DEP++  L+GRI T L++GIVG+PNVGKSTFFNVLT+S A AENFPFCTI PNESRVPVPD+RFD+L E+H P S  PAYL+VVDIAGLVKGA EG GLGN FLSHI+  DAIFH+ R FE  DV HVEG+V+P+RDLEII+EELRLKD+E ++K +DKLEK   RGGDKKLKPE D+M+K++ I+ D K+ +RF DW  +DIE LN +LF+T+KP IYL+N+S+  +++KKNKWL KIK W+D+ DPGA +IPFS   E +     + E   Y  E    S L KI+ TGYK LQL+YFFT G DEVKAWTIQ GTKAPQAAG+IHTD EKGFIMAEVM++EDFK EGSE   KA GKY+Q+GR Y VEDGDIIFFKFNAGAGL   K
Sbjct:    1 MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0089384)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 311/395 (78.73%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK DEP++  L+GRI T L++GIVG+PNVGKSTFFNVLT+S A AENFPFCTI PNESRVPVPD+RFD+L E+H P S  PAYL+VVDIAGLVKGA EG GLGN FLSHI+  DAIFH+ R FE  DV HVEG+V+P+RDLEII+EELRLKD+E ++K +DKLEK   RGGDKKLKPE D+M+K++ I+ D K+ +RF DW  +DIE LN +LF+T+KP IYL+N+S+  +++KKNKWL KIK W+D+ DPGA +IPFS   E +     + E   Y  E    S L KI+ TGYK LQL+YFFT G DEVKAWTIQ GTKAPQAAG+IHTD EKGFIMAEVM++EDFK EGSE   KA GKY+Q+GR Y VEDGDIIFFKFNAGAGL   K
Sbjct:    1 MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Match: CG1354 (gene:FBgn0030151 transcript:FBtr0336922)

HSP 1 Score: 516.538 bits (1329), Expect = 0.000e+0
Identity = 261/395 (66.08%), Postives = 311/395 (78.73%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            M  KK DEP++  L+GRI T L++GIVG+PNVGKSTFFNVLT+S A AENFPFCTI PNESRVPVPD+RFD+L E+H P S  PAYL+VVDIAGLVKGA EG GLGN FLSHI+  DAIFH+ R FE  DV HVEG+V+P+RDLEII+EELRLKD+E ++K +DKLEK   RGGDKKLKPE D+M+K++ I+ D K+ +RF DW  +DIE LN +LF+T+KP IYL+N+S+  +++KKNKWL KIK W+D+ DPGA +IPFS   E +     + E   Y  E    S L KI+ TGYK LQL+YFFT G DEVKAWTIQ GTKAPQAAG+IHTD EKGFIMAEVM++EDFK EGSE   KA GKY+Q+GR Y VEDGDIIFFKFNAGAGL   K
Sbjct:    1 MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Match: ola1 (Obg-like ATPase 1 [Source:NCBI gene;Acc:326864])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 268/386 (69.43%), Postives = 313/386 (81.09%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNA 1227
            KK GD PK+  L+GR  T LK+GIVG+PNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVP+PD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLS+I   DAIFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D+KK VR + +W   +IEVLN HLF+T+KP IYL+N+SE  Y++KKNKWL KIK WVD  DPGA +IP S   E K+Q+MS EE  +Y +EN T S L KIIK+GY ALQL+YFFT G DEV+AWT++ GTKAPQAAGKIHTD EKGFIMAEVM + DFK EGSENA KA GKY+Q+GR YIVEDGDIIFFKFN 
Sbjct:    4 KKGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTRAFEDEDIIHVEGCVDPVRDIEIIHEELRMKDEEMIGPIIDKLEKTAVRGGDKKLKPEYDIMCKVKSWVVDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDAHDPGALVIPLSGGFESKYQDMSDEEKQKYCEENKTQSILTKIIKSGYSALQLEYFFTAGPDEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSENAAKAAGKYRQQGRNYIVEDGDIIFFKFNT 389          
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Match: ola1 (Obg-like ATPase 1 [Source:NCBI gene;Acc:326864])

HSP 1 Score: 412.535 bits (1059), Expect = 2.209e-142
Identity = 228/386 (59.07%), Postives = 267/386 (69.17%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNA 1227
            KK GD PK+  L+GR  T LK+GIVG+PNVGK                                                 PA+L+VVDIAGLVKGAH G GLGNAFLS+I   DAIFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D+KK VR+  +W   +IEVLN HLF+T+KP IYL+N+SE  Y++KKNKWL KIK WVD  DPGA +IP S   E K+Q+MS EE  +Y +EN T S L KIIK+GY ALQL+YFFT G DEV+AWT++ GTKAPQAAGKIHTD EKGFIMAEVM + DFK EGSENA KA GKY+Q+GR YIVEDGDIIFFKFN 
Sbjct:    4 KKGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKV------------------------------------------------PAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTRAFEDEDIIHVEGCVDPVRDIEIIHEELRMKDEEMIGPIIDKLEKTAVRGGDKKLKPEYDIMCKVKSWVVDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWVDAHDPGALVIPLSGGFESKYQDMSDEEKQKYCEENKTQSILTKIIKSGYSALQLEYFFTAGPDEVRAWTVRKGTKAPQAAGKIHTDFEKGFIMAEVMKFTDFKEEGSENAAKAAGKYRQQGRNYIVEDGDIIFFKFNT 341          
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Match: ola1 (Obg-like ATPase 1 [Source:NCBI gene;Acc:326864])

HSP 1 Score: 331.257 bits (848), Expect = 7.120e-112
Identity = 160/234 (68.38%), Postives = 191/234 (81.62%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYV 771
            KK GD PK+  L+GR  T LK+GIVG+PNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVP+PD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLS+I   DAIFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D+KK VR + +W   +IEVLN HLF+T+KP IYL+N+SE  Y+
Sbjct:    9 KKGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTRAFEDEDIIHVEGCVDPVRDIEIIHEELRMKDEEMIGPIIDKLEKTAVRGGDKKLKPEYDIMCKVKSWVVDEKKHVRYYHEWNDKEIEVLNKHLFLTSKPMIYLVNLSEKDYI 242          
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Match: CABZ01035356.1 (obg-like ATPase 1 [Source:NCBI gene;Acc:110438478])

HSP 1 Score: 198.364 bits (503), Expect = 2.076e-61
Identity = 93/124 (75.00%), Postives = 107/124 (86.29%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVF 444
            KK GD PK+  L+GR  T LK+GIVG+PNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVP+PD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLS+I   DAIFHM R +
Sbjct:    4 KKGGDGPKQPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSNIFACDAIFHMTREY 127          
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Match: mtg2 (mitochondrial ribosome-associated GTPase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-2209])

HSP 1 Score: 64.3142 bits (155), Expect = 9.892e-11
Identity = 35/123 (28.46%), Postives = 59/123 (47.97%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHML 435
            M   +G + ++  +   ++T     +VG PNVGKS+    ++K++ A   +PF T++P+   V   D                   ++V DI GL+ GAH   GLG +FL HI     + ++L
Sbjct:  174 MRATEGQQGQQREIQLELRTMAHAALVGFPNVGKSSLLRAISKARPAVAAYPFTTLNPHVGIVEYRDH----------------TQVAVADIPGLIPGAHLNRGLGLSFLRHIERCRVLLYVL 280          
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Match: lgals2 (lectin, galactoside binding soluble 2 [Source:Xenbase;Acc:XB-GENE-1032899])

HSP 1 Score: 514.998 bits (1325), Expect = 0.000e+0
Identity = 261/393 (66.41%), Postives = 315/393 (80.15%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK  D PK+  ++GR  T LK+GIVG+PN+GKSTFFNVLTKSQAAAENFPFCTI+PNESRVPVPD+RF++LC++H P S+ PA+L+VVDIAGLVKGA  G GLGNAFLS+I+  D IFH++R F+ +D+IHVEG VNP+RD+EII EELRLKD+E I+  +DKLEK   RGGDKKLKPE D M KV+  I D+K  VRF  DW   +I+VLN +LF+T+KP IYL+N+SE  Y++KKNKWL KIK WVD+ DP A +IPFS  +EL  Q+MS EE  +Y +E  T S L KI+KTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EGSE++VKA GKY+Q+GR Y VEDGDIIFFKFN      KK
Sbjct:    9 KKADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTINPNESRVPVPDERFEFLCQYHKPASKVPAFLNVVDIAGLVKGASTGQGLGNAFLSNISACDGIFHLMRAFDDDDIIHVEGSVNPVRDIEIIHEELRLKDEEMIIAALDKLEKVAVRGGDKKLKPEYDIMCKVKNWIIDEKNHVRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPCALVIPFSGVLELNLQDMSDEEKHKYLQEKVTQSVLSKIVKTGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKEEGSESSVKAAGKYRQQGRNYTVEDGDIIFFKFNTPQQSKKK 401          
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Match: lgals2 (lectin, galactoside binding soluble 2 [Source:Xenbase;Acc:XB-GENE-1032899])

HSP 1 Score: 463.381 bits (1191), Expect = 2.088e-161
Identity = 235/354 (66.38%), Postives = 285/354 (80.51%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEG 1131
            KK  D PK+  ++GR  T LK+GIVG+PN+GKSTFFNVLTKSQAAAENFPFCTI+PNESRVPVPD+RF++LC++H P S+ PA+L+VVDIAGLVKGA  G GLGNAFLS+I+  D IFH++R F+ +D+IHVEG VNP+RD+EII EELRLKD+E I+  +DKLEK   RGGDKKLKPE D M KV+  I D+K  VRF  DW   +I+VLN +LF+T+KP IYL+N+SE  Y++KKNKWL KIK WVD+ DP A +IPFS  +EL  Q+MS EE  +Y +E  T S L KI+KTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EG
Sbjct:    4 KKADDGPKQHPIIGRFGTSLKIGIVGLPNIGKSTFFNVLTKSQAAAENFPFCTINPNESRVPVPDERFEFLCQYHKPASKVPAFLNVVDIAGLVKGASTGQGLGNAFLSNISACDGIFHLMRAFDDDDIIHVEGSVNPVRDIEIIHEELRLKDEEMIIAALDKLEKVAVRGGDKKLKPEYDIMCKVKNWIIDEKNHVRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPCALVIPFSGVLELNLQDMSDEEKHKYLQEKVTQSVLSKIVKTGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKEEG 357          
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Match: lgals2 (lectin, galactoside binding soluble 2 [Source:Xenbase;Acc:XB-GENE-1032899])

HSP 1 Score: 403.29 bits (1035), Expect = 1.579e-138
Identity = 222/393 (56.49%), Postives = 269/393 (68.45%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK  D PK+  ++GR  T LK+GIVG+PN+GK                                                 PA+L+VVDIAGLVKGA  G GLGNAFLS+I+  D IFH++R F+ +D+IHVEG VNP+RD+EII EELRLKD+E I+  +DKLEK   RGGDKKLKPE D M KV+  I D+K  VRF  DW   +I+VLN +LF+T+KP IYL+N+SE  Y++KKNKWL KIK WVD+ DP A +IPFS  +EL  Q+MS EE  +Y +E  T S L KI+KTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EGSE++VKA GKY+Q+GR Y VEDGDIIFFKFN      KK
Sbjct:    4 KKADDGPKQHPIIGRFGTSLKIGIVGLPNIGKV------------------------------------------------PAFLNVVDIAGLVKGASTGQGLGNAFLSNISACDGIFHLMRAFDDDDIIHVEGSVNPVRDIEIIHEELRLKDEEMIIAALDKLEKVAVRGGDKKLKPEYDIMCKVKNWIIDEKNHVRFYHDWNDKEIDVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPCALVIPFSGVLELNLQDMSDEEKHKYLQEKVTQSVLSKIVKTGYAALQLEYFFTAGPDEVRAWTIKKGTKAPQAAGKIHTDFEKGFIMAEVMKFDDFKEEGSESSVKAAGKYRQQGRNYTVEDGDIIFFKFNTPQQSKKK 348          
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Match: pcid2 (PCI domain containing 2 [Source:Xenbase;Acc:XB-GENE-964456])

HSP 1 Score: 64.3142 bits (155), Expect = 1.390e-10
Identity = 49/190 (25.79%), Postives = 85/190 (44.74%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKE----VDKLEKAFFRGGDKKLKPELDTMI 624
            M    G   ++ +L   +KT   VG+VG PN GKS+   +L+ ++ A   +PF T++P+   +                  R    ++V D  G++ GAH+  GLG AFL HI     +  +L      D+ H E    P   L  +  EL   +++ + +      +KL+    R   ++L+ E D+ +
Sbjct:  206 MMATPGQMGEERVLHLELKTMAHVGMVGFPNAGKSSLLRLLSNARPAVAAYPFTTLNPHVGIIKY----------------RDYVQIAVADTPGIIDGAHQNRGLGFAFLRHIERCRILLFVL------DLSHKE----PWAQLASLRYELEQYNEDLVQRPHVIVANKLDLPAARETLRRLRHETDSNV 369          
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:496681])

HSP 1 Score: 60.077 bits (144), Expect = 3.488e-9
Identity = 29/90 (32.22%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHI 405
            VG+VG PN GKS+  + ++ ++     + F T+ P   R+  PD +                 +SV D+ GL++GAH   G+G+ FL HI
Sbjct:  143 VGLVGFPNAGKSSLLSRISHAKPQVAEYAFTTVKPELGRIMYPDYK----------------QISVADLPGLIEGAHYNRGMGHKFLKHI 216          
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Match: Ola1 (Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:1914309])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 272/393 (69.21%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPILDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Match: Ola1 (Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:1914309])

HSP 1 Score: 326.635 bits (836), Expect = 1.489e-109
Identity = 157/234 (67.09%), Postives = 187/234 (79.91%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYV 771
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y+
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPILDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYI 237          
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Match: Ola1 (Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:1914309])

HSP 1 Score: 325.865 bits (834), Expect = 1.941e-109
Identity = 157/234 (67.09%), Postives = 187/234 (79.91%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYV 771
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y+
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPILDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYI 237          
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Match: Nrf1 (nuclear respiratory factor 1 [Source:MGI Symbol;Acc:MGI:1332235])

HSP 1 Score: 123.25 bits (308), Expect = 7.274e-30
Identity = 60/85 (70.59%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  994 GKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            G D V AWTI     APQAAGKIHTD  KGFIMAEVM  ED K E SENA KA GKYKQ+GR Y+VEDGDIIFFKFN+   L KK
Sbjct:  450 GPDGVHAWTISKAVTAPQAAGKIHTDFGKGFIMAEVMKDEDLKEESSENAAKAAGKYKQQGRAYVVEDGDIIFFKFNSPQQLKKK 534          
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Match: Nrf1 (nuclear respiratory factor 1 [Source:MGI Symbol;Acc:MGI:1332235])

HSP 1 Score: 123.25 bits (308), Expect = 7.274e-30
Identity = 60/85 (70.59%), Postives = 63/85 (74.12%), Query Frame = 1
Query:  994 GKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            G D V AWTI     APQAAGKIHTD  KGFIMAEVM  ED K E SENA KA GKYKQ+GR Y+VEDGDIIFFKFN+   L KK
Sbjct:  450 GPDGVHAWTISKAVTAPQAAGKIHTDFGKGFIMAEVMKDEDLKEESSENAAKAAGKYKQQGRAYVVEDGDIIFFKFNSPQQLKKK 534          
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Match: sp|Q5ZM25|OLA1_CHICK (Obg-like ATPase 1 OS=Gallus gallus OX=9031 GN=OLA1 PE=2 SV=1)

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 274/393 (69.72%), Postives = 317/393 (80.66%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGN+FLSHIN  D IFH++R FE +D+ HVEG V+P+RD+EII EELRLKD+E I + +DKLEK   RGGDKKLKPE D M K++  + D+KK VRF  DW   +I+VLN HLF T+KP IYL+N+SE  Y++KKNKWL KIK WVD+ DPGA +IPFS  +ELK Q+MS EE  +Y +EN T SALPKIIK GY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK  GSE AVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKAGDGVKAHPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDFLCQYHKPPSKIPAFLNVVDIAGLVKGAHTGQGLGNSFLSHINACDGIFHLMRAFEDDDITHVEGSVDPVRDIEIIHEELRLKDEELITQSIDKLEKVAVRGGDKKLKPEYDVMCKIKTWVIDEKKAVRFYHDWNDKEIDVLNKHLFFTSKPMIYLVNLSEKDYIRKKNKWLIKIKEWVDKHDPGALVIPFSGALELKLQDMSAEEKQKYLEENMTQSALPKIIKAGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEGGSEAAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Match: sp|Q9NTK5|OLA1_HUMAN (Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2)

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 272/393 (69.21%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Match: sp|Q9CZ30|OLA1_MOUSE (Obg-like ATPase 1 OS=Mus musculus OX=10090 GN=Ola1 PE=1 SV=1)

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 272/393 (69.21%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPILDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKDEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Match: sp|Q2HJ33|OLA1_BOVIN (Obg-like ATPase 1 OS=Bos taurus OX=9913 GN=OLA1 PE=2 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 269/393 (68.45%), Postives = 316/393 (80.41%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+P+RD+EII EEL+LKD+E +   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +EL+ Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPVRDIEIIHEELQLKDEEMVGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELRLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Match: sp|Q5R821|OLA1_PONAB (Obg-like ATPase 1 OS=Pongo abelii OX=9601 GN=OLA1 PE=2 SV=1)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 271/393 (68.96%), Postives = 315/393 (80.15%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KK GD  K   ++GR  T LK+GIVG+PNVGKSTFFNVLT SQA+AENFPFCTIDPNESRVPVPD+RFD LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFH+ R FE +D+ HVEG V+PIRD+EII EEL+LKD+E I   +DKLEK   RGGDKKLKPE D M KV+  + D KKPVRF  DW   +IEVLN HLF+T+KP +YL+N+SE  Y++KKNKWL KIK WVD++DPGA +IPFS  +ELK Q +S EE  +Y + N T SALPKIIK G+ ALQL+YFFT G +EV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM YEDFK EGSENAVKA GKY+Q+GR YIVEDGDIIFFKFN      KK
Sbjct:    4 KKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDSLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGFAALQLEYFFTAGPEEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK 396          
BLAST of Obg-like ATPase 1 vs. TrEMBL
Match: A0A4S2LIR9 (Obg-like ATPase 1 OS=Opisthorchis felineus OX=147828 GN=CRM22_006895 PE=3 SV=1)

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 290/395 (73.42%), Postives = 340/395 (86.08%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            MSKKK D PKK ++ GR+ T LK GIVGMPNVGKSTFFNVLTKS A AENFPFCTI+PNESRV VPD+RFDWLCE+H PLSR PA+L+VVDIAGLVKGAHEG GLGNAFLSHI GVDAIFHM+RVF+SED+ HVEGD+NPIRDL+I+ EELRLKD EYI+KE DK EK   RGGDKK  P  + + KV++++C+DK+ VRFGDW+P+++E+LN HLFITAKP +YLINMSE  ++KKKNKWL KIK WVD  DPGA+IIP S ++E+K   M+ EE++ + KE+G  S+LPKII+ GY+ LQLQYFFTCGKDEVKAWTIQ GTKAPQAAG+IH+DME+GFIMAEVM+Y DFK EGSE AVKA GKYKQ+GREY+VEDGDII FKFNAGAGLT+KK
Sbjct:    1 MSKKKTDLPKKAVIFGRVGTNLKCGIVGMPNVGKSTFFNVLTKSHAPAENFPFCTINPNESRVVVPDERFDWLCEYHKPLSRVPAHLNVVDIAGLVKGAHEGKGLGNAFLSHIRGVDAIFHMIRVFDSEDISHVEGDINPIRDLDIVEEELRLKDVEYIMKEWDKCEKVVVRGGDKKQMPVYECLTKVKELLCNDKRSVRFGDWLPSEVEILNEHLFITAKPVVYLINMSEKAFIKKKNKWLPKIKEWVDSNDPGAAIIPLSVELEMKMMEMTPEELEAFTKEHGIQSSLPKIIRIGYQTLQLQYFFTCGKDEVKAWTIQKGTKAPQAAGRIHSDMERGFIMAEVMSYNDFKAEGSEAAVKAAGKYKQKGREYVVEDGDIILFKFNAGAGLTQKK 395          
BLAST of Obg-like ATPase 1 vs. TrEMBL
Match: A0A1S8WX41 (Obg-like ATPase 1 OS=Opisthorchis viverrini OX=6198 GN=X801_05160 PE=3 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 291/395 (73.67%), Postives = 338/395 (85.57%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            MSKKK D PKK ++ GRI T LK GIVGMPNVGKSTFFNVLTKS A AENFPFCTI+PNESRV VPD+RFDWLCE+H PLSR PA+L+VVDIAGLVKGAHEG GLGNAFLSHI GVDAIFHM+RVF+SEDV HVEGD+NPIRDL+I+ EELRLKD EYI+KE DK EK   RGGDKK  P  + + KV+ ++C+DK+ VRFG+W+P+++E+LN HLFITAKP +YLINMSE  ++KKKNKWL KIK WVD  DPGASIIP S ++E+K   MS +E++ + KE+G  S+LPKII+ GY+ LQLQYFFTCGKDEVKAWTIQ GTKAPQAAG+IH+DME+GFIMAEVM+Y DFK EG E AVKA GKYKQ+GREY+VEDGDII FKFNAGAGLT+KK
Sbjct:    1 MSKKKTDLPKKAVIFGRIGTNLKCGIVGMPNVGKSTFFNVLTKSHAPAENFPFCTINPNESRVVVPDERFDWLCEYHKPLSRVPAHLNVVDIAGLVKGAHEGKGLGNAFLSHIRGVDAIFHMIRVFDSEDVSHVEGDINPIRDLDIVEEELRLKDVEYIMKEWDKCEKVVIRGGDKKQMPVYECLTKVKDLLCNDKRSVRFGEWLPSEVEILNEHLFITAKPVVYLINMSEKAFIKKKNKWLPKIKEWVDSNDPGASIIPLSVELEVKMAEMSPDELEAFTKEHGIQSSLPKIIRIGYQTLQLQYFFTCGKDEVKAWTIQKGTKAPQAAGRIHSDMERGFIMAEVMSYNDFKAEGCEAAVKAAGKYKQKGREYVVEDGDIILFKFNAGAGLTQKK 395          
BLAST of Obg-like ATPase 1 vs. TrEMBL
Match: A0A3R7F2C1 (Obg-like ATPase 1 OS=Clonorchis sinensis OX=79923 GN=CSKR_13842s PE=3 SV=1)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 289/403 (71.71%), Postives = 340/403 (84.37%), Query Frame = 1
Query:   43 SLLLTSFKMSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            S+L T   +   K D PKK ++ GR+ T LK GIVGMPNVGKSTFFNVLTKS A AENFPFCTI+PNESRV VPD+RFDWLCE+H PLSR PA+L+VVDIAGLVKGAHEG GLGNAFLSHI GVDAIFHM+RVFESED+ HVEGD+NPIRDL+I+ EELRLKD EYI+KE DK EK   RGGDKK  P  + + KV+ ++C+DK+ VRFGDW+P+++E+LN HLFITAKP +YLINMSE  ++KKKNKWL KIK WVD  DPGA+IIP S ++E++   M+ EE++ + KE+G  S+LPKII+ GY+ LQLQYFFTCGKDEVKAWTIQ GTKAPQAAG+IH+DME+GFIMAEVM+Y DFK EGSE AVKA GKYKQ+GREY+VEDGDII FKFNAGAGLT+KK
Sbjct:  152 SVLNTDVMLLMMKADLPKKAVIFGRVGTNLKCGIVGMPNVGKSTFFNVLTKSHAPAENFPFCTINPNESRVVVPDERFDWLCEYHKPLSRVPAHLNVVDIAGLVKGAHEGKGLGNAFLSHIRGVDAIFHMIRVFESEDISHVEGDINPIRDLDIVEEELRLKDVEYIMKEWDKCEKVVIRGGDKKQMPVYECLTKVKDLLCNDKRSVRFGDWLPSEVEILNEHLFITAKPVVYLINMSEKAFIKKKNKWLPKIKEWVDSNDPGAAIIPLSVELEMRMTEMTPEELEAFTKEHGIQSSLPKIIRIGYQTLQLQYFFTCGKDEVKAWTIQKGTKAPQAAGRIHSDMERGFIMAEVMSYNDFKAEGSEAAVKAAGKYKQKGREYVVEDGDIILFKFNAGAGLTQKK 554          
BLAST of Obg-like ATPase 1 vs. TrEMBL
Match: G4VSL7 (Obg-like ATPase 1 OS=Schistosoma mansoni OX=6183 GN=Smp_015720 PE=3 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 289/395 (73.16%), Postives = 333/395 (84.30%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            MSKKKGD PKKT+LLGRI T LK G+VG+PNVGKSTFFN+LTKSQ  AENFPFCTI+PNESRV VPD+RFDWLCE+H P+SR PAYL+VVDIAGLVKGAHEG GLGNAFLSHI GVDAIFHMLR+FE+ED+ H+EGD++P+RDL+II EELRLKD EY+ KE +K EK   RG DKK  P  + + KV+ ++ +DK+ VRFGDW P ++E+LN HLFIT+KP IYL+NMSE  ++KKK+KWL KIK WVDE D GA+IIPFSAD+E K   MS EE   Y KEN   + LPKII+ GY+ LQL YFFTCGKDEVKAWTIQ G+KAPQAAG+IHTDMEKGFIMAEVM+YEDFKTEGSE AVKA GKYKQ+GREY+VEDGDII FKFNAGAGL  KK
Sbjct:    1 MSKKKGDVPKKTVLLGRIGTNLKCGVVGLPNVGKSTFFNILTKSQVPAENFPFCTINPNESRVAVPDERFDWLCEYHQPVSRVPAYLNVVDIAGLVKGAHEGQGLGNAFLSHIRGVDAIFHMLRLFENEDITHIEGDIDPVRDLDIIDEELRLKDIEYVTKEWEKCEKVVIRGNDKKQMPAYECLTKVKNMLINDKRNVRFGDWNPTEVEILNEHLFITSKPVIYLVNMSEKAFLKKKSKWLPKIKEWVDEHDSGAAIIPFSADLEQKLSEMSPEEATAYMKENEFTTMLPKIIRVGYQTLQLHYFFTCGKDEVKAWTIQKGSKAPQAAGRIHTDMEKGFIMAEVMSYEDFKTEGSEAAVKAAGKYKQKGREYVVEDGDIILFKFNAGAGLQAKK 395          
BLAST of Obg-like ATPase 1 vs. TrEMBL
Match: A0A094ZWH4 (Obg-like ATPase 1 OS=Schistosoma haematobium OX=6185 GN=MS3_05870 PE=3 SV=1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 288/395 (72.91%), Postives = 331/395 (83.80%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            MSKKKGD PKK +LLGRI T LK G+VG+PNVGKSTFFN+LTKSQ  AENFPFCTI+PNESRV VPD+RFDWLCE+H P+SR PAYL+VVDIAGLVKGAHEG GLGNAFLSHI  VDAIFHMLR+FE+ED+ H+EGD++P+RDL+II EELRLKD EY+ KE +K EK   RG DKK  P  + + KV+ ++ +DK+ VRFGDW P ++E+LN HLFIT+KP IYL+NMSE  ++KKK+KWL KIK WVDE D GA+IIPFSAD+E K   MS EE   Y KEN   + LPKII+ GY+ LQLQYFFTCGKDEVKAWTIQ G+KAPQAAG+IHTDMEKGFIMAEVM+YEDFK EGSE AVKA GKYKQ+GREYIVEDGDII FKFNAGAGL  KK
Sbjct:    1 MSKKKGDVPKKAVLLGRIGTNLKCGVVGLPNVGKSTFFNILTKSQVPAENFPFCTINPNESRVAVPDERFDWLCEYHQPVSRVPAYLNVVDIAGLVKGAHEGQGLGNAFLSHIRSVDAIFHMLRLFENEDITHIEGDIDPVRDLDIIDEELRLKDIEYVTKEWEKCEKVVIRGNDKKQMPAYECLTKVKNMLVNDKRNVRFGDWTPTEVEILNEHLFITSKPVIYLVNMSEKAFLKKKSKWLPKIKEWVDEHDSGAAIIPFSADLEQKLSEMSPEEAGAYMKENEFTTMLPKIIRIGYQTLQLQYFFTCGKDEVKAWTIQKGSKAPQAAGRIHTDMEKGFIMAEVMSYEDFKAEGSEAAVKAAGKYKQKGREYIVEDGDIILFKFNAGAGLQAKK 395          
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Match: ola1 (Obg like ATPase 1 [Source:NCBI gene;Acc:103043206])

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 264/386 (68.39%), Postives = 313/386 (81.09%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNA 1227
            KK GD PK   L+GR  T LK+GIVG+PNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVP+PD+RFD+LC++H P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D+IFHM R FE ED+IHVEG V+P+RD+EII EELRLKD+E I   +DKLEK   RGGDKKLKPE D M K++  + ++KK VR + +W   +IEVLN +LF+T+KP IYL+N+SE  Y++KKNKWL KIK W+D  DPGA +IPFS   E K+Q+MS EE  ++ +E+ T S L KIIK+GY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM + DFK EGSE A KA GKY+Q+GR YIVEDGDIIFFKFN 
Sbjct:    4 KKAGDGPKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPIPDERFDFLCQYHKPASKVPAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACDSIFHMTRAFEDEDIIHVEGCVDPVRDIEIIHEELRLKDEEMIGPIIDKLEKTAVRGGDKKLKPEYDIMCKIKSWVIEEKKHVRYYHEWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLVKIKEWIDAHDPGALVIPFSGGFESKYQDMSDEEKQKFCEESKTQSVLTKIIKSGYAALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFVDFKEEGSETAAKAAGKYRQQGRNYIVEDGDIIFFKFNT 389          
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Match: mtg2 (mitochondrial ribosome associated GTPase 2 [Source:NCBI gene;Acc:103039230])

HSP 1 Score: 63.1586 bits (152), Expect = 2.306e-10
Identity = 34/113 (30.09%), Postives = 55/113 (48.67%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHI 405
            M+   G+  +  +L   ++T    G+VG PN GKS+    ++ ++ A  ++PF T+ P+   +   D                   L+V DI GL++GAH   GLG +FL HI
Sbjct:  201 MTATPGEPGEDRVLQLELRTMAHAGLVGFPNAGKSSLLRAISNARPAVASYPFTTLSPHVGIINYRDHE----------------QLAVADIPGLIRGAHLNRGLGVSFLRHI 297          
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Match: gtpbp10 (GTP-binding protein 10 (putative) [Source:NCBI gene;Acc:436727])

HSP 1 Score: 57.7658 bits (138), Expect = 1.172e-8
Identity = 28/90 (31.11%), Postives = 45/90 (50.00%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHI 405
            +G+VG PN GKS+    L+ +     ++PF T+ P   +V   D +                 +SV D+ GL++GAH   G+G+ FL H+
Sbjct:  170 LGLVGFPNAGKSSLLTALSHATPQIASYPFTTLRPEIGKVMYEDHK----------------QVSVADLPGLIEGAHMNRGMGHKFLKHV 243          
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 49.6766 bits (117), Expect = 3.217e-6
Identity = 26/107 (24.30%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  133 KVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESE 453
            +V ++G P+VGKSTF +++T +++ A ++ F T+    + +P               +  + A + ++D+ G+++GA +G G G   ++     D +  ML   + E
Sbjct:   64 RVALIGFPSVGKSTFLSLMTSTESEAASYEFTTL----TCIP-------------GVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADVVIMMLDATKGE 153          
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Match: drg2 (developmentally regulated GTP binding protein 2 [Source:NCBI gene;Acc:103036155])

HSP 1 Score: 49.6766 bits (117), Expect = 3.720e-6
Identity = 26/107 (24.30%), Postives = 55/107 (51.40%), Query Frame = 1
Query:  133 KVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESE 453
            +V ++G P+VGKSTF +++T +++ A ++ F T+    + +P               +  + A + ++D+ G+++GA +G G G   ++     D +  ML   + E
Sbjct:   64 RVALIGFPSVGKSTFLSLMTSTESEAASYEFTTL----TCIP-------------GVIEYKGANIQLLDLPGIIEGAAQGKGRGRQVIAVARTADVVIMMLDATKGE 153          
BLAST of Obg-like ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008922.1 (pep scaffold:Pmarinus_7.0:GL476670:52803:99208:-1 gene:ENSPMAG00000008073.1 transcript:ENSPMAT00000008922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 245.743 bits (626), Expect = 7.471e-80
Identity = 130/210 (61.90%), Postives = 162/210 (77.14%), Query Frame = 1
Query:  442 FESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFG-DWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHT 1068
            F+ +D++HVEG V+P+RD+EII +ELRLKD+E I   +DKLEK   RG DKKLKPE D M K++  + D+KK +RF  DW   +IEVLN HL +T+KP +YL+N+SE  Y++KKNKWL KIK WVD+ DPGA +IPFS  +ELK Q M+ EE ++Y  E  T SAL KIIKTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHT
Sbjct:    2 FDDDDIVHVEGSVDPVRDIEIIHDELRLKDEELIAPILDKLEKVAVRGNDKKLKPEYDIMCKIKSWVVDEKKHIRFHPDWNDKEIEVLNKHLLLTSKPMVYLVNLSEKDYIRKKNKWLIKIKEWVDKNDPGAVLIPFSGALELKLQEMTDEEKEKYLTEVKTTSALTKIIKTGYAALQLEYFFTAGSDEVRAWTIRKGTKAPQAAGKIHT 211          
BLAST of Obg-like ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005006.1 (pep scaffold:Pmarinus_7.0:GL484587:200353:203019:1 gene:ENSPMAG00000004552.1 transcript:ENSPMAT00000005006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 8.532e-35
Identity = 55/79 (69.62%), Postives = 68/79 (86.08%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNP 303
            M+ KK ++ K   ++GR  T LK+GIVG+PNVGKSTFFNVLTKSQA+AENFPFCTIDPNESRVP+PD R+D+LC++H P
Sbjct:    1 MAPKKAED-KPMPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSQASAENFPFCTIDPNESRVPIPDPRYDFLCQYHKP 78          
BLAST of Obg-like ATPase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004440.1 (pep scaffold:Pmarinus_7.0:GL476640:93137:105923:-1 gene:ENSPMAG00000004034.1 transcript:ENSPMAT00000004440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 7.168e-10
Identity = 31/103 (30.10%), Postives = 50/103 (48.54%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVF 444
            VG++G PN GKST    L+ ++    ++PF T+ P    +   D R                 +SV D+ GL++GAH   G+G+ FL H+     +  ++ VF
Sbjct:  151 VGLIGFPNAGKSTLLEKLSSAKPKIADYPFTTLCPQIGTMMFQDHR----------------QISVADLPGLIEGAHANKGMGHHFLKHVQRNKILLFVVDVF 237          
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Match: OLA1 (P-loop ATPase with similarity to human OLA1 and bacterial YchF; identified as specifically interacting with the proteasome; null mutant displays increased translation rate and increased readthrough of premature stop codons; protein abundance increases in response to hydrogen peroxide and to DNA replication stress [Source:SGD;Acc:S000000229])

HSP 1 Score: 363.999 bits (933), Expect = 1.545e-123
Identity = 201/394 (51.02%), Postives = 266/394 (67.51%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAA-AENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQ-PAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGD----KKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAG 1230
            M  KK  E KK +LLGR    LK GIVG+ NVGKSTFF  +T+       N+PF TIDP E+RV VP  RFD LCE +   + + PA+L+V DIAGL KGA  G GLGNAFLSHI  VD+I+ ++R F+  ++IHVEGDV+P+RDLEII +ELRLKD E+  K ++  EK   RGG     K+ K E+D + K+ K++ +  + V    W   ++E++N    +TAKP IYLIN+SE  Y++KKNK L +IK WVD++ PG  IIPFS  +E +  +MS E+ ++  K+  T SALPKII T  + L L  FFTCG DEV+ WTI+ GTKAPQAAG IH D+   FI+A+VM  ED      ++A+KA GK  Q+G++Y+VEDGDII+F+  AG
Sbjct:    1 MPPKKQVEEKK-VLLGRPGNNLKAGIVGLANVGKSTFFQAITRCPLGNPANYPFATIDPEEARVIVPSPRFDKLCEIYKKTASEVPAHLTVYDIAGLTKGASAGEGLGNAFLSHIRSVDSIYQVVRCFDDAEIIHVEGDVDPVRDLEIINQELRLKDIEFAQKALEGAEKIAKRGGQSLEVKQKKEEMDLITKIIKLL-ESGQRVANHSWTSKEVEIINSMFLLTAKPCIYLINLSERDYIRKKNKHLLRIKEWVDKYSPGDLIIPFSVSLEERLSHMSPEDAEEELKKLQTISALPKIITTMRQKLDLISFFTCGPDEVREWTIRRGTKAPQAAGVIHNDLMNTFILAQVMKCEDVFEYKDDSAIKAAGKLMQKGKDYVVEDGDIIYFRAGAG 392          
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Match: YLF2 (Protein of unknown function; has weak similarity to E. coli GTP-binding protein gtp1; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000001006])

HSP 1 Score: 253.062 bits (645), Expect = 3.636e-80
Identity = 151/399 (37.84%), Postives = 234/399 (58.65%), Query Frame = 1
Query:  106 LLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAA-AENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGD-----KKLKPELDTMIKVRKIICDDKKPVRFGD-WVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIE---LKFQNMSQEEIDQYAKENGTG-----SALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEG---SENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            LLGRI      GIVG+ NVGKSTFF  +T S+     N+PF TID   ++V +P      L   +      P  L++ DIAGL +GA +GHGLGN FL+ I  V+ IF ++R F  ED+ H+EG+V+P+RDL ++ +EL LKD E++    ++L K            +++K E + +  + + + + KK   F D W  +++++LN H F+T+KP++ L+N+S   YV+ +NK++  I  W++EF PG   + FSA+ E   ++ + ++ E  D+  ++         SA+P+II    K L L  FFTCG  EV  W I+ GT A +AAG IH+D+ + FI A+V+ Y+D K      +E+ +K+ G  K+ G++YI++D DI  FK  A  G  KK
Sbjct:    9 LLGRISNNPTSGIVGLANVGKSTFFQAITNSKLGNPANYPFATIDAECAKVNIPSVPLSNLLRIYQSAKCVPGTLTIYDIAGLTRGASQGHGLGNKFLNDIRHVEGIFQVVRGFLKEDITHIEGNVDPVRDLSVVQDELILKDLEFLENIRERLSKKMRMVSKNSKEHQEMKIETELLDALEEHLFNGKKIRHFKDHWNLDEVKILNKHNFLTSKPTLILLNVSPQDYVRNENKFVRNIIEWINEFSPGDKFLLFSAEFESQLMECKGIASEYFDKIKEDTNVSDQQLVSAIPQIILEMRKLLNLISFFTCGPQEVHQWNIREGTTAQEAAGVIHSDLRETFISADVIKYDDLKKMEPPLNESLLKSKGLIKRAGKQYIMQDNDIALFK--AAGGKIKK 405          
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Match: YGR210C_mRNA (Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm [Source:SGD;Acc:S000003442])

HSP 1 Score: 85.1149 bits (209), Expect = 1.912e-18
Identity = 55/143 (38.46%), Postives = 82/143 (57.34%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNES----RVPVPDDRF--DWLCE-FHNPLSRQPAYLSV--VDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGD----VNPIRDLEIITEELRL 525
            +GIVG P+ GKST  N LT + AA   FPF TI+PN++    +V     RF  + LC+  +   S+   ++ +  +D+AGLV GAH G GLGN FL  +   DA+ H++ V  + D    EG      +P+ D+E + +E+RL
Sbjct:    7 IGIVGKPSSGKSTTLNSLTDAGAAVGAFPFTTIEPNQATGYLQVECACSRFGKEDLCKPNYGWCSKGKRHIPIKLLDVAGLVPGAHSGRGLGNKFLDDLRHADALIHVVDVSGTTD---AEGKNTRGYDPLNDIEWLQDEIRL 146          
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Match: MTG2 (Putative GTPase; member of the Obg family; peripheral protein of the mitochondrial inner membrane that associates with the large ribosomal subunit; required for mitochondrial translation, possibly via a role in ribosome assembly [Source:SGD;Acc:S000001211])

HSP 1 Score: 53.1434 bits (126), Expect = 5.703e-8
Identity = 35/138 (25.36%), Postives = 62/138 (44.93%), Query Frame = 1
Query:  106 LLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEEL 519
             L  +K+   +G++G+PN GKST  N ++ ++    ++ F T+ P    V                L       +V DI G+++GA    G+G  FL HI   +    +L +           + NP+ DL+++ EE+
Sbjct:  332 FLFELKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTV---------------SLGFGQDVFTVADIPGIIQGASLDKGMGLEFLRHIERSNGWVFVLDL----------SNKNPLNDLQLLIEEV 444          
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Match: RBG1 (Member of the DRG family of GTP-binding proteins; associates with translating ribosomes; interacts with Tma46p, Ygr250cp, Gir2p and Yap1p via two-hybrid [Source:SGD;Acc:S000000034])

HSP 1 Score: 47.7506 bits (112), Expect = 2.265e-6
Identity = 38/135 (28.15%), Postives = 64/135 (47.41%), Query Frame = 1
Query:  121 KTGL-KVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVN-PIRDLEIITEEL 519
            +TG+  VG VG P+VGKST  + LT +++ A  + F T+      V VP             +  + A + ++D+ G++ GA +G G G   ++     + +F +L             DVN P+   +II +EL
Sbjct:   62 RTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTL------VTVP-----------GVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIIL-------------DVNKPLHHKQIIEKEL 166          
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Match: EDO42940 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S018])

HSP 1 Score: 500.745 bits (1288), Expect = 6.198e-177
Identity = 252/382 (65.97%), Postives = 303/382 (79.32%), Query Frame = 1
Query:  106 LLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            L+GR  T LK GIVG+PNVGKSTFFNVLTKS A+AENFPFCTI      VPVPD+R+D+LC++H P S+ PA+L+VVDIAGLVKGA EG GLGNAFLSHI   DAIFH++R FE EDV HVEGDVNP+RDLEII+EELR KD+E++   V+ +EK   RGGDKK   EL+ M K+   + ++KK +RFG W  N++EVLN HL +T+KP IYL+N+SE  Y++KKNKWL KIK WVD  D GA+IIPFS ++E K  ++ +EE ++Y KE+ T SAL KII  G+KALQLQYFFTCG DEVKAWTI  GTKAP AAGKIHTD EKGFIMAEVM Y+DFK  GSE A K+ GKY+Q G+ Y+V+DGDIIFFKFNAGAGL+ KK
Sbjct:   14 LMGRFGTSLKCGIVGIPNVGKSTFFNVLTKSAASAENFPFCTI------VPVPDERWDFLCKYHQPASKVPAFLNVVDIAGLVKGASEGQGLGNAFLSHIWACDAIFHLVRAFEGEDVTHVEGDVNPVRDLEIISEELRKKDEEFLTDRVNGMEKTVVRGGDKKRMGELEIMKKLLHWVAEEKKDLRFGTWNANEVEVLNKHLLLTSKPCIYLVNLSERDYIRKKNKWLVKIKEWVDSRDKGAAIIPFSGELEAKLVDLGEEEAEKYCKEHNTSSALSKIITLGFKALQLQYFFTCGPDEVKAWTIVKGTKAPGAAGKIHTDFEKGFIMAEVMKYDDFKECGSEAACKSAGKYRQEGKNYVVQDGDIIFFKFNAGAGLSDKK 389          
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Match: EDO29246 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T467])

HSP 1 Score: 71.2478 bits (173), Expect = 1.078e-13
Identity = 42/134 (31.34%), Postives = 66/134 (49.25%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQE 537
            VG++GMPN GKSTF   ++ ++    ++PF T+ PN   V V  ++                   V DI GL++GA EG GLG+ FL H+     + H++      D+   +  V+P+   + I  EL+  D E
Sbjct:  138 VGLLGMPNAGKSTFIAAVSNARPKIADYPFTTLHPNLGVVRVAAEQ----------------SFVVADIPGLIEGASEGAGLGHQFLRHLQRTRLLLHVV------DLAPFDDSVDPVAQAKAIVGELQKYDAE 249          
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Match: EDO47469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA4])

HSP 1 Score: 70.4774 bits (171), Expect = 2.611e-13
Identity = 49/152 (32.24%), Postives = 79/152 (51.97%), Query Frame = 1
Query:  142 IVGMPNVGKSTFFNVLTK-SQAAAENFPFCTIDPNESR----VPVPDDRFDWLCEF-HNPLSRQPAYLSVV--DIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVF-ESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEK 570
            ++G P+ GKSTFFN  T+ ++A   + PF TI+PN  R    +P P       C   +        Y+ V+  D+AGLV GA EG G GN F++ +   D + H++    E+++      D +P +D+E + EEL     + I+ + D + K
Sbjct:    1 LLGKPSAGKSTFFNAATQQNRARVASHPFTTIEPNIGRGFYAIPCPCGTLSKQCNAAYGHADNGDRYVPVILKDVAGLVPGACEGRGKGNKFMNDLLDADVLIHVIDASGETDENGKETSDYDPSQDVEWLYEELHRWIADNIMDKWDAICK 152          
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Match: EDO46414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ12])

HSP 1 Score: 62.003 bits (149), Expect = 1.528e-10
Identity = 40/147 (27.21%), Postives = 71/147 (48.30%), Query Frame = 1
Query:  118 IKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVD 558
            +KT   VG+VG PN GKST    ++++      +PF T++P+   V   D                 + ++V DI GL+  AH   GLG+ FL HI    ++ ++L +  S+   H +  ++  R+LE+  + L  +    +  ++D
Sbjct:  186 LKTIADVGLVGFPNAGKSTLLRAISRATPTVAAYPFTTLNPSVGMVEYDDF----------------SQIAVADIPGLIPDAHLNKGLGHTFLRHIERCCSLLYVLDI--SQKDFHSQ-FISLQRELELYKKGLSSRPAAIVANKID 313          
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Match: EDO45794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRP0])

HSP 1 Score: 60.077 bits (144), Expect = 4.682e-10
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 1
Query:  118 IKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGV 414
            +K    VG+VG PN GKST   +LT++     ++PF T+ P    +   DD                + +SV D+ GLV+GAH   G+ + FL H+ G 
Sbjct:  129 LKLAADVGLVGFPNAGKSTLLGMLTQADPTVADYPFTTLRPVIGMLGQHDD----------------SQISVADLPGLVEGAHLNRGMVHKFLKHVEGT 211          
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Match: OLA1 (Obg like ATPase 1 [Source:NCBI gene;Acc:101161102])

HSP 1 Score: 530.406 bits (1365), Expect = 0.000e+0
Identity = 269/391 (68.80%), Postives = 316/391 (80.82%), Query Frame = 1
Query:   79 KGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            KGD  K   L+GR  T LK+GIVG+PNVGKSTFFNVLTKS+AAAENFPFCTIDPNESRVP+PD+R+D+LC+FH P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M K++  + D+KK VR + DW   +IEVLN  LF+T+KP IYL+N+SE  Y+++KNKWL KIK WVD  DPGA +IPFS ++E K Q+MS+EE  +Y  E  T SAL KIIKTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EGSE+AVKA GKY+Q+GR YIVEDGDIIFFKFNA     KK
Sbjct:    4 KGDALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSEAAAENFPFCTIDPNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACDGIFHMTRAFEDEDIIHVEGTVDPVRDMEIIHEELRMKDEEMISPIIDKLEKTAIRGGDKKLKPEYDIMCKIKGWVVDEKKHVRYYPDWNDKEIEVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESKLQDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVKAAGKYRQQGRNYIVEDGDIIFFKFNAPNAPKKK 394          
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Match: OLA1 (Obg like ATPase 1 [Source:NCBI gene;Acc:101161102])

HSP 1 Score: 487.263 bits (1253), Expect = 9.351e-170
Identity = 250/371 (67.39%), Postives = 295/371 (79.51%), Query Frame = 1
Query:   73 KKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGRE 1182
            K KGD  K   L+GR  T LK+GIVG+PNVGKSTFFNVLTKS+AAAENFPFCTIDPNESRVP+PD+R+D+LC+FH P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M K++  + D+KK VR + DW   +IEVLN  LF+T+KP IYL+N+SE  Y+++KNKWL KIK WVD  DPGA +IPFS ++E K Q+MS+EE  +Y  E  T SAL KIIKTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EGSE+AVK V     RG E
Sbjct:    5 KAKGDALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSEAAAENFPFCTIDPNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACDGIFHMTRAFEDEDIIHVEGTVDPVRDMEIIHEELRMKDEEMISPIIDKLEKTAIRGGDKKLKPEYDIMCKIKGWVVDEKKHVRYYPDWNDKEIEVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESKLQDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVK-VSSQSARGDE 374          
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Match: OLA1 (Obg like ATPase 1 [Source:NCBI gene;Acc:101161102])

HSP 1 Score: 485.723 bits (1249), Expect = 3.937e-169
Identity = 249/369 (67.48%), Postives = 294/369 (79.67%), Query Frame = 1
Query:   79 KGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR-FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGRE 1182
            KGD  K   L+GR  T LK+GIVG+PNVGKSTFFNVLTKS+AAAENFPFCTIDPNESRVP+PD+R+D+LC+FH P S+ PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  D IFHM R FE ED+IHVEG V+P+RD+EII EELR+KD+E I   +DKLEK   RGGDKKLKPE D M K++  + D+KK VR + DW   +IEVLN  LF+T+KP IYL+N+SE  Y+++KNKWL KIK WVD  DPGA +IPFS ++E K Q+MS+EE  +Y  E  T SAL KIIKTGY ALQL+YFFT G DEV+AWTI+ GTKAPQAAGKIHTD EKGFIMAEVM ++DFK EGSE+AVK V     RG E
Sbjct:    6 KGDALKPPPLIGRFGTSLKIGIVGLPNVGKSTFFNVLTKSEAAAENFPFCTIDPNESRVPIPDERYDFLCQFHKPASKVPAFLNVVDIAGLVKGAHVGQGLGNAFLSHISACDGIFHMTRAFEDEDIIHVEGTVDPVRDMEIIHEELRMKDEEMISPIIDKLEKTAIRGGDKKLKPEYDIMCKIKGWVVDEKKHVRYYPDWNDKEIEVLNKFLFLTSKPMIYLVNLSERDYIRRKNKWLVKIKEWVDSHDPGALVIPFSGNLESKLQDMSEEERHKYCTEQKTQSALNKIIKTGYAALQLEYFFTTGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKFQDFKEEGSESAVK-VSSQSARGDE 373          
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Match: ola1 (obg-like ATPase 1 [Source:NCBI gene;Acc:105356914])

HSP 1 Score: 415.231 bits (1066), Expect = 1.726e-143
Identity = 228/395 (57.72%), Postives = 271/395 (68.61%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRF-GDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKK 1248
            M  KK + PK+  L+GR  T LK+GIVG+PNVGK                                                 PA+L+VVDIAGLVKGAH G GLGNAFLSHI+  DAIFHM R F+ ED++HVEG+V+P+RD+EII EELRLKD+E I   +DKLEK   RGGDKKLKPE D M+KV+  + D+KK VRF  DW   +IEVLN +LF+T+KP IYL+N+SE  Y++KKNKWL+KIK WVD  DPGA +IP S  +E K  +M +E+ D+Y +E  T S L KIIKTGY ALQL+YFFT G DEV+AWTI+ G KAPQAAGKIHTD EKGFIMAEVM Y DFK EGSE+AVKA GKY+Q+GR Y VEDGDIIFFKFN      KK
Sbjct:    1 MPPKKTEAPKQPPLIGRFGTSLKIGIVGLPNVGKV------------------------------------------------PAFLNVVDIAGLVKGAHAGQGLGNAFLSHISACDAIFHMTRAFDDEDIVHVEGNVDPVRDIEIIHEELRLKDEEMIAPIIDKLEKTAVRGGDKKLKPEYDIMMKVKNWVVDEKKHVRFYHDWNDKEIEVLNKYLFLTSKPMIYLVNLSEKDYIRKKNKWLAKIKEWVDVHDPGAMVIPLSGALESKLLDMEEEDRDKYCEEQKTQSVLTKIIKTGYAALQLEYFFTAGPDEVRAWTIRKGAKAPQAAGKIHTDFEKGFIMAEVMKYSDFKEEGSESAVKAAGKYRQQGRNYTVEDGDIIFFKFNTPNAPKKK 347          
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Match: mtg2 (mitochondrial ribosome associated GTPase 2 [Source:NCBI gene;Acc:101155109])

HSP 1 Score: 60.8474 bits (146), Expect = 1.136e-9
Identity = 32/113 (28.32%), Postives = 56/113 (49.56%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHI 405
            M+   G + ++ +L   ++T    G++G PN GKS+    ++ ++ A   +PF T++P+   V   D                   ++V DI G+++GAH   GLG +FL HI
Sbjct:  220 MTATPGMDGQERVLQLELRTMAHAGLIGFPNAGKSSLLRAISNARPAVAAYPFTTLNPHVGIVQYRDHE----------------QVAVADIPGIIRGAHLNRGLGISFLRHI 316          
BLAST of Obg-like ATPase 1 vs. Planmine SMEST
Match: SMESG000061866.1 (SMESG000061866.1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 395/395 (100.00%), Postives = 395/395 (100.00%), Query Frame = 1
Query:   67 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVXXXXXXXXXXXXXVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 1251
            MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVKKKNKWLSKIKSWVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK
Sbjct:    1 MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEELRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVRFGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVKKKNKWLSKIKSWVDEFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKALQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYEDFKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK 395          
BLAST of Obg-like ATPase 1 vs. Planmine SMEST
Match: SMESG000039624.1 (SMESG000039624.1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.606e-10
Identity = 29/103 (28.16%), Postives = 52/103 (50.49%), Query Frame = 1
Query:  136 VGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHMLRVF 444
            +G+VG PN GKS+F N ++       N+PF TI P  + +  PD R                 +++ D+ G+++GAH   G+G+ FL H+     +  ++ ++
Sbjct:  147 IGLVGFPNAGKSSFLNGISGMSVKVANYPFTTITPQVATIKYPDYR----------------AITIADLPGIIEGAHVNVGVGHHFLKHVERTKLLLFVVDIY 233          
BLAST of Obg-like ATPase 1 vs. Planmine SMEST
Match: SMESG000025280.1 (SMESG000025280.1)

HSP 1 Score: 49.2914 bits (116), Expect = 4.101e-6
Identity = 26/101 (25.74%), Postives = 52/101 (51.49%), Query Frame = 1
Query:  133 KVGIVGMPNVGKSTFFNVLTKSQAAAENFPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAHEGHGLGNAFLSHINGVDAIFHML 435
            +V ++G P+VGKST  ++LTK+++   ++ F T+    + +P               +  + A + ++D+ G+++GA +G G G   ++     D I  ML
Sbjct:   64 RVALIGFPSVGKSTLLSMLTKTESETASYEFTTL----TCIP-------------GVIEYKGANIQLLDLPGIIEGASQGKGRGRQVIAVARTADLILMML 147          
The following BLAST results are available for this feature:
BLAST of Obg-like ATPase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OLA10.000e+069.21Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:288... [more]
OLA10.000e+069.21Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:288... [more]
OLA11.383e-10967.09Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:288... [more]
OLA11.703e-10068.67Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:288... [more]
OLA17.254e-5575.00Obg like ATPase 1 [Source:HGNC Symbol;Acc:HGNC:288... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ola-17.016e-16662.03Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
ola-17.016e-16662.03Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
ola-13.272e-4966.13Obg-like ATPase 1 [Source:UniProtKB/Swiss-Prot;Ac... [more]
M01E5.24.172e-827.12pep chromosome:WBcel235:I:13277300:13280175:-1 gen... [more]
M01E5.24.172e-827.12pep chromosome:WBcel235:I:13277061:13280175:-1 gen... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG13540.000e+066.08gene:FBgn0030151 transcript:FBtr0474138[more]
CG13540.000e+066.08gene:FBgn0030151 transcript:FBtr0089385[more]
CG13540.000e+066.08gene:FBgn0030151 transcript:FBtr0089383[more]
CG13540.000e+066.08gene:FBgn0030151 transcript:FBtr0089384[more]
CG13540.000e+066.08gene:FBgn0030151 transcript:FBtr0336922[more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ola10.000e+069.43Obg-like ATPase 1 [Source:NCBI gene;Acc:326864][more]
ola12.209e-14259.07Obg-like ATPase 1 [Source:NCBI gene;Acc:326864][more]
ola17.120e-11268.38Obg-like ATPase 1 [Source:NCBI gene;Acc:326864][more]
CABZ01035356.12.076e-6175.00obg-like ATPase 1 [Source:NCBI gene;Acc:110438478][more]
mtg29.892e-1128.46mitochondrial ribosome-associated GTPase 2 [Source... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgals20.000e+066.41lectin, galactoside binding soluble 2 [Source:Xenb... [more]
lgals22.088e-16166.38lectin, galactoside binding soluble 2 [Source:Xenb... [more]
lgals21.579e-13856.49lectin, galactoside binding soluble 2 [Source:Xenb... [more]
pcid21.390e-1025.79PCI domain containing 2 [Source:Xenbase;Acc:XB-GEN... [more]
gtpbp103.488e-932.22GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ola10.000e+069.21Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:19143... [more]
Ola11.489e-10967.09Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:19143... [more]
Ola11.941e-10967.09Obg-like ATPase 1 [Source:MGI Symbol;Acc:MGI:19143... [more]
Nrf17.274e-3070.59nuclear respiratory factor 1 [Source:MGI Symbol;Ac... [more]
Nrf17.274e-3070.59nuclear respiratory factor 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Obg-like ATPase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZM25|OLA1_CHICK0.000e+069.72Obg-like ATPase 1 OS=Gallus gallus OX=9031 GN=OLA1... [more]
sp|Q9NTK5|OLA1_HUMAN0.000e+069.21Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 ... [more]
sp|Q9CZ30|OLA1_MOUSE0.000e+069.21Obg-like ATPase 1 OS=Mus musculus OX=10090 GN=Ola1... [more]
sp|Q2HJ33|OLA1_BOVIN0.000e+068.45Obg-like ATPase 1 OS=Bos taurus OX=9913 GN=OLA1 PE... [more]
sp|Q5R821|OLA1_PONAB0.000e+068.96Obg-like ATPase 1 OS=Pongo abelii OX=9601 GN=OLA1 ... [more]
back to top
BLAST of Obg-like ATPase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LIR90.000e+073.42Obg-like ATPase 1 OS=Opisthorchis felineus OX=1478... [more]
A0A1S8WX410.000e+073.67Obg-like ATPase 1 OS=Opisthorchis viverrini OX=619... [more]
A0A3R7F2C10.000e+071.71Obg-like ATPase 1 OS=Clonorchis sinensis OX=79923 ... [more]
G4VSL70.000e+073.16Obg-like ATPase 1 OS=Schistosoma mansoni OX=6183 G... [more]
A0A094ZWH40.000e+072.91Obg-like ATPase 1 OS=Schistosoma haematobium OX=61... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ola10.000e+068.39Obg like ATPase 1 [Source:NCBI gene;Acc:103043206][more]
mtg22.306e-1030.09mitochondrial ribosome associated GTPase 2 [Source... [more]
gtpbp101.172e-831.11GTP-binding protein 10 (putative) [Source:NCBI gen... [more]
drg23.217e-624.30developmentally regulated GTP binding protein 2 [S... [more]
drg23.720e-624.30developmentally regulated GTP binding protein 2 [S... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008922.17.471e-8061.90pep scaffold:Pmarinus_7.0:GL476670:52803:99208:-1 ... [more]
ENSPMAT00000005006.18.532e-3569.62pep scaffold:Pmarinus_7.0:GL484587:200353:203019:1... [more]
ENSPMAT00000004440.17.168e-1030.10pep scaffold:Pmarinus_7.0:GL476640:93137:105923:-1... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
OLA11.545e-12351.02P-loop ATPase with similarity to human OLA1 and ba... [more]
YLF23.636e-8037.84Protein of unknown function; has weak similarity t... [more]
YGR210C_mRNA1.912e-1838.46Putative protein of unknown function; green fluore... [more]
MTG25.703e-825.36Putative GTPase; member of the Obg family; periphe... [more]
RBG12.265e-628.15Member of the DRG family of GTP-binding proteins; ... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429406.198e-17765.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292461.078e-1331.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474692.611e-1332.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464141.528e-1027.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457944.682e-1033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OLA10.000e+068.80Obg like ATPase 1 [Source:NCBI gene;Acc:101161102][more]
OLA19.351e-17067.39Obg like ATPase 1 [Source:NCBI gene;Acc:101161102][more]
OLA13.937e-16967.48Obg like ATPase 1 [Source:NCBI gene;Acc:101161102][more]
ola11.726e-14357.72obg-like ATPase 1 [Source:NCBI gene;Acc:105356914][more]
mtg21.136e-928.32mitochondrial ribosome associated GTPase 2 [Source... [more]
back to top
BLAST of Obg-like ATPase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000061866.10.000e+0100.00SMESG000061866.1[more]
SMESG000039624.11.606e-1028.16SMESG000039624.1[more]
SMESG000025280.14.101e-625.74SMESG000025280.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033346 ID=SMED30033346|Name=Obg-like ATPase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1406bp
CTTTTATTCAGTTTTGTTTAAATATTCGTCTAGTATTGCATATCATTATT
ATTAACCTCATTTAAAATGTCCAAGAAAAAGGGAGATGAGCCTAAGAAGA
CTATCTTGTTAGGAAGAATTAAAACTGGACTAAAAGTTGGTATTGTTGGA
ATGCCTAATGTTGGAAAATCAACGTTTTTCAATGTTTTAACTAAAAGCCA
AGCAGCTGCAGAAAATTTTCCCTTCTGTACAATTGATCCAAATGAAAGCA
GAGTTCCAGTACCTGATGATAGATTCGATTGGTTATGTGAATTTCATAAT
CCACTTAGTCGCCAACCAGCTTATTTATCAGTTGTTGATATAGCAGGTCT
TGTTAAAGGTGCTCATGAAGGACATGGTTTAGGAAATGCTTTCCTATCTC
ATATAAACGGTGTTGATGCTATCTTTCATATGCTAAGAGTCTTTGAATCT
GAAGATGTGATTCACGTTGAAGGTGACGTTAATCCGATACGAGATTTAGA
GATAATTACCGAAGAATTAAGATTAAAAGATCAAGAATATATAGTGAAAG
AAGTTGATAAACTTGAGAAAGCATTTTTTCGTGGTGGCGATAAAAAACTG
AAACCAGAACTAGATACGATGATAAAGGTGCGGAAAATAATTTGTGATGA
TAAGAAACCAGTAAGATTTGGTGATTGGGTTCCAAATGATATAGAAGTTC
TCAATCATCATTTATTCATCACTGCAAAGCCTAGTATATATCTTATCAAC
ATGTCTGAGGCTGGTTATGTGAAAAAAAAGAATAAATGGCTGTCAAAAAT
AAAATCATGGGTTGATGAATTTGATCCTGGAGCCTCAATCATTCCGTTTT
CCGCAGATATTGAATTAAAGTTTCAGAATATGAGTCAAGAAGAAATCGAT
CAGTATGCTAAAGAAAATGGTACCGGTTCTGCCTTGCCGAAAATAATCAA
AACTGGCTACAAAGCGTTGCAATTGCAATACTTTTTTACGTGTGGTAAAG
ATGAAGTCAAAGCATGGACTATTCAAAACGGAACGAAAGCCCCACAGGCT
GCTGGAAAAATACACACTGACATGGAAAAAGGCTTCATAATGGCTGAAGT
GATGAATTACGAAGATTTTAAAACCGAAGGTTCTGAAAATGCTGTCAAAG
CTGTCGGAAAATATAAACAAAGAGGTCGAGAATATATTGTCGAAGATGGG
GATATAATTTTCTTTAAATTTAATGCTGGAGCCGGTTTAACGAAAAAAAA
ATGAATATTTAATTAACCAGAAATAAACGTTTTTGTTTGGAAGTTTGCTT
GTTTTTTCTATTATTTTTGTACAATTTAATGTTTATTTAATCCACATTAA
TGAATTAGAATTTGAATGTTATCTAAAATTCTTCTTTTGTCACATTAGGA
TATTTG
back to top

protein sequence of SMED30033346-orf-1

>SMED30033346-orf-1 ID=SMED30033346-orf-1|Name=SMED30033346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MSKKKGDEPKKTILLGRIKTGLKVGIVGMPNVGKSTFFNVLTKSQAAAEN
FPFCTIDPNESRVPVPDDRFDWLCEFHNPLSRQPAYLSVVDIAGLVKGAH
EGHGLGNAFLSHINGVDAIFHMLRVFESEDVIHVEGDVNPIRDLEIITEE
LRLKDQEYIVKEVDKLEKAFFRGGDKKLKPELDTMIKVRKIICDDKKPVR
FGDWVPNDIEVLNHHLFITAKPSIYLINMSEAGYVKKKNKWLSKIKSWVD
EFDPGASIIPFSADIELKFQNMSQEEIDQYAKENGTGSALPKIIKTGYKA
LQLQYFFTCGKDEVKAWTIQNGTKAPQAAGKIHTDMEKGFIMAEVMNYED
FKTEGSENAVKAVGKYKQRGREYIVEDGDIIFFKFNAGAGLTKKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR041706YchF_N
IPR006073GTP_binding_domain
IPR027417P-loop_NTPase
IPR013029YchF_C
IPR012675Beta-grasp_dom_sf
IPR023192TGS-like_dom_sf
IPR004396ATPase_YchF/OLA1
IPR031167G_OBG
IPR012676TGS-like
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:0043022ribosome binding
GO:0043023ribosomal large subunit binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006073GTP binding domainPRINTSPR00326GTP1OBGcoord: 89..104
score: 53.02
coord: 106..124
score: 35.39
coord: 45..63
score: 32.03
coord: 24..44
score: 56.32
IPR006073GTP binding domainPFAMPF01926MMR_HSR1coord: 23..135
e-value: 2.6E-22
score: 79.1
IPR013029YchF, C-terminal domainPFAMPF06071YchF-GTPase_Ccoord: 303..386
e-value: 1.8E-39
score: 133.8
IPR013029YchF, C-terminal domainCDDcd04867TGS_YchF_OLA1coord: 301..385
e-value: 1.30591E-56
score: 178.491
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 22..302
e-value: 8.2E-142
score: 474.6
NoneNo IPR availablePANTHERPTHR23305GTP-BINDING PROTEIN-RELATEDcoord: 1..389
NoneNo IPR availablePANTHERPTHR23305:SF11OBG-LIKE ATPASE 1coord: 1..389
NoneNo IPR availablePROSITEPS51880TGScoord: 302..385
score: 14.774
IPR012675Beta-grasp domain superfamilyGENE3DG3DSA:3.10.20.30coord: 67..385
e-value: 8.2E-142
score: 474.6
IPR023192TGS-like domain superfamilyGENE3DG3DSA:1.10.150.300coord: 132..221
e-value: 8.2E-142
score: 474.6
IPR004396Ribosome-binding ATPase YchF/Obg-like ATPase 1TIGRFAMTIGR00092TIGR00092coord: 21..386
e-value: 2.4E-132
score: 439.5
IPR004396Ribosome-binding ATPase YchF/Obg-like ATPase 1PIRSFPIRSF006641EngDcoord: 19..387
e-value: 2.2E-140
score: 465.7
IPR031167OBG-type guanine nucleotide-binding (G) domainPROSITEPS51710G_OBGcoord: 22..281
score: 56.525
IPR041706YchF, N-terminalCDDcd01900YchFcoord: 24..301
e-value: 1.13392E-139
score: 397.215
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 22..325
IPR012676TGS-likeSUPERFAMILYSSF81271TGS-likecoord: 303..384