DUF4476 domain-containing protein

Overview
NameDUF4476 domain-containing protein
Smed IDSMED30033340
Uniprot Best hitProline and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=PROSER1 PE=1 SV=2 (E=3.54959e-06)
Length (bp)889
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4476 domain-containing protein (SMED30033340) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4476 domain-containing protein (SMED30033340) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4476 domain-containing protein (SMED30033340) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4476 domain-containing protein (SMED30033340) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033340

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033340SMESG000055714.1 SmedASXL_010013SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30033340SMESG000055714.1 dd_Smed_v6_3608_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30033340SMESG000055714.1 OX_Smed_1.0.15417ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30033340SMESG000055714.1 dd_Smed_v4_3608_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF4476 domain-containing protein vs. Ensembl Human
Match: PROSER1 (proline and serine rich 1 [Source:HGNC Symbol;Acc:HGNC:20291])

HSP 1 Score: 51.9878 bits (123), Expect = 7.391e-7
Identity = 30/106 (28.30%), Postives = 57/106 (53.77%), Query Frame = 3
Query:   60 VDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIE 377
            +D ++F +++++I R+    E K   + Y   +F+  Q   LL  +  A  +LK + AL+ ++  +  TE   IL+ F  +  DK+ AL+ +   +ID Q++  IE
Sbjct:    1 MDKKSFEMVLDEI-RKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSK-DKLVALELLASNIIDAQNSRPIE 104          
BLAST of DUF4476 domain-containing protein vs. UniProt
Match: sp|Q86XN7|PRSR1_HUMAN (Proline and serine-rich protein 1 OS=Homo sapiens OX=9606 GN=PROSER1 PE=1 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 3.550e-6
Identity = 30/106 (28.30%), Postives = 57/106 (53.77%), Query Frame = 3
Query:   60 VDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIE 377
            +D ++F +++++I R+    E K   + Y   +F+  Q   LL  +  A  +LK + AL+ ++  +  TE   IL+ F  +  DK+ AL+ +   +ID Q++  IE
Sbjct:    1 MDKKSFEMVLDEI-RKAVLTEYKLKAIEYVHGYFSSEQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSK-DKLVALELLASNIIDAQNSRPIE 104          
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16456845 (tr|A0A183VRR7|A0A183VRR7_TRIRE DUF4476 domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS3173 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 8.535e-76
Identity = 114/214 (53.27%), Postives = 157/214 (73.36%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRY--DNGVSW 680
            MAKTP+    F  L   ++ ETTS+  KF+ +YY+K +F G QAA +L  YKTAPER++VI AL+KRLCRMTC EA  IL   QLTN+D++FALDC+K TLIDH++TEGIEYIL AF + +DK+KA+ IL+TVS +VS ++++GGHQ+Y+P GGL++QSFP +  L+GPI EQL  +  +  P++   AR    +S++R+ PSY Y  D+  SW
Sbjct:   39 MAKTPLSDSEFERLRRALISETTSVADKFDKLYYSKGYFTGVQAAAILACYKTAPERVQVIKALKKRLCRMTCAEAAEILKVMQLTNHDRIFALDCVKHTLIDHETTEGIEYILKAFIYESDKMKALHILSTVSMHVSRELASGGHQVYAPFGGLYTQSFPGRETLYGPISEQLAVKNHEVKPSLPVTARMNLPESIFRAAPSYAYIGDDNRSW 252          
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19094986 (tr|A0A2H1CWM4|A0A2H1CWM4_FASHE DUF4476 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_00471 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 3.252e-75
Identity = 118/214 (55.14%), Postives = 162/214 (75.70%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRY--DNGVSW 680
            MAK P+    F+ L+  +  ET S+E+KF   YY+K  F+G+QAA L+  +KTAPER++VI ALE+RLCRM C EA+ IL+  QLTN+D+VFALDCIKRTL+DH++TEGIEYILSAFPF  DK +AM IL+TVS YV++++++GGHQ+ +P+GGL++QSFPL+  LFGPI+EQL  +  +  P++   AR  K+ S++ + PSY Y  D G SW
Sbjct:    1 MAKHPLSDGDFSRLLKLLAAETDSMERKFEKFYYSKGCFSGAQAAALMAAFKTAPERVRVIKALERRLCRMCCAEAREILNVVQLTNHDRVFALDCIKRTLVDHETTEGIEYILSAFPFETDKKRAMQILSTVSMYVNKELASGGHQINAPLGGLYTQSFPLREALFGPINEQLAMKNHEVKPSLPVTARVKKIPSMFAAAPSYIYNGDEGRSW 214          
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|22540661 (tr|A0A5J4N836|A0A5J4N836_9TREM DUF4476 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0003465 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 4.081e-72
Identity = 110/214 (51.40%), Postives = 157/214 (73.36%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRY--DNGVSW 680
            MAK P+    FN L++ ++ ET+  EKKF  +YY+K  F+G+QAA LL  +KTAPER++VI ALE+RLCRM C EA+ IL+ FQLTN+D++FALDCIKRTL+DH++  G+EYIL+AF F  DK KA+ IL+T+S +V++++++GGHQLY+P GGL+SQ FP   +L+GPID+QL  ++ +  P++   A      S++ + PSY Y  D   SW
Sbjct:    1 MAKQPLSDGDFNRLLSTLISETSENEKKFEKLYYSKGCFSGAQAAALLACFKTAPERVRVIRALERRLCRMCCAEAREILNVFQLTNHDRLFALDCIKRTLVDHETAGGVEYILNAFHFETDKKKALDILSTISMHVTQELASGGHQLYAPFGGLYSQCFPGNESLYGPIDKQLAVKEHRVKPSLPVTACTNPPPSMFVAAPSYMYNGDEDRSW 214          
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|19060836 (tr|A0A4E0RMN5|A0A4E0RMN5_FASHE DUF4476 domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_000303 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.099e-71
Identity = 118/226 (52.21%), Postives = 162/226 (71.68%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEK------------RLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRY--DNGVSW 680
            MAK P+    F+ L+  +  ET S+E+KF   YY+K  F+G+QAA L+  +KTAPER++VI ALE+            RLCRM C EA+ IL+  QLTN+D+VFALDCIKRTL+DH++TEGIEYILSAFPF  DK +AM IL+TVS YV++++++GGHQ+ +P+GGL++QSFPL+  LFGPI+EQL  +  +  P++   AR  K+ S++ + PSY Y  D G SW
Sbjct:    1 MAKHPLSDGDFSRLLKLLAAETDSMERKFEKFYYSKGCFSGAQAAALMAAFKTAPERVRVIKALERVSFSRTVIPVHQRLCRMCCAEAREILNVVQLTNHDRVFALDCIKRTLVDHETTEGIEYILSAFPFETDKKRAMQILSTVSMYVNKELASGGHQINAPLGGLYTQSFPLREALFGPINEQLAMKNHEVKPSLPVTARVKKIPSMFAAAPSYIYNGDEGRSW 226          
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20389694 (tr|A0A3R7DG61|A0A3R7DG61_CLOSI DUF4476 domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CSKR_6925s PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 2.879e-71
Identity = 110/214 (51.40%), Postives = 155/214 (72.43%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRY--DNGVSW 680
            MAK P+    FN L++ ++ ET+  EKKF  +YY++  F+G QAA LL  +KTAPER++VI ALE+RLCRM C EA+ IL+  QLTNND++ AL+C+KRTL+DH++TEGIEYILSAFPF  DK KA+ ILATVS + ++++++GGHQ Y+P GGL++QSFP K  L+GP+++Q+  ++ K  P++   A      S + + PSY Y  D   SW
Sbjct:    1 MAKVPLSDSDFNRLLSLLISETSDKEKKFEKLYYSRGCFSGIQAAALLACFKTAPERVRVIRALERRLCRMCCAEAREILNIIQLTNNDRLTALNCVKRTLVDHETTEGIEYILSAFPFETDKKKALEILATVSMHATQQLASGGHQHYAPFGGLYTQSFPGKEGLYGPLEDQVAAKEHKVKPSLPVTACTKPPPSAFVAAPSYIYNGDEDRSW 214          
BLAST of DUF4476 domain-containing protein vs. Planmine SMEST
Match: SMESG000055714.1 (SMESG000055714.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.149e-165
Identity = 218/220 (99.09%), Postives = 219/220 (99.55%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRYDNGVSWKSSMGQFC 704
            MAKTPVDSETFNILINDIV+ETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKG PAIAPHARPGKVDSLYRSHPSYRYDNGVSWKSSMGQFC
Sbjct:    1 MAKTPVDSETFNILINDIVKETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGQPAIAPHARPGKVDSLYRSHPSYRYDNGVSWKSSMGQFC 220          
BLAST of DUF4476 domain-containing protein vs. Planmine SMEST
Match: SMESG000045760.1 (SMESG000045760.1)

HSP 1 Score: 274.633 bits (701), Expect = 3.542e-92
Identity = 133/217 (61.29%), Postives = 165/217 (76.04%), Query Frame = 3
Query:   45 MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQYKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRTLIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYSPVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRSHPSYRYDNGVSWKSSMG 695
            MAK P D   F  L+ ++  ET SI+KKFNIVYY K FF+G+QAA LL  +KTAPE+LKVI +L+KRLCRMTC E K IL A Q  NND++ AL+ IKRTLIDHQ TEG+E+ILSAFPF +DKLKA+ IL TVSSYV++++ +GGHQ Y+PVGGL+SQ+FPL+ NLFG +++QL    G G PAI   ARPGKV SLY SHPSY+YD   ++    G
Sbjct:    1 MAKKPADESYFMDLVRNLKEETDSIDKKFNIVYYGKGFFSGTQAAILLKSFKTAPEKLKVIKSLDKRLCRMTCAEGKEILIAMQPINNDRLEALNIIKRTLIDHQCTEGMEHILSAFPFQSDKLKALGILTTVSSYVADQLPSGGHQQYAPVGGLYSQNFPLRENLFGSLEDQLLRMPGSGLPAIPLRARPGKVPSLYTSHPSYKYDTTYTYLQDRG 217          
The following BLAST results are available for this feature:
BLAST of DUF4476 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PROSER17.391e-728.30proline and serine rich 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q86XN7|PRSR1_HUMAN3.550e-628.30Proline and serine-rich protein 1 OS=Homo sapiens ... [more]
back to top
BLAST of DUF4476 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|164568458.535e-7653.27tr|A0A183VRR7|A0A183VRR7_TRIRE DUF4476 domain-cont... [more]
gnl|BL_ORD_ID|190949863.252e-7555.14tr|A0A2H1CWM4|A0A2H1CWM4_FASHE DUF4476 domain-cont... [more]
gnl|BL_ORD_ID|225406614.081e-7251.40tr|A0A5J4N836|A0A5J4N836_9TREM DUF4476 domain-cont... [more]
gnl|BL_ORD_ID|190608361.099e-7152.21tr|A0A4E0RMN5|A0A4E0RMN5_FASHE DUF4476 domain-cont... [more]
gnl|BL_ORD_ID|203896942.879e-7151.40tr|A0A3R7DG61|A0A3R7DG61_CLOSI DUF4476 domain-cont... [more]
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4476 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000055714.12.149e-16599.09SMESG000055714.1[more]
SMESG000045760.13.542e-9261.29SMESG000045760.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033340 ID=SMED30033340|Name=DUF4476 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=889bp
TTTAACCACTTAAATCTATAGAAACACCAATTAATAAATTTTAAATGGCT
AAAACTCCAGTAGATTCTGAGACGTTTAATATATTAATCAATGACATTGT
CAGAGAAACAACATCGATTGAAAAAAAATTTAATATTGTTTATTATACAA
AATTTTTTTTCGCTGGATCTCAGGCTGCACATTTGTTGATTCAATATAAA
ACCGCACCAGAACGCTTGAAAGTAATTTCTGCTTTAGAAAAGCGACTGTG
CCGAATGACATGCACCGAAGCAAAATTGATCTTGGATGCATTCCAATTGA
CGAATAATGACAAAGTATTTGCTCTAGACTGTATCAAGAGAACTCTGATT
GACCATCAATCAACAGAAGGAATTGAATACATTCTCTCGGCATTTCCATT
CACGAATGATAAATTAAAAGCGATGAGTATCCTTGCGACAGTCAGTTCGT
ATGTGTCGGAAAAGATGAGTGCTGGAGGTCATCAGCTGTACTCTCCTGTT
GGAGGGCTTTTTTCCCAGAGTTTCCCATTGAAAGCAAATCTTTTTGGTCC
GATTGACGAGCAATTGGAAAATCAACAAGGAAAAGGACATCCGGCTATTG
CACCTCATGCTAGGCCTGGAAAAGTCGATTCATTGTATCGCAGCCATCCT
TCATACCGATACGACAATGGAGTTAGTTGGAAATCGTCGATGGGTCAATT
TTGCTGACTCTTTTCCATGAGTTAATTGATTTTAACTGACTGCGGATATT
ATATTGATTTATTGATTTTCATATTTTTGCCAATAATCAACTACTGACAA
TTATAAGTAGCGAAATTTTATTAAAATATTTAAACGCAAATTTAATCAAT
TAAAATTTTCCCTGATTATCAACTACTGACAATTATAAG
back to top

protein sequence of SMED30033340-orf-1

>SMED30033340-orf-1 ID=SMED30033340-orf-1|Name=SMED30033340-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MAKTPVDSETFNILINDIVRETTSIEKKFNIVYYTKFFFAGSQAAHLLIQ
YKTAPERLKVISALEKRLCRMTCTEAKLILDAFQLTNNDKVFALDCIKRT
LIDHQSTEGIEYILSAFPFTNDKLKAMSILATVSSYVSEKMSAGGHQLYS
PVGGLFSQSFPLKANLFGPIDEQLENQQGKGHPAIAPHARPGKVDSLYRS
HPSYRYDNGVSWKSSMGQFC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042616PROSER1
IPR028011DUF4476
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028011Domain of unknown function DUF4476PFAMPF14771DUF4476coord: 55..130
e-value: 1.1E-5
score: 25.7
IPR042616Proline and serine-rich protein 1PANTHERPTHR14880FAMILY NOT NAMEDcoord: 7..112