Transcription initiation factor TFIID subunit 2

Overview
NameTranscription initiation factor TFIID subunit 2
Smed IDSMED30033338
Length (bp)3214
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transcription initiation factor TFIID subunit 2 (SMED30033338) t-SNE clustered cells

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 2 (SMED30033338) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transcription initiation factor TFIID subunit 2 (SMED30033338) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transcription initiation factor TFIID subunit 2 (SMED30033338) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033338

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033338h1SMcG0002361 SmedASXL_013102SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033338h1SMcG0002361 SmedASXL_013102SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: TAF2 (TATA-box binding protein associated factor 2 [Source:HGNC Symbol;Acc:HGNC:11536])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 561/985 (56.95%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + I + + A  Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W ++ ELK LK+ + FSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+SNG L+++VYT D+  K +HY L  P  AS I + +G FEI  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  NLLH   ++D++ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+NEY+  IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y +M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  +I  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F +  +Y LQ ++   +ALL+  H LCP ++ T + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +  +L+ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G++  +P +F  Y    +  D+R  AL  ++      ++YE L+WL+  +I  D     +R   +N L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   24 RPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIY---------RVRINDLEAAFIYNDPTLEVCH-SESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLL-NMIQNDPV-PYVRHKILNMLT---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 974          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: TAF2 (TATA-box binding protein associated factor 2 [Source:HGNC Symbol;Acc:HGNC:11536])

HSP 1 Score: 160.614 bits (405), Expect = 3.699e-43
Identity = 99/324 (30.56%), Postives = 163/324 (50.31%), Query Frame = 3
Query:  822 PKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDR 1775
            P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  +                                       WV  GISGY+  L++K   G+NEY+  IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y +M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+ 
Sbjct:    2 PQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFRSD--------------------------------------EWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEE 276          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: NPEPPS (aminopeptidase puromycin sensitive [Source:HGNC Symbol;Acc:HGNC:7900])

HSP 1 Score: 57.7658 bits (138), Expect = 1.259e-7
Identity = 78/333 (23.42%), Postives = 132/333 (39.64%), Query Frame = 3
Query:  183 AKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELK-PLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKT-----TVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYL 1142
            A Q+R  + Q+     +I I+    A    +   A    + +N+ N D  + +   S     L+ G G L +        ++ EL   +K       YR K    +  P+      +   +  T      +R  FPC D  EP    T+ I + V +D VA+SN  ++D    PD  N V   F + PV ++  +  VVGE++         V   C   + P+ K       +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++
Sbjct:   83 AAQVRQATNQIVMNCADIDIITASYAPEGDEEIHA----TGFNYQNEDEKVTLSFPST----LQTGTGTLKI-------DFVGELNDKMK-----GFYRSK----YTTPSGEVRYAAVTQFEATD-----ARRAFPCWD--EPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGV---CVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWI 381          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: NPEPPS (aminopeptidase puromycin sensitive [Source:HGNC Symbol;Acc:HGNC:7900])

HSP 1 Score: 57.3806 bits (137), Expect = 1.568e-7
Identity = 78/333 (23.42%), Postives = 132/333 (39.64%), Query Frame = 3
Query:  183 AKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELK-PLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKT-----TVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYL 1142
            A Q+R  + Q+     +I I+    A    +   A    + +N+ N D  + +   S     L+ G G L +        ++ EL   +K       YR K    +  P+      +   +  T      +R  FPC D  EP    T+ I + V +D VA+SN  ++D    PD  N V   F + PV ++  +  VVGE++         V   C   + P+ K       +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++
Sbjct:   79 AAQVRQATNQIVMNCADIDIITASYAPEGDEEIHA----TGFNYQNEDEKVTLSFPST----LQTGTGTLKI-------DFVGELNDKMK-----GFYRSK----YTTPSGEVRYAAVTQFEATD-----ARRAFPCWD--EPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGV---CVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWI 377          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 51.6026 bits (122), Expect = 8.748e-6
Identity = 74/298 (24.83%), Postives = 111/298 (37.25%), Query Frame = 3
Query:  540 YLFTSTMGNMSRLWFPCVDCAE-PCTWKIEITVNEDMVAISNGMLLDSVYTP-DLHNKVYHYFLKQPVPASCIGMVVGEFE---IYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNML-DQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFR 1415
            YLF+       R   PC D      T+  E++V +++VA+ + +       P D   K+Y +  K P+P   I +VVG  E   I P  L+               +T  E+M    K  ED L   Y +  Y  + +  +F     Y  M    L  + P  +  D+SL    V+A  I   + G+    K W H W+  G + YL +     L G     FN      E+ N  +  G       E          L       A     Y+K  AL+  L +L  GP + L   +
Sbjct:  131 YLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSET--ESM---LKIAED-LGGPYVWGQYDLLVLPPSF----PYGGMENPCLTFVTPTLLAGDKSLSN--VIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFG-------ETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLK 409          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Celegans
Match: taf-2 (Transcription initiation factor TFIID subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9TYN3])

HSP 1 Score: 312.768 bits (800), Expect = 5.166e-90
Identity = 242/908 (26.65%), Postives = 438/908 (48.24%), Query Frame = 3
Query:   57 NYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRV---DLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMS--RLWFPCVDCAEP---CTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLE-CKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGG---LRDVFTTLYYTKTGKSMICSNDF----KNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSL-EFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAV 2729
             + + +Q + I+ ++         TEIV+ P + ++ ++ L+  +  +   ++    +++++   +   S  D +  ++++               ISS + V    L E   EL + IP +    I   K ++L V+  +  P  GL FV        N +  ++FT    ++S  R W  C+D  EP     W++   +   +V +++G L +     +     Y +    P  A  IG  +G F++ P P    +  F  P   P +  T   + ++ +F+E+KL+  +P+   K VFVD   E+   Y+S+ I    +L+   ++D      + +  +I  QFFG       W H W+P  I+ +L  LY+++ +G  E ++ +K+ MD+V +YE Q G IVL P E  K LP +         A+  YV    KK  L +R+L+ ++G    ++V  ++L +        +D +     P    H   LL   E    +V  V+G +I +FL  +V   GH     ++ FNR+RN+ E+ +KQ      G  +YTGP+ VV QE +G F   ++ID  V+ +      +I  H+K RK RK+KV L  G E+++DL   D++ P LW+ +D +  L  +I + QP      +LR+E+D +AQ+ A+E I A+  A   S++ D   N K FY+ R +AA  +  + N   +    G   L ++F   + +K   ++  SN+F    +NL  Y +  ++ + +A L+   G C  D+   L +L+ +NDNSTNRYSD +Y+A +  S+  ++           L E L +++++++K+    L +D   P++   +    L  L +LQ+ GY+  +  + + +   N    +R+ A+  +I  +
Sbjct:   70 KFRILSQQVEISNLNISTRSFNVRTEIVLLPCEKSLYQLDLHIGKCSLLPNEVPGSASKVTLNGVECEYSRRDFWKDLAQEKS-------------ISSLEPVLYEKLAENDYELQILIPKEVRKKIKHRKAVRLRVDTVVRDPPRGLQFVD------FNEHDCHVFTYHTPHISGAREWTVCLD--EPDQLALWELTFELEPHLVPVASGELEEKREVSENGKIRYKFHQTVPTSACNIGWAIGRFKLEPHPESPTIYTFSLPGLEPFVNHTTMYLDKMVEFLEEKLSCRFPYPTLKVVFVDQCTEEIQVYSSLLIVPTAMLYHKKIIDVVQEARQKLIFSIALQFFGCLISPAQWWHWWIPVSIARFLTSLYVETKLGTAEARWQLKRAMDDVCDYEHQWGKIVLSPPEPTKKLPLH-VDPRHEYTASPLYVEAMLKKGFLTMRMLQRRIGLEPFMRVLHRVLTVG-------LDMSEKKTTPAAWRH---LLTTTESFFRSVISVTGKEIPSFLSQFVRTGGHAAFAVKFDFNRKRNIVEIEIKQDDTEGNGRTQYTGPLSVVVQEVDGAFTHTIQIDGAVSHA------EISCHSKGRKQRKKKVPLLTGEEIEIDLTNMDAESPILWLRIDPDYLLIREITISQPMFHWEYMLRYERDVIAQMEALERIQALPSAHSRSVIVDAVANEKFFYRIRYRAAFVLTFVQNRKSEALTVGTPVLINMFRESFGSKAATNIPRSNNFVVTAQNLQQYFVMQALPQAIARLRRQSGECHEDVQPFLLDLIKFNDNSTNRYSDDFYRAALYNSLASSVFPHDALPCHVELPENLSNDVRVLIKEFTYALNMDTVSPSWGRVVGAAALTGLYQLQKCGYLPLDSQLLWTFSHPNCCVQMRRCAITLIIDRI 939          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Match: Taf2 (gene:FBgn0011836 transcript:FBtr0332688)

HSP 1 Score: 543.117 bits (1398), Expect = 6.950e-174
Identity = 333/986 (33.77%), Postives = 529/986 (53.65%), Query Frame = 3
Query:   51 MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXX--XXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPN--------------------YSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGV---FHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQD----IYRMYWS-QKLP 2909
            +R + +++Q + +  I F+   I G  E+ I P    +  I LNAKQ+RI+S  L    N++   +     +Y DPF  I  K ++    L+ + K H+++A+  D +   GEL +Q+PP+ +S I E + L++ +EFSL  PK G++FV P  +       N +++FT+   N SRLWFPCVD  A+PCTW++E TV+++M A+S G LL+ + TPDL  K +HY +  PV A  I + VG+FEIY DP +  VTHFC P  +PLLK TV  + + F+F E+ L+  YPF  YK VFVD    D  +YA+M+I  +NLLH   ++DQ+ I+   M+ A+ EQFFG F     W   W+  GI+ YL  LY +   G NEY+  ++ E+  VV YEEQ GGI+LD   C   P                     + F +      +  YV   ++KA  +IR+LE ++G  ++++VF K L LA  A  T + +             + LL+   +   A+  V+G  ++ F++ WV   GH +      FNR+RN  EL ++Q +   RG  +Y GP+ V  QE +G F+  ++I+  +  S      DI  H+K R+++K+K+ L  G EVD+DL   D D P LWI LD  M L   + + QPD      LRHE+D  AQ  AI+ +      +    L D  ++ + FYQ R +AA  +  + N +     G   + ++F   + + +   +I  N+F N   Y LQ +I   +A L+TSHG+CP ++   LF+L  YN+NS N Y+D YY+A ++ ++G+ +   V    H    + + L ++ K++L +V R L +++ +P+YK+ ++  CL ++R+LQ++G++   P I+  Y       D+R  A+ CL+  V      E LE L+   +++       R      L+D       S +R D    + R+++S  +LP
Sbjct:   12 LRPFKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVL----NDVCQAD----FTYFDPFQNICYK-EHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCFGNNEYRAWVQSELARVVRYEEQYGGIILD---CSQPPAPLPVSGTNQSAASSKQQEIVHYFPIKSLHTVSPKYVEAMRRKAHFVIRMLENRIGQELLIQVFNKQLALASSAATTKIGAGL----------WSQLLISTNIFIKAIFTVTGKDMSVFMDQWVRTGGHAKFSLTSVFNRKRNTIELEIRQDYVNQRGIRKYNGPLMVQLQELDGTFKHTLQIESTLVKS------DITCHSKSRRNKKKKIPLCTGEEVDMDLSAMD-DSPVLWIRLDPEMILLRDLIIEQPDFQWQYQLRHERDVTAQFQAIQALQKYPTNATRLALTDTIESERCFYQVRCEAAHSLTKVANQMVASWSGPPAMLNIFRKFFGSFSAPHIIKLNNFSNFQLYFLQKAIPVAMAGLRTSHGICPPEVMRFLFDLFKYNENSRNHYTDAYYRAALVEALGETLTPVVSVAIHGTQITTDSLSTDAKLVLDEVTRLLNMEKHLPSYKYMVSVSCLKVIRKLQKFGHLPSLPHIYRSYAEYGIYLDLRIAAMECLVDFVKVDGRSEDLEHLI--TLLETDPDPAARHALAQLLIDNPPFTRESRSRLDKPNLVDRLWFSINRLP 966          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Match: Taf2 (gene:FBgn0011836 transcript:FBtr0076361)

HSP 1 Score: 543.117 bits (1398), Expect = 6.950e-174
Identity = 333/986 (33.77%), Postives = 529/986 (53.65%), Query Frame = 3
Query:   51 MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXX--XXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPN--------------------YSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGV---FHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQD----IYRMYWS-QKLP 2909
            +R + +++Q + +  I F+   I G  E+ I P    +  I LNAKQ+RI+S  L    N++   +     +Y DPF  I  K ++    L+ + K H+++A+  D +   GEL +Q+PP+ +S I E + L++ +EFSL  PK G++FV P  +       N +++FT+   N SRLWFPCVD  A+PCTW++E TV+++M A+S G LL+ + TPDL  K +HY +  PV A  I + VG+FEIY DP +  VTHFC P  +PLLK TV  + + F+F E+ L+  YPF  YK VFVD    D  +YA+M+I  +NLLH   ++DQ+ I+   M+ A+ EQFFG F     W   W+  GI+ YL  LY +   G NEY+  ++ E+  VV YEEQ GGI+LD   C   P                     + F +      +  YV   ++KA  +IR+LE ++G  ++++VF K L LA  A  T + +             + LL+   +   A+  V+G  ++ F++ WV   GH +      FNR+RN  EL ++Q +   RG  +Y GP+ V  QE +G F+  ++I+  +  S      DI  H+K R+++K+K+ L  G EVD+DL   D D P LWI LD  M L   + + QPD      LRHE+D  AQ  AI+ +      +    L D  ++ + FYQ R +AA  +  + N +     G   + ++F   + + +   +I  N+F N   Y LQ +I   +A L+TSHG+CP ++   LF+L  YN+NS N Y+D YY+A ++ ++G+ +   V    H    + + L ++ K++L +V R L +++ +P+YK+ ++  CL ++R+LQ++G++   P I+  Y       D+R  A+ CL+  V      E LE L+   +++       R      L+D       S +R D    + R+++S  +LP
Sbjct:   12 LRPFKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVL----NDVCQAD----FTYFDPFQNICYK-EHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCFGNNEYRAWVQSELARVVRYEEQYGGIILD---CSQPPAPLPVSGTNQSAASSKQQEIVHYFPIKSLHTVSPKYVEAMRRKAHFVIRMLENRIGQELLIQVFNKQLALASSAATTKIGAGL----------WSQLLISTNIFIKAIFTVTGKDMSVFMDQWVRTGGHAKFSLTSVFNRKRNTIELEIRQDYVNQRGIRKYNGPLMVQLQELDGTFKHTLQIESTLVKS------DITCHSKSRRNKKKKIPLCTGEEVDMDLSAMD-DSPVLWIRLDPEMILLRDLIIEQPDFQWQYQLRHERDVTAQFQAIQALQKYPTNATRLALTDTIESERCFYQVRCEAAHSLTKVANQMVASWSGPPAMLNIFRKFFGSFSAPHIIKLNNFSNFQLYFLQKAIPVAMAGLRTSHGICPPEVMRFLFDLFKYNENSRNHYTDAYYRAALVEALGETLTPVVSVAIHGTQITTDSLSTDAKLVLDEVTRLLNMEKHLPSYKYMVSVSCLKVIRKLQKFGHLPSLPHIYRSYAEYGIYLDLRIAAMECLVDFVKVDGRSEDLEHLI--TLLETDPDPAARHALAQLLIDNPPFTRESRSRLDKPNLVDRLWFSINRLP 966          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Zebrafish
Match: taf2 (TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:NCBI gene;Acc:324486])

HSP 1 Score: 557.755 bits (1436), Expect = 1.317e-179
Identity = 327/985 (33.20%), Postives = 547/985 (55.53%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL------ECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN ++F    + G+ E+ I+P    + RI LN+KQ RI+          + + + +    Y+DP + +         NL+ F   + ++   VD + G GEL++++P + W    E+K +K+ +EFSL +PK GL+FV P+   N      ++F+    N SR WFPCVD  +E CTWK+E TV+  MVA+S G L+++VYT D+  K YHY L  P  A  I M VG FEI  DP +  VTHFC P+ +PLLK T+  + +IF+F E+ L   YP+  +KTVFVD A+    SYASM+IF  NLLH   ++DQ+ +T   +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+  IK+E+D++V YE + GG++L P       +    P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +           L DI + ++ FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F +  +Y LQ +I   +A L+    LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L +++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G+I  +P +F  Y    +  DVR  AL  +I      ++   L+WL+ +++  D     +R + ++ L       N    +     +     + +L++ ++     DWRLR   + L
Sbjct:   13 RPYKLTHQVVCINNVNFQRKSVIGYVELTIFPTVVNLNRIKLNSKQCRIY---------RVRVNDLEAPFIYNDPTLEVCHHESKQR-NLNYFSSAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVMKVYIEFSLDQPKGGLHFVVPDVEGNMAERAAHVFSFGNQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTYHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHTMSYLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSGLIIDQTPMTRSFLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGVNEYRHWIKEELDKIVEYELKIGGVLLHPTFSGGKEKDNPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHM----------WSQMLVSTSGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEEAILALEKFPTPPSRRALTDILEQDQCFYKVRMHACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFISFQSYFLQKTIPVAMAQLRDVQNLCPREVLSFILDLIKYNDNRKNKFSDNYYRAELIDALTNSLTPAISINNEVRTVDSLNADVRLILEEITRFLNMEKLLPSYRNTITVSCLRAIRMLQKNGHIPSDPTLFKSYAEYGHFVDVRIAALEAVIDYTRVDRSSSELQWLL-DLVQNDPVH-YVRHEILSMLA-----KNPPFTKAADSSLCNEALVDQLWKLMNSGTCHDWRLRCDAVNL 963          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 554/985 (56.24%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNY-SFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDS-SLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R+Y +++Q +CIN ++F    + G+ E+ I P+  ++ RI LN+KQ RI+          + + + + A  Y+DP + I         NL+ F   + ++   VD + G GEL +++P + W  + ELK LK+ +EFSL +PK GL+FV PN   +    G +LF+    N SR WFPCVD  +E CTWK+E TV+  MVA+SNG L++  YT D+  K + Y L  P  A  I + VG FE+  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVFVD A+ +  SYASM+IF  NLLH + ++DQ+ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+N+Y+  IK E+D +V YE + GG++L P+     E     +Y  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ +  + G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +S +L+ L +++++IL+++ R L +++ +P+Y+  IT  CL  +R LQ+ G++  +P +F  Y    +  DVR  AL  ++      ++ E L+WL+   + ++     +R      L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   14 RHYKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEICHHESKQR-NLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSL-GTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQEEAILALETFPTPASRLALTDILEQEQCFYRVRMMACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFLNFQSYFLQKTMPVAMALLRDVHNLCPKEVLSFILDLIKYNDNRKNKFSDNYYRAELIDALSNSVTPAVSVNNESRTLDNLNADVRLILEEITRFLNMEKLLPSYRHIITVSCLRAIRILQKNGHVPSDPTLFKSYAENGHFVDVRVAALEAVVDYTKVDRSCEDLQWLL--TMAQNDPVPYIRHKIFYMLS---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 964          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 554/985 (56.24%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNY-SFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDS-SLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R+Y +++Q +CIN ++F    + G+ E+ I P+  ++ RI LN+KQ RI+          + + + + A  Y+DP + I         NL+ F   + ++   VD + G GEL +++P + W  + ELK LK+ +EFSL +PK GL+FV PN   +    G +LF+    N SR WFPCVD  +E CTWK+E TV+  MVA+SNG L++  YT D+  K + Y L  P  A  I + VG FE+  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVFVD A+ +  SYASM+IF  NLLH + ++DQ+ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+N+Y+  IK E+D +V YE + GG++L P+     E     +Y  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ +  + G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +S +L+ L +++++IL+++ R L +++ +P+Y+  IT  CL  +R LQ+ G++  +P +F  Y    +  DVR  AL  ++      ++ E L+WL+   + ++     +R      L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   14 RHYKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEICHHESKQR-NLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSL-GTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQEEAILALETFPTPASRLALTDILEQEQCFYRVRMMACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFLNFQSYFLQKTMPVAMALLRDVHNLCPKEVLSFILDLIKYNDNRKNKFSDNYYRAELIDALSNSVTPAVSVNNESRTLDNLNADVRLILEEITRFLNMEKLLPSYRHIITVSCLRAIRILQKNGHVPSDPTLFKSYAENGHFVDVRVAALEAVVDYTKVDRSCEDLQWLL--TMAQNDPVPYIRHKIFYMLS---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 964          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 564.688 bits (1454), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 554/985 (56.24%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNY-SFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDS-SLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R+Y +++Q +CIN ++F    + G+ E+ I P+  ++ RI LN+KQ RI+          + + + + A  Y+DP + I         NL+ F   + ++   VD + G GEL +++P + W  + ELK LK+ +EFSL +PK GL+FV PN   +    G +LF+    N SR WFPCVD  +E CTWK+E TV+  MVA+SNG L++  YT D+  K + Y L  P  A  I + VG FE+  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVFVD A+ +  SYASM+IF  NLLH + ++DQ+ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+N+Y+  IK E+D +V YE + GG++L P+     E     +Y  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ +  + G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +S +L+ L +++++IL+++ R L +++ +P+Y+  IT  CL  +R LQ+ G++  +P +F  Y    +  DVR  AL  ++      ++ E L+WL+   + ++     +R      L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   14 RHYKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEICHHESKQR-NLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSL-GTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQEEAILALETFPTPASRLALTDILEQEQCFYRVRMMACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFLNFQSYFLQKTMPVAMALLRDVHNLCPKEVLSFILDLIKYNDNRKNKFSDNYYRAELIDALSNSVTPAVSVNNESRTLDNLNADVRLILEEITRFLNMEKLLPSYRHIITVSCLRAIRILQKNGHVPSDPTLFKSYAENGHFVDVRVAALEAVVDYTKVDRSCEDLQWLL--TMAQNDPVPYIRHKIFYMLS---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 964          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 549.28 bits (1414), Expect = 5.427e-178
Identity = 308/878 (35.08%), Postives = 510/878 (58.09%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNY-SFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDS-SLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIF 2657
            R+Y +++Q +CIN ++F    + G+ E+ I P+  ++ RI LN+KQ RI+          + + + + A  Y+DP + I         NL+ F   + ++   VD + G GEL +++P + W  + ELK LK+ +EFSL +PK GL+FV PN   +    G +LF+    N SR WFPCVD  +E CTWK+E TV+  MVA+SNG L++  YT D+  K + Y L  P  A  I + VG FE+  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVFVD A+ +  SYASM+IF  NLLH + ++DQ+ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+N+Y+  IK E+D +V YE + GG++L P+     E     +Y  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ +  + G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +S +L+ L +++++IL+++ R L +++ +P+Y+  IT  CL  +R LQ+ G++  +P +F
Sbjct:   14 RHYKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEICHHESKQR-NLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFSTNLLHSSMIIDQTPVTRRYLAHSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSL-GTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQEEAILALETFPTPASRLALTDILEQEQCFYRVRMMACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFLNFQSYFLQKTMPVAMALLRDVHNLCPKEVLSFILDLIKYNDNRKNKFSDNYYRAELIDALSNSVTPAVSVNNESRTLDNLNADVRLILEEITRFLNMEKLLPSYRHIITVSCLRAIRILQKNGHVPSDPTLF 864          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Match: TAF2 (uncharacterized loc100125055 [Source:Xenbase;Acc:XB-GENE-5962512])

HSP 1 Score: 531.176 bits (1367), Expect = 3.587e-170
Identity = 322/985 (32.69%), Postives = 538/985 (54.62%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNY-SFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDS-SLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R+Y +++Q +CIN ++F    + G+ E+ I P+  ++ RI LN+KQ RI+          + + + + A  Y+DP + I         NL+ F   + ++   VD + G GEL +++P + W  + ELK LK+ +EFSL +PK GL+FV PN   +    G +LF+    N SR WFPCVD  +E CTWK+E TV+  MVA+SNG L++  YT D+  K + Y L  P  A  I + VG FE+  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVFVD A+ +  SYASM+IF L               LK       E  + +  V+  W   WV  GISGY+  L++K   G+N+Y+  IK E+D +V YE + GG++L P+     E     +Y  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ +  + G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +S +L+ L +++++IL+++ R L +++ +P+Y+  IT  CL  +R LQ+ G++  +P +F  Y    +  DVR  AL  ++      ++ E L+WL+   + ++     +R      L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   14 RHYKLTHQVVCINNVNFQRKCVIGYVELTICPMVTSLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEICHHESKQR-NLNYFSNTYAAAVTAVDPDAGNGELCIKVPSELWKQVDELKSLKVYIEFSLDQPKGGLHFVVPNVEGSMAERGAHLFSYGYQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSNGDLVEVEYTHDMRKKTFRYTLTIPTAAPNISLAVGPFEVLVDPYMHEVTHFCLPQLLPLLKHTTAYLHEVFEFYEEILTCRYPYSCFKTVFVDEAYIEVASYASMSIFRL--------------YLKQNKPGASEYVYKYVAVILLWSDEWVLKGISGYIYGLWMKKTFGVNQYRHWIKDELDTIVAYELKTGGVLLHPIFSSGKEKDNPASYLHFSIKHPHTLSWEYYNMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSL-GTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQEEAILALETFPTPASRLALTDILEQEQCFYRVRMMACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFLNFQSYFLQKTMPVAMALLRDVHNLCPKEVLSFILDLIKYNDNRKNKFSDNYYRAELIDALSNSVTPAVSVNNESRTLDNLNADVRLILEEITRFLNMEKLLPSYRHIITVSCLRAIRILQKNGHVPSDPTLFKSYAENGHFVDVRVAALEAVVDYTKVDRSCEDLQWLLT--MAQNDPVPYIRHKIFYMLS---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 950          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Match: Taf2 (TATA-box binding protein associated factor 2 [Source:MGI Symbol;Acc:MGI:2443028])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 558/985 (56.65%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + I + + A  Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W ++ ELK LK+ + FSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+SNG L+++VYT D+  K +HY L  P  AS I + +G FEI  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  NLLH   ++D++ +T + +A A+ +QFFG F    +W   WV  GISGY+  L++K   G+NEY   IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  +I  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  KT  +++ +N+F +  +Y LQ ++   +ALL+  H LCP ++ T + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +  +L+ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G++  +  +F  Y    +  D+R  AL  ++      ++YE L+WL+  +I  D     +R   +N L    K   ++ N +    +     + +L++ ++   + DWRLR   + L
Sbjct:   24 RPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIY---------RVRINDLEAAFIYNDPTLEVCH-SESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTYGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLL-NMIQTDPV-PYVRHKILNMLT---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTAHDWRLRCGAVDL 974          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Match: Npepps (aminopeptidase puromycin sensitive [Source:MGI Symbol;Acc:MGI:1101358])

HSP 1 Score: 58.151 bits (139), Expect = 4.872e-8
Identity = 117/536 (21.83%), Postives = 193/536 (36.01%), Query Frame = 3
Query:  183 AKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKT-----TVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKL--LLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQF----HHRIRGCFEYTGPIEVVTQE 1736
            A Q+R  + Q+     +I I+    A    +   A    + +N+ N D  + +   S     L+ G G L +        ++ EL         S Y   AG                    T      +R  FPC D  EP    T+ I + V +D VA+SN  ++D    PD  N V   F + PV ++  +  VVGE++         V   C   + P+ K       +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++   YL       EY    +    +    +E +      P+E         S+      +  + A+   K A +IR+L   +G     K F+K   + L K  Q  +                       E L  +++  SG  I   +  W  + G   I  E +      V +LS K+F     +    C ++  PI + T E
Sbjct:   84 AAQVRQATNQIVMNCADIDIITASYAPEGDEEIHA----TGFNYQNEDEKVTLSFPST----LQTGTGTLKI-------DFVGELNDKMKGFYRSRYTTPAG-------------EVRYAAVTQFEATDARRAFPCWD--EPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGV---CVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIE--YLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEV--------SVGHPSEVDEIFDAISYSKGASVIRMLHDYIGD----KDFKKGMNMYLTKFQQKNA---------------------ATEDLWESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRVLKLSQKKFCASGPYGGEDCPQWMVPITISTSE 551          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Match: Npepps (aminopeptidase puromycin sensitive [Source:MGI Symbol;Acc:MGI:1101358])

HSP 1 Score: 58.151 bits (139), Expect = 6.621e-8
Identity = 94/407 (23.10%), Postives = 155/407 (38.08%), Query Frame = 3
Query:  570 SRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKT-----TVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKL--LLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQF----HHRIRGCFEYTGPIEVVTQE 1736
            +R  FPC D  EP    T+ I + V +D VA+SN  ++D    PD  N V   F + PV ++  +  VVGE++         V   C   + P+ K       +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++   YL       EY    +    +    +E +      P+E         S+      +  + A+   K A +IR+L   +G     K F+K   + L K  Q  +                       E L  +++  SG  I   +  W  + G   I  E +      V +LS K+F     +    C ++  PI + T E
Sbjct:  185 ARRAFPCWD--EPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGV---CVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIE--YLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEV--------SVGHPSEVDEIFDAISYSKGASVIRMLHDYIGD----KDFKKGMNMYLTKFQQKNA---------------------ATEDLWESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRVLKLSQKKFCASGPYGGEDCPQWMVPITISTSE 551          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Match: Npepps (aminopeptidase puromycin sensitive [Source:MGI Symbol;Acc:MGI:1101358])

HSP 1 Score: 57.7658 bits (138), Expect = 8.008e-8
Identity = 94/407 (23.10%), Postives = 155/407 (38.08%), Query Frame = 3
Query:  570 SRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKT-----TVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKL--LLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQF----HHRIRGCFEYTGPIEVVTQE 1736
            +R  FPC D  EP    T+ I + V +D VA+SN  ++D    PD  N V   F + PV ++  +  VVGE++         V   C   + P+ K       +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++   YL       EY    +    +    +E +      P+E         S+      +  + A+   K A +IR+L   +G     K F+K   + L K  Q  +                       E L  +++  SG  I   +  W  + G   I  E +      V +LS K+F     +    C ++  PI + T E
Sbjct:  185 ARRAFPCWD--EPAIKATFDISLVVPKDRVALSNMNVIDRKPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGV---CVRVYTPVGKAEQGKFALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIE--YLCVDHCFPEYDIWTQFVSADYTRAQELDALDNSHPIEV--------SVGHPSEVDEIFDAISYSKGASVIRMLHDYIGD----KDFKKGMNMYLTKFQQKNA---------------------ATEDLWESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDDRVLKLSQKKFCASGPYGGEDCPQWMVPITISTSE 551          
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q6P1X5|TAF2_HUMAN (Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 561/985 (56.95%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + I + + A  Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W ++ ELK LK+ + FSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+SNG L+++VYT D+  K +HY L  P  AS I + +G FEI  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  NLLH   ++D++ +T + +A ++ +QFFG F    +W   WV  GISGY+  L++K   G+NEY+  IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y +M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  +I  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F +  +Y LQ ++   +ALL+  H LCP ++ T + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +  +L+ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G++  +P +F  Y    +  D+R  AL  ++      ++YE L+WL+  +I  D     +R   +N L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   24 RPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIY---------RVRINDLEAAFIYNDPTLEVCH-SESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLL-NMIQNDPV-PYVRHKILNMLT---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 974          
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q5ZIT8|TAF2_CHICK (Transcription initiation factor TFIID subunit 2 OS=Gallus gallus OX=9031 GN=TAF2 PE=2 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 330/985 (33.50%), Postives = 559/985 (56.75%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G+ E+ I+P    + RI LN+KQ RI+          + + + + A  Y+DP + +         NL+ F   + ++   VD + G GEL +++P + W ++ ELK LK+ + FSL +PK GL+FV PN   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+SNG L+++VYT D+  K +HY L  P  AS I + +G FEI  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  NLLH   ++D++ +T + +A A+ +QFFG F    +W   WV  GISGY+  L++K   G+NEY+  IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  KT  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++   + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +  +L+ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G++  +P +F  Y    +  DVR  AL  ++      ++YE L+WL+   ++++     +R   ++ L    K   ++ N +    +     + +L++ ++   S DWRLR   + L
Sbjct:   14 RPYKLTHQVVCINNINFQRKSVVGYVELTIFPTVANLNRIKLNSKQCRIY---------RVRVNDLEAAFIYNDPTLEVCHHESKQR-NLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKVHINFSLDQPKGGLHFVVPNMEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEYTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLAIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKQELDQIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQSDFMWQYQLRYERDVVAQEEAILALEKFPTPASRLALTDILEQEQCFYRVRMLACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMNFQSYFLQKTMPVAMALLRDVHNLCPKEVLMFILDLIKYNDNRKNKFSDNYYRAELIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLKAIRVLQKNGHVPSDPALFKSYAEYGHFVDVRIAALEAVVDYTKVDRSYEELQWLLT--MVQNDPVPYIRHKILDMLT---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTSHDWRLRCGAVDL 964          
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q8C176|TAF2_MOUSE (Transcription initiation factor TFIID subunit 2 OS=Mus musculus OX=10090 GN=Taf2 PE=2 SV=2)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 328/985 (33.30%), Postives = 558/985 (56.65%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL----ECKTLP--NYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + I + + A  Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W ++ ELK LK+ + FSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+SNG L+++VYT D+  K +HY L  P  AS I + +G FEI  DP +  VTHFC P+ +PLLK T   + ++F+F E+ L   YP+  +KTVF+D A+ +  +YASM+IF  NLLH   ++D++ +T + +A A+ +QFFG F    +W   WV  GISGY+  L++K   G+NEY   IK+E+D++V YE + GG++L P+    + K  P  +  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ W+++ G V+    + FNR+RNV EL +KQ  +   G  +Y GP++V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   ++D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  +I  +      +    L DI +  + FY+ R+ A   +  I N++     G   ++ +FT ++  KT  +++ +N+F +  +Y LQ ++   +ALL+  H LCP ++ T + +L+ YNDN  N++SD YY+AE+I ++ +++   V    +  +L+ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G++  +  +F  Y    +  D+R  AL  ++      ++YE L+WL+  +I  D     +R   +N L    K   ++ N +    +     + +L++ ++   + DWRLR   + L
Sbjct:   14 RPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIY---------RVRINDLEAAFIYNDPTLEVCH-SESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYIHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYHHWIKEELDKIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYTMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHM----------WSQMLVSTYGFLKSISNVSGKDIQPLIKQWLDQSGVVKFYGSFAFNRKRNVLELEIKQ-DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMEADSPLLWIRIDPDMSVLRKVEFEQADFMWQYELRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKTCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMIDALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDASLFKSYAEYGHFVDIRIAALEAVVDYTKVDRSYEELQWLL-NMIQTDPV-PYVRHKILNMLT---KNPPFTKNMES--PLCNEALVDQLWKLMNSGTAHDWRLRCGAVDL 964          
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q32PW3|TAF2_DANRE (Transcription initiation factor TFIID subunit 2 OS=Danio rerio OX=7955 GN=taf2 PE=2 SV=2)

HSP 1 Score: 557.755 bits (1436), Expect = 9.944e-179
Identity = 327/985 (33.20%), Postives = 547/985 (55.53%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL------ECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN ++F    + G+ E+ I+P    + RI LN+KQ RI+          + + + +    Y+DP + +         NL+ F   + ++   VD + G GEL++++P + W    E+K +K+ +EFSL +PK GL+FV P+   N      ++F+    N SR WFPCVD  +E CTWK+E TV+  MVA+S G L+++VYT D+  K YHY L  P  A  I M VG FEI  DP +  VTHFC P+ +PLLK T+  + +IF+F E+ L   YP+  +KTVFVD A+    SYASM+IF  NLLH   ++DQ+ +T   +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+  IK+E+D++V YE + GG++L P       +    P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +L+       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +           L DI + ++ FY+ R+ A   +  I N++     G   ++ +FT ++  K+  +++ +N+F +  +Y LQ +I   +A L+    LCP ++ + + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L +++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ+ G+I  +P +F  Y    +  DVR  AL  +I      ++   L+WL+ +++  D     +R + ++ L       N    +     +     + +L++ ++     DWRLR   + L
Sbjct:   13 RPYKLTHQVVCINNVNFQRKSVIGYVELTIFPTVVNLNRIKLNSKQCRIY---------RVRVNDLEAPFIYNDPTLEVCHHESKQR-NLNYFSSAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVMKVYIEFSLDQPKGGLHFVVPDVEGNMAERAAHVFSFGNQNSSRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTYHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHTMSYLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSGLIIDQTPMTRSFLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGVNEYRHWIKEELDKIVEYELKIGGVLLHPTFSGGKEKDNPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHM----------WSQMLVSTSGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEEAILALEKFPTPPSRRALTDILEQDQCFYKVRMHACFCLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFISFQSYFLQKTIPVAMAQLRDVQNLCPREVLSFILDLIKYNDNRKNKFSDNYYRAELIDALTNSLTPAISINNEVRTVDSLNADVRLILEEITRFLNMEKLLPSYRNTITVSCLRAIRMLQKNGHIPSDPTLFKSYAEYGHFVDVRIAALEAVIDYTRVDRSSSELQWLL-DLVQNDPVH-YVRHEILSMLA-----KNPPFTKAADSSLCNEALVDQLWKLMNSGTCHDWRLRCDAVNL 963          
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Match: sp|Q24325|TAF2_DROME (Transcription initiation factor TFIID subunit 2 OS=Drosophila melanogaster OX=7227 GN=Taf2 PE=1 SV=2)

HSP 1 Score: 543.117 bits (1398), Expect = 6.966e-173
Identity = 333/986 (33.77%), Postives = 529/986 (53.65%), Query Frame = 3
Query:   51 MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXX--XXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPN--------------------YSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGV---FHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQD----IYRMYWS-QKLP 2909
            +R + +++Q + +  I F+   I G  E+ I P    +  I LNAKQ+RI+S  L    N++   +     +Y DPF  I  K ++    L+ + K H+++A+  D +   GEL +Q+PP+ +S I E + L++ +EFSL  PK G++FV P  +       N +++FT+   N SRLWFPCVD  A+PCTW++E TV+++M A+S G LL+ + TPDL  K +HY +  PV A  I + VG+FEIY DP +  VTHFC P  +PLLK TV  + + F+F E+ L+  YPF  YK VFVD    D  +YA+M+I  +NLLH   ++DQ+ I+   M+ A+ EQFFG F     W   W+  GI+ YL  LY +   G NEY+  ++ E+  VV YEEQ GGI+LD   C   P                     + F +      +  YV   ++KA  +IR+LE ++G  ++++VF K L LA  A  T + +             + LL+   +   A+  V+G  ++ F++ WV   GH +      FNR+RN  EL ++Q +   RG  +Y GP+ V  QE +G F+  ++I+  +  S      DI  H+K R+++K+K+ L  G EVD+DL   D D P LWI LD  M L   + + QPD      LRHE+D  AQ  AI+ +      +    L D  ++ + FYQ R +AA  +  + N +     G   + ++F   + + +   +I  N+F N   Y LQ +I   +A L+TSHG+CP ++   LF+L  YN+NS N Y+D YY+A ++ ++G+ +   V    H    + + L ++ K++L +V R L +++ +P+YK+ ++  CL ++R+LQ++G++   P I+  Y       D+R  A+ CL+  V      E LE L+   +++       R      L+D       S +R D    + R+++S  +LP
Sbjct:   12 LRPFKLAHQVVSLTGISFERRSIIGVVELTIVPNSENLRLIRLNAKQLRIYSVVL----NDVCQAD----FTYFDPFQNICYK-EHKSRALEVYSKHHLTAAQYTDPDVNNGELLIQVPPEGYSMIQEGQGLRIRIEFSLENPKCGVHFVIPPASTDEETQMNSSHMFTNCYENSSRLWFPCVDSFADPCTWRLEFTVDKNMTAVSCGELLEVIMTPDLRKKTFHYSVSTPVCAPNIALAVGQFEIYVDPHMHEVTHFCLPGLLPLLKNTVRYLHEAFEFYEETLSTRYPFSCYKQVFVDELDTDISAYATMSIASVNLLHSIAIIDQTYISRTFMSRAVAEQFFGCFITSHHWSDTWLAKGIAEYLCGLYSRKCFGNNEYRAWVQSELARVVRYEEQYGGIILD---CSQPPAPLPVSGTNQSAASSKQQEIVHYFPIKSLHTVSPKYVEAMRRKAHFVIRMLENRIGQELLIQVFNKQLALASSAATTKIGAGL----------WSQLLISTNIFIKAIFTVTGKDMSVFMDQWVRTGGHAKFSLTSVFNRKRNTIELEIRQDYVNQRGIRKYNGPLMVQLQELDGTFKHTLQIESTLVKS------DITCHSKSRRNKKKKIPLCTGEEVDMDLSAMD-DSPVLWIRLDPEMILLRDLIIEQPDFQWQYQLRHERDVTAQFQAIQALQKYPTNATRLALTDTIESERCFYQVRCEAAHSLTKVANQMVASWSGPPAMLNIFRKFFGSFSAPHIIKLNNFSNFQLYFLQKAIPVAMAGLRTSHGICPPEVMRFLFDLFKYNENSRNHYTDAYYRAALVEALGETLTPVVSVAIHGTQITTDSLSTDAKLVLDEVTRLLNMEKHLPSYKYMVSVSCLKVIRKLQKFGHLPSLPHIYRSYAEYGIYLDLRIAAMECLVDFVKVDGRSEDLEHLI--TLLETDPDPAARHALAQLLIDNPPFTRESRSRLDKPNLVDRLWFSINRLP 966          
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A5J4NDT3 (Transcription initiation factor TFIID subunit 2 OS=Paragonimus westermani OX=34504 GN=DEA37_0011063 PE=4 SV=1)

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 387/1050 (36.86%), Postives = 598/1050 (56.95%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIME---------------------TDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDS-VYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLIS-HVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDT--------------------------SVDSNYNLA--------APVI-DEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGG----------LRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFS-----ARLRFDTVNGLVDK--FKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +++Q LCI  IDF+  ++ G T++VIWP  P++ +I+LN +Q RIH   L  + ++  + +                      DL + ++DP + I ++ D     LD+F + + S  ++ D ++  GE+T++IPPDFW  ++  +P++L +EFSL +PK+G YFV P  + +    G + FT+T+ + SRLWFPC+DC+EPCTWKIE+TVNEDMV ++ G LLD+  YT DL +K YH+++ QPV A  IG+ VG F +YPDP++S H THFCP   +PLL+ TV  +P I ++ E  L   YPF   KTVFVD A+ DF +YAS+ IF ++LLH   ++DQ++ T K++++AI  QFFG F  M+ W  AW+  GI+GYL  LY K + G+NEY+  +  EM  V  YE    GI+LDP +  T   + F L    A +  Y+  + KKA L+IR+LEL+ G  ++L+V  KLL+LA+++ ++                          +VDS   L          P + DE++ NL+L     +  + +V+G  I NFLE WV   GHVR+ A++ FNR+RNV EL +KQ   + RG   YTGP+ V+ QE +G F+   +++      + R + D+P H+K RKHRK+++ L+NG EVD+DL   D++ P LW+ LD ++ +   + + QPD +  L+L H++D L Q+ A   +           L  +  N + FY+ R+ A   +  I N +  V  G           L  +F  L+ +   + +I  N+FKNL NY L  +I R LA L+    +CP ++ + L +LL +NDNS N YSD YY+A++IR+M D +   +  RG  S   LP E + ++++V   L LD  +P+Y+ T+T  CL  +R+LQ  G++  +P +FY Y S    +D+R  +L CL+  V G ++   L+W+  EVI +D  +     ARLRF+ V  L+    F+     S      R+   Q +  L+  ++   + D RLRSAV  L
Sbjct:   46 RGFRLAHQNLCITHIDFEQRFLVGFTQLVIWPTAPSLRKIYLNCRQCRIHRVLLEAVDSKPDVFDHNHPGTNFKWAGSKSVRLPAPMDLPVVHNDPSLEICKR-DTKLRTLDSFQRRYTSVIEQTDPDKEAGEVTIRIPPDFWPLVTACRPIQLTLEFSLNKPKSGFYFVVPPGDGSLTDRGVHAFTATIPHASRLWFPCIDCSEPCTWKIEVTVNEDMVVVAPGELLDAPYYTEDLSSKTYHFYVAQPVAAPYIGLAVGAFVVYPDPVLSNHATHFCPCGLLPLLQHTVAPIPDIIEYFEAILASQYPFSTIKTVFVDRAYNDFQAYASLLIFPVDLLHSPQIIDQAIETRKLISVAIASQFFGCFLSMQTWCDAWLTTGIAGYLSGLYQKRVFGVNEYRRIVLDEMHHVTTYEHTKYGILLDPSKSTTKLTH-FGLNSPHAISPNYLVAFIKKAHLVIRMLELRFGQPVLLQVLNKLLVLARLSANSTSSGRNESCDTEDQTSGEPARNAPTETVDSVATLGIGSDSRDVPPCLSDENQANLILSTGSFRRIISMVTGQDIYNFLEQWVFNSGHVRLFAKFHFNRKRNVVELELKQ-DLQSRGTLNYTGPLTVMLQELDGAFKHTFKLE------EGRTLRDLPCHSKSRKHRKKRIPLANGDEVDMDLARIDAESPLLWVRLDPDLGIIHTMHIDQPDFMWHLMLIHDRDCLGQLEACRALRDFPSPETRHALVSVITNERAFYRVRMNACFTLCHIANELSAVGTGQAATSNAATSCLLPIFWQLFSSPAARGLIRQNNFKNLQNYFLMRAIFRSLATLRVQQ-VCPREVLSFLSDLLRHNDNSRNLYSDCYYRADLIRTMKDTLTPTIVVRGVMSASSLPMEARTVVEEVTHHLNLDTQIPSYRGTVTVACLEAIRKLQRLGFLPVDPTLFYRYASSGLYHDIRLASLECLVDYVRGERDQPSLDWIFDEVIERDDSASDASYARLRFEAVQLLIQTPPFQRTETGS------RLDTPQLVERLWNLMNYGCAGDSRLRSAVADL 1079          
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A4E0RFG7 (Transcription initiation factor TFIID subunit 2 OS=Fasciola hepatica OX=6192 GN=D915_002909 PE=4 SV=1)

HSP 1 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 389/1067 (36.46%), Postives = 593/1067 (55.58%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIME------------------TDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDS-VYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISH-VTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQD--------------------------------------------TSVDSNYNLAAP--VIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGG--------------------LRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFS----ARLRFDTVNGLVD--KFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +++QTLCI +IDF++  + G T+++IWPL   + RIH+N +Q RIH   L     ++   E                   DL +  +DP + I ++ D     LD+F + H S  +  D ++  GE+T+++PP+FW  IS  +PLKL +EFSL +P++G YFV P    +    G + FT T+ N SRLWFPC+DC+EPCTWKIE+TV EDMVA++ G L+D+  YT DL +K YH++L QPV A  IG+ VG F+IYPDPL+++  THFCP   +PL+K TV  +P + ++ E  L   YPF   KTVFVD A+ DF +YAS+ +F + +LH   ++DQ++ T K++++A+  QFFG F  M+ W  AW+P G++GYL  LY K + G NEY+  I  EM  V NYE    GI+LDP + +T     FSL      + TY+  + KKA L+IR+LEL+ G  ++L+V  KLL+LA+++                                              +S   N +L  P  + DEH+TNL+L     +  + +V+G  I NFL+ WV   GHVR+ A + FNR+RNV EL +KQ  H  RG   YTGP+ V+ QE +G F    +++      + R   D+P H+K RKHRK+K+ L+NG EVD+DL   D++ P LW+ LD ++ +   I + QPD +  L+L H++D L Q+ A+  + +   A     L  +  N ++FY+ R+ A   +  I N +  V  GG                    L  +F  L+ +   +++I  N+F+NL +Y L  ++IR LA L+    +CP ++   + +LL  NDNS N YSD YY+A++I+++ D +   +  RG  S   LP E + ++++V   L LD  + +Y+ T+T  CL  +RRLQ  G++  +P +FY Y S    +D+R   L  L+  + G ++ + L+W+  EVI +D  S     +LRF+ V  L+    F+     S      R+   Q +  L+  ++   S D RLRSAV  L
Sbjct:   26 RWFRLAHQTLCITEIDFEHRILIGFTQLIIWPLTNGLRRIHVNCRQCRIHRVLLEAADTDLDSFERSTSDRYLGSKLAYLPSPVDLPVVQNDPSLEICKR-DTKLRTLDSFQRRHASVVEMTDPDKEAGEVTIRVPPEFWPLISNSRPLKLTLEFSLNKPRSGFYFVVPPGEGSLADRGVHAFTGTVSNASRLWFPCIDCSEPCTWKIEVTVLEDMVAVAPGELIDAPYYTEDLQHKTYHFYLSQPVSAPYIGLAVGAFDIYPDPLLTNGSTHFCPSGLLPLMKHTVSHIPDMIEYYEALLASQYPFGTIKTVFVDRAYNDFQAYASLLVFPVEILHSAQIIDQAIETRKIISLAVASQFFGCFLTMQTWFDAWLPVGLAGYLSGLYQKRVFGNNEYRRIISNEMRYVTNYEFSRYGILLDPCK-RTTKTTHFSLASPHTISPTYLTAFVKKAHLVIRMLELRFGQPVLLQVLNKLLVLARLSASSILPSDEVTSKHTTNNEDANALRQSTGTTECVNELTSDENRRLGSSAGRNASLVVPPCLSDEHQTNLILSTTSFRRIISMVTGQDIQNFLDQWVTHSGHVRLSARFHFNRKRNVVELELKQDLHS-RGTLNYTGPLTVMLQELDGAFMHTFKLE------EGRTSRDLPCHSKSRKHRKKKIPLANGDEVDMDLGRIDAESPLLWLRLDPDLAVIRTIGVDQPDFMWHLMLAHDRDCLGQMEAVHALRSCPSAETRHALASLIANERVFYRVRMDACYALCHIANELSAV--GGTTGNSAPMGTSSNTNAATSCLFPIFWQLFSSPAARALIRQNNFQNLQHYFLMRAMIRSLATLRVQQ-VCPREVLAFVTDLLRQNDNSRNGYSDCYYRADLIKALKDTLTPAIVVRGVMSASSLPFEARTVVEEVAHHLNLDSQIVSYRGTVTVACLTAIRRLQRLGFLPVDPTLFYHYASPGLFHDLRIAGLEALVDYIRGERDQKALDWIFDEVIERDEISEVSYPKLRFEAVQLLIRMPPFQRGEAGS------RLDTPQLVERLWTLMNYGCSGDSRLRSAVADL 1074          
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A504Z4J3 (Transcription initiation factor TFIID subunit 2 OS=Fasciola gigantica OX=46835 GN=FGIG_07330 PE=4 SV=1)

HSP 1 Score: 681.019 bits (1756), Expect = 0.000e+0
Identity = 388/1067 (36.36%), Postives = 593/1067 (55.58%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIME------------------TDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDS-VYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISH-VTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQD--------------------------------------------TSVDSNYNLAAP--VIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGG--------------------LRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFS----ARLRFDTVNGLV--DKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +++QTLCI +IDF++  + G T+++IWPL   + RIH+N +Q RIH   L     ++   E                   DL +  +DP + I ++ D     LD+F + H S  +  D ++  GE+T+++PP+FW  IS  +PLKL +EFSL +P++G YFV P    +    G + FT T+ N SRLWFPC+DC+EPCTWKIE+TV EDMVA++ G L+D+  YT DL +K YH++L QPV A  IG+ VG F+IYPDPL+++  THFCP   +PL+K TV  +P + ++ E  L   YPF   KTVFVD A+ DF +YAS+ +F + +LH   ++DQ++ T K++++A+  QFFG F  M+ W  AW+P G++GYL  LY K + G NEY+  I  EM  V NYE    GI+LDP + +T     FSL      + TY+  + KKA L+IR+LEL+ G  ++L+V  KLL+LA+++                                              +S   N +L  P  + DEH+TNL+L     +  + +V+G  I NFL+ WV   GHVR+ A + FNR+RNV EL +KQ  H  RG   YTGP+ V+ QE +G F    +++      + R   D+P H+K RKHRK+K+ L+NG EVD+DL   D++ P LW+ LD ++ +   I + QPD +  L+L H++D L Q+ A+  + +   A     L  +  N ++FY+ R+ A   +  I N +  V  GG                    L  +F  L+ +   +++I  N+F+NL +Y L  ++IR LA L+    +CP ++   + +LL  NDNS N YSD YY+A++I+++ D +   +  RG  S   LP E + ++++V   L LD  + +Y+ T+T  CL  +RRLQ  G++  +P +FY Y S    +D+R   L  L+  + G ++ + L+W+  E+I +D  S     +LRF+ V  L+    F+     S      R+   Q +  L+  ++   S D RLRSAV  L
Sbjct:    6 RWFRLAHQTLCITEIDFEHRILIGFTQLIIWPLTNGLRRIHVNCRQCRIHRVLLEAADTDLDSFERSTSDKYLGSKLTYLPSPVDLPVVQNDPSLEICKR-DTKLRTLDSFQRRHASVVEMTDPDKEAGEVTIRVPPEFWPLISNSRPLKLTLEFSLNKPRSGFYFVVPPGEGSLADRGVHAFTGTVSNASRLWFPCIDCSEPCTWKIEVTVLEDMVAVAPGELIDAPYYTEDLQHKTYHFYLSQPVSAPYIGLAVGAFDIYPDPLLTNGATHFCPSGLLPLMKHTVSHIPDMIEYYEALLASQYPFGTIKTVFVDRAYNDFQAYASLLVFPVEILHSAQIIDQAIETRKIISLAVASQFFGCFLTMQTWFDAWLPVGLAGYLSGLYQKRVFGNNEYRRIISNEMRYVTNYEFSRYGILLDPSK-RTTKTTHFSLASPHTISPTYLTAFVKKAHLVIRMLELRFGQPVLLQVLNKLLVLARLSASSILPSDEVTSTHTTNNEDANALRQPTGTTECVNELTSDENRRLRSSTGRNTSLVVPPCLSDEHQTNLILSTTSFRRIISMVTGQDIQNFLDQWVTHSGHVRLSARFHFNRKRNVVELELKQDLHS-RGTLNYTGPLTVMLQELDGAFMHTFKLE------EGRTSRDLPCHSKSRKHRKKKIPLANGDEVDMDLGRIDAESPLLWLRLDPDLAVIRTIGVDQPDFMWHLMLAHDRDCLGQMEAVHALRSCPSAETRHALASLIANERVFYRVRMDACYALCHIANELSAV--GGTTGNSAPMGTSSNTNAATSCLFPIFWQLFSSPAARALIRQNNFQNLQHYFLMRAMIRSLATLRVQQ-VCPREVLAFVTDLLRQNDNSRNGYSDCYYRADLIKALKDTLTPAIVVRGVMSASSLPFEARTVVEEVAHHLNLDSQIVSYRGTVTVACLTAIRRLQRLGFLPVDPTLFYHYASPGLFHDLRIAGLEALVDYIRGERDQKALDWIFDELIERDEISEVSYPKLRFEAVQLLIRMPPFQRGETGS------RLDTPQLVERLWTLMNYGCSGDSRLRSAVADL 1054          
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A4V3SC14 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010512 PE=4 SV=1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 389/1041 (37.37%), Postives = 584/1041 (56.10%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIH---------------------STQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDS-VYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISH-VTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMA---------------QDTSV----DSNYNLAAP--------VIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVN--QGG--------LRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMK----DSFSARLRFDTVNGLV--DKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +S+Q LCI +IDF+   + G T++++WP    + R+HLN +Q RIH                     S +  +       + TDL + YHDP + I  + D     LD F + H   A++ D ++  GE+T++IPPDFW  IS  +P ++ +EFSL +PK+G YFV P    +    G + FT++M N SRLWFPC+DCAEPCTWKIEITV EDMVA++ G LLD+  YT DL +K YH+++ QPV A  IG+ VG FE+YPDP++S+  THFCP   + LLK TV  +P I +  E  L   YPF    TVFVD A+ DF ++AS+ IF ++LLH + ++DQ++ T KV+++AI  QFFG F     W  AW+P GI+GYL  LY K + G NEY+  I+ +M  V NYE    GI+LDP +      + F L      +  Y+  + KK+ L+IR+LEL+ G  ++L+V  KLL+LA+++               +D S+      +Y   AP        + DE++ NLLL     +  + +V+G  I NFL+ WV + GHVR+  ++ FNR+RNV EL +KQ   + RG   YTGP+ V+ QE +G F    +++      + R+  D+P H+K RKHRK+++ L+NG EVD+DL   D++ P LW+ +D ++ +   I + QPD +  L+L H++D L Q+ A   +           L ++  N +IFY+ R  A   +  I N +  ++  QG         L  +F  L+ +   + ++  N+FK+L +Y L  +I R LA L+    +CP ++   +  LL +NDN+ N YSD  Y A++IR+M D +   +  RG  S   LP E + ++++V+  L LD   P+YK TIT  CL  +RRLQ  G++  +P +FY Y S  + YDVR   L CL+  V G ++   L+W+  E+I +    DS  ARLRF+ V  L+    F+     S      R+   Q +  L+  ++     D RLR AV  L
Sbjct:   22 RGFRLSHQNLCITQIDFEQRLLVGFTQLILWPTTSDLRRVHLNCRQCRIHRVLLEPADPNAEAYEQAVSGASVKWTSAKTHRFPVPTDLPVIYHDPSLEICSR-DTKLRTLDCFQRDHTLVAEKTDPDKHAGEVTVRIPPDFWPLISFGRPFRITLEFSLNKPKSGFYFVVPPGEGSLVDRGVHAFTASMPNSSRLWFPCIDCAEPCTWKIEITVFEDMVAVAPGELLDAPYYTEDLTHKTYHFYVAQPVAAPYIGLAVGAFEVYPDPVLSNNATHFCPGGLLNLLKHTVSHLPDIIEHFEALLASQYPFSTINTVFVDRAYSDFQAFASLLIFPVDLLHSSRIIDQAIETRKVLSLAISSQFFGCFIAGHTWCDAWLPMGIAGYLSGLYQKRVFGNNEYRRIIRNDMFHVTNYEHTKYGILLDPSKINNRTAH-FGLKSPHTISPNYLTAFIKKSHLVIRMLELRFGQPVLLQVLNKLLVLARLSASSVLPNGSIASGNHRDESIAHDEQPDYTSTAPDCSNVPPCLSDENQANLLLSTASFRRIILMVTGQDIQNFLDQWVFRTGHVRLFVKFHFNRKRNVVELELKQ-DLQSRGTLSYTGPLTVMLQELDGAFMHTFKLE------EGRMARDLPCHSKSRKHRKKRIPLANGDEVDMDLGRIDAESPLLWVRMDPDLAVIHTIYVEQPDFMWHLMLLHDRDCLGQLEATHALRDFPSPETRHALANVIANERIFYRVRTDACFSLCHIANELSAMSGAQGTTANAATSVLLPLFWQLFSSPAARGLVRQNNFKHLQHYFLMRTICRSLATLRVQQ-VCPREVLPFISELLRHNDNTRNEYSDYCYLADLIRTMKDILTPAIVVRGVMSSSSLPVEARTVIEEVVHHLNLDTQTPSYKGTITVVCLATIRRLQRLGFLPVDPSLFYLYASPGFFYDVRLAGLECLVDYVRGERDQPALDWIFNEIIERDDGTDSSHARLRFEAVQLLLRMPPFQRGETGS------RLDTPQLVCRLWNLMNYGCGGDSRLRCAVADL 1046          
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Match: A0A1S8X807 (Peptidase family M1 OS=Opisthorchis viverrini OX=6198 GN=X801_01277 PE=4 SV=1)

HSP 1 Score: 669.463 bits (1726), Expect = 0.000e+0
Identity = 388/1040 (37.31%), Postives = 581/1040 (55.87%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIH---------------------STQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDS-VYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISH-VTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMA----------------QDTSV----DSNYNLAAP--------VIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVN--QGG--------LRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMK----DSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +S+Q LCI +IDF+   + G T++++WP    + R+HLN +Q RIH                     S +  +       + TDL + YHDP + I  + D     LD F + H   A++ D +   GE+T++IPPDFW  IS  +P ++ +EFSL +PK+G YFV P    +    G + FT++M N SRLWFPC+DCAEPCTWKIEITV EDMVA++ G LLD+  YT DL +K YH+++ QPV A  IG+ VG FE+YPDP++S+  THFCP   + LLK TV  +P I +  E  L   YPF    TVFVD A+ DF ++AS+ IF ++LLH + ++DQ++ T K++++AI  QFFG F     W  AW+P GI+GYL  LY K + G NEY+  I K+M  V NYE    GI+LDP +      + F L      +  Y+  + KK+ L+IR+LEL+ G  ++L+V  KLL+LA+++                +D S+      +Y L AP        + DE++ NLLL     +  + +V+G  I NFL+ WV + GHVR+  ++ FNR+RNV EL +KQ     RG   YTGP+ V+ QE +G F    +++      + R+  D+P H+K RKHRK+++ L+NG EVD+DL   D++ P LW+ +D ++ +   I + QPD +  L+L H++D L Q+ A   +           L ++  N ++FY+ R  A   +  I N +  +   QG         L  +F  L+ +   + ++  N+FK+L +Y L  +I R LA L+    +CP ++   +  LL +NDN+ N YSD  Y A++IR+M D +   +  RG  S   LP E + ++++V+  L LD   P+YK TIT  CL  +RRLQ  G++  +P +FY Y S  + YDVR   L CL+  V G ++   L+W+  EVI +    DS  ARLRF+ V   +   +M  +        R+   Q +  L+  ++     D RLR AV  L
Sbjct:   33 RGFRLSHQNLCITQIDFEQRLLVGFTQLILWPTTSDLRRVHLNCRQCRIHRVLLEPADPNAEAYEQAVSGSSVKWTSAKTHRFPVPTDLPVIYHDPSLEICSR-DTKLRTLDCFQRDHTLVAEKTDPDIHAGEVTIRIPPDFWPLISFGRPFRITLEFSLNKPKSGFYFVVPPGEGSLVDRGVHAFTASMPNSSRLWFPCIDCAEPCTWKIEITVFEDMVAVAPGELLDAPYYTEDLTHKTYHFYVAQPVAAPYIGLAVGAFEVYPDPVLSNNATHFCPGGLLNLLKHTVSHLPDIIEHFEALLASQYPFSTINTVFVDRAYSDFQAFASLLIFPVDLLHSSRIIDQAIETRKILSLAISSQFFGCFITGHTWCDAWLPMGIAGYLSGLYQKRVFGNNEYRRIICKDMLHVTNYEHTKYGILLDPSKITNRTAH-FGLKSPHTISPNYLTAFIKKSHLVIRMLELRFGQPVLLQVLNKLLVLARLSASSVLPNGSIASSGNHKDESIAHDEQPDYTLTAPDCSNVPPCLSDENQANLLLSTSSFRRIILMVTGQDIQNFLDQWVFRTGHVRLFVKFHFNRKRNVVELELKQ----SRGTLSYTGPLTVMLQELDGAFMHTFKLE------EGRMARDLPCHSKSRKHRKKRIPLANGDEVDMDLGRIDAESPLLWVRMDPDLAVIHTIYVEQPDFMWHLMLLHDRDCLGQLEATHALRDFPSPETRHALANVIANERVFYRVRTDACFSLCHIANELSAMGGAQGTSANAATSVLLPLFWQLFSSPAARGLVRQNNFKHLQHYFLMRAICRSLATLRVQQ-VCPREVLPFISELLRHNDNTRNEYSDYCYLADLIRTMKDILTPAIVVRGVMSSSSLPIEARTVIEEVVHHLNLDTLTPSYKGTITVVCLATIRRLQRLGFLPVDPSLFYLYASPGFYYDVRLAGLECLVDYVRGERDQPALDWIFNEVIERDDGTDSSHARLRFEAVQMFL---RMPPFQRGETG-SRLDTPQLVCRLWNLMNYGCGGDSRLRCAVADL 1055          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:103035672])

HSP 1 Score: 553.132 bits (1424), Expect = 6.461e-178
Identity = 329/985 (33.40%), Postives = 551/985 (55.94%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL------ECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R Y +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+  ++  L       +  L + +H+     S++ + N+F+       + ++   VD + G GEL++++P + W    E+K LK+ +EFSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+S G L+++VYT D+  K +HY L  P  A  I M VG FEI  DP +  VTHFC P+ +PLLK ++  + +IF+F E+ L   YP+  +KTVFVD A+ +  S ASM+IF  N+LH   ++DQ+ +T + +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+  IK+E+D +V+YE + GG++L P       +    P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +LL       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG E+D+DL   DSD P LWI +D +M +  K++  Q D +    LR+E+D +AQ  AI  +     A+    L DI + ++ FY+ R+QA   +  I N +     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++   + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ  G+I  +P +F  Y    +  DVR  AL  ++      ++ +  +WL+ +++  D     +R   ++ L       N    R     +     + +L++ ++   S DWRLR   + L
Sbjct:   13 RPYKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHHE-----SKQRNLNYFS-----SAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVLKVYIEFSLDQPKGGLHFVVPDVEGSMAERGAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTFHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYMEVSSSASMSIFSTNMLHSGMIIDQTPMTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLYLKKTFGVNEYRHWIKEELDRIVDYELKMGGVLLHPTFTGGKEKENPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLANTASSQKYQSHM----------WSQMLLSTSGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEIDMDLSAMDSDSPLLWIRIDPDMAILRKVEFEQADFMWQYQLRYERDVVAQEEAISALEKFPTAASRLALTDILEQDQCFYKVRMQACFCLAKIANAMMSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMNFQSYFLQKTMPVAMALLRDVHNLCPKEVLNFILDLIKYNDNRKNKFSDNYYRAELIDALTNSLTPAISINNEVRTIDSLNPDVRLILEEITRFLNMEKLLPSYRNTITVSCLRAIRMLQRNGHIPSDPSLFKSYAEYGHFVDVRVAALDAVVDYTRVERSADEFQWLL-DMVQNDPIHY-VRHKILSLLA-----KNPPFTRAAESSLCNEALVDQLWKLMNSGTSHDWRLRCGAVNL 963          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:103035672])

HSP 1 Score: 536.569 bits (1381), Expect = 6.033e-173
Identity = 321/964 (33.30%), Postives = 538/964 (55.81%), Query Frame = 3
Query:  117 ICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL------ECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            + G  E+ I+P    + RI LN+KQ RI+  ++  L       +  L + +H+     S++ + N+F+       + ++   VD + G GEL++++P + W    E+K LK+ +EFSL +PK GL+FV P+   +    G ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+S G L+++VYT D+  K +HY L  P  A  I M VG FEI  DP +  VTHFC P+ +PLLK ++  + +IF+F E+ L   YP+  +KTVFVD A+ +  S ASM+IF  N+LH   ++DQ+ +T + +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+  IK+E+D +V+YE + GG++L P       +    P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +LL       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG E+D+DL   DSD P LWI +D +M +  K++  Q D +    LR+E+D +AQ  AI  +     A+    L DI + ++ FY+ R+QA   +  I N +     G   ++ +FT ++  K+  +++ +N+F N  +Y LQ ++   +ALL+  H LCP ++   + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L  ++++IL+++ R L +++ +P+Y+ TIT  CL  +R LQ  G+I  +P +F  Y    +  DVR  AL  ++      ++ +  +WL+ +++  D     +R   ++ L       N    R     +     + +L++ ++   S DWRLR   + L
Sbjct:    1 VIGFVELTIFPTVVNLNRIKLNSKQCRIYRVRVNDLEAPFIYNDPTLEVCHHE-----SKQRNLNYFS-----SAYTAAVSAVDPDAGNGELSIKVPSELWKQGDEMKVLKVYIEFSLDQPKGGLHFVVPDVEGSMAERGAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETVYTHDMRKKTFHYMLPIPTAAPNISMAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYMEVSSSASMSIFSTNMLHSGMIIDQTPMTRRCLAQALAQQFFGCFISRMSWSDEWVLKGISGYIYGLYLKKTFGVNEYRHWIKEELDRIVDYELKMGGVLLHPTFTGGKEKENPTPHLHFSIKHPHTLSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLANTASSQKYQSHM----------WSQMLLSTSGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEIDMDLSAMDSDSPLLWIRIDPDMAILRKVEFEQADFMWQYQLRYERDVVAQEEAISALEKFPTAASRLALTDILEQDQCFYKVRMQACFCLAKIANAMMSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMNFQSYFLQKTMPVAMALLRDVHNLCPKEVLNFILDLIKYNDNRKNKFSDNYYRAELIDALTNSLTPAISINNEVRTIDSLNPDVRLILEEITRFLNMEKLLPSYRNTITVSCLRAIRMLQRNGHIPSDPSLFKSYAEYGHFVDVRVAALDAVVDYTRVERSADEFQWLL-DMVQNDPIHY-VRHKILSLLA-----KNPPFTRAAESSLCNEALVDQLWKLMNSGTSHDWRLRCGAVNL 930          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Match: taf2 (TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor [Source:NCBI gene;Acc:324486])

HSP 1 Score: 536.184 bits (1380), Expect = 4.723e-172
Identity = 322/925 (34.81%), Postives = 520/925 (56.22%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-------ECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMIL-KVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMW-----VNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGV-FHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLIS---AVDGMKNYEVLEWLM 2768
            R + +++Q L IN I+F    I GH E+ ++P   T+ +I LN KQ RI+          + + + + A  Y+DP + +  + +    NL+ F   + +S + V+ + G GEL +++P D   ++ E++ LK+ VEF +  PK GL FV P+          ++F+    N SR WFPC+D  +E C WK+E TV+  MVA+SNG L++++YT D+  K +HY L  P  A  I + VG FEI  DP +  VTHFC P+ +PLLK T   + +IF+F E+ L   YP+  YKTVFVD A+ +  SYASM+IF  NLLH   ++DQ+ IT K +A A+ +QFFG F    +W   WV  GISGY+  L++K   G NEY++ IKK +  V +YE Q GGI+L P        E  T P+  FS+ +    +  Y  +Y+ KA L++RL+E ++    +L +VF KLL LA  A      S+            + +LL       ++ +VSG  I   +  W      ++ G V+    + FNR+RN+ EL +KQ     +G  +Y GP+ V  QE +G F   ++I+      ++    +IP H+K R+++K+K+ L NG E+D+DL   D+D P LWI +D  M++  +++L QPD +    LR+E+D +AQ  AI  +           L DI ++ + FY+ R+Q+   +  I N +     G   ++ +FT ++  KT  ++I +N+F N  +Y L  +I   +A+ +  HG+CP ++ T L +L+ YNDN  N++SD YY+A +I ++ +++   V     + ++E L ++++++L+++ R L +++ +P Y+ T+T  CL  +R LQ+ G+I  +P IF  Y    +  D+R  AL  L+    AVD   + EVL+WL+
Sbjct:   27 RPFKLNHQVLSINNINFQKKSIIGHVELTLFPTTATLNKIRLNCKQCRIY---------RVRVNDKEAAFMYNDPTLEVCHQENKQR-NLNFFSNAYAASVQAVEPDYGNGELLIKVPSDLREHVEEMRMLKVHVEFWMDNPKGGLQFVVPDLEGTLAERAAHVFSYGHQNASRSWFPCIDSYSELCMWKLEYTVDASMVAVSNGDLVETIYTHDMRRKTFHYQLTTPTAAPNISLAVGPFEILVDPFMHEVTHFCLPQLLPLLKQTTSFLHEIFEFYEEVLTCRYPYTCYKTVFVDQAYVEATSYASMSIFSTNLLHGATIIDQTPITRKRIAKALAQQFFGCFISRMSWTDDWVLKGISGYIYGLWIKKTFGNNEYRYWIKKWLSRVTDYELQTGGILLHPTFPAGKEKESPT-PHLHFSVCYPHTLSWEYYKLYQAKAHLVLRLIENRISMEFLLQQVFNKLLSLANTASSQRFQSHM----------WSQMLLSTSAFLKSISIVSGKDIQPLIRQWWGGASSDQSGVVKFYGTFVFNRKRNILELELKQ-DCIAQGTQKYVGPLTVTVQELDGSFNHNLQIE------ENSTRHEIPCHSKSRRNKKKKIPLLNGEEIDMDLSLMDADSPLLWIRIDPEMSILRRVELEQPDFMWQYELRYERDVVAQGEAISALERFPTPQSRLALTDILEHEQCFYRVRMQSTFCLAQIANAMVNTWNGPPAMKSIFTRMFCCKTCPNIIKTNNFCNFQSYFLLKTIPVTMAMQRDIHGMCPKEVLTFLLDLIKYNDNRKNKFSDNYYRASLIEALANSVTPAVAVSNENRTVENLNADVRLVLEEITRFLNMEKLLPCYRHTVTISCLKAIRVLQKNGHIPSDPAIFKAYAQAGHFVDIRLAALEALVDFTRAVD--MSAEVLQWLL 921          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005578.1 (pep scaffold:Pmarinus_7.0:GL491533:415:5877:-1 gene:ENSPMAG00000005072.1 transcript:ENSPMAT00000005578.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 230.335 bits (586), Expect = 8.414e-69
Identity = 121/262 (46.18%), Postives = 163/262 (62.21%), Query Frame = 3
Query:  477 PKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDP 1259
            PK GL F+ P+          + F+    N SR WFPC+D  +E C WK+E TV+  MVA+SNG L++++YT D+  K +HY L  P  A  I + VG FEI  DP +  VTHFC P+ +PLLK T   + +IF+F E+ L   YP+  YKTVFVD A+ +  SYASM+IF  NLLH   ++DQ+ IT K +A A+ +QFFG F    +W   WV  GISGY+  L++K   G NEY++ IKK +  V +YE Q GGI+L P
Sbjct:    1 PKGGLQFLLPDLEGTLAERAAFFFSYGHQNASRSWFPCIDSYSELCMWKLEYTVDASMVAVSNGDLVETIYTHDMRRKTFHYQLTTPTAAPNISLAVGPFEILVDPFMHEVTHFCLPQLLPLLKQTTSFLHEIFEFYEEVLTCRYPYTCYKTVFVDQAYVEATSYASMSIFSTNLLHGATIIDQTPITRKRIAKALAQQFFGCFISRMSWTDDWVLKGISGYIYGLWIKKTFGNNEYRYWIKKWLSRVTDYELQTGGILLHP 262          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Yeast
Match: TAF2 (TFIID subunit (150 kDa); involved in RNA polymerase II transcription initiation [Source:SGD;Acc:S000000638])

HSP 1 Score: 72.0182 bits (175), Expect = 3.945e-13
Identity = 73/303 (24.09%), Postives = 135/303 (44.55%), Query Frame = 3
Query:  903 NYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSM----ILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSR 1799
            +YPF  Y  VF+  A      +A++ I +  LL+P  ++D++  T   +A A+  Q+             W   GI+GY+     K LMG N YK+ +K+  + +V  + +       P    T    S  + ++ + + +++ +   KA +I+ +L+ ++  +     + +V  K+ L A M+ D   +S                 L +   ++  + V+ S++ NF   WV   G   ++   +FNR+R V EL ++Q         E  G  +VV +  EGFF  K  +D   +P  +R
Sbjct:  469 SYPFTCYSMVFLPTAPSKHMDFAALGICNTRLLYPLEVIDKAFSTTNELAWALANQWSCVNITPLDMNDYWCCLGIAGYMVFQVTKKLMGNNTYKYQLKRNSEAIVEQDFEK------PPIGSTFTGSSRPISWS-SKDLSFIQL---KAPMILHILDRRMTKTERSFGMSRVLPKIFLQA-MSGDLPNNS-----------------LTSSHFQHVCERVNKSKLENFFNEWVYGSGVPILRVTQRFNRKRMVIELGIRQVQD------EELGHEKVVGE--EGFF--KSALDHLEHPDLNR 733          

HSP 2 Score: 66.2402 bits (160), Expect = 2.400e-11
Identity = 50/185 (27.03%), Postives = 91/185 (49.19%), Query Frame = 3
Query: 1917 YLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIE------TISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLR---DVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSM 2444
            + WI +D ++    ++ + QPD +    LR + D  AQ+ AI           V+   Y SIL   A + + F+  R+ A   +   + +      GG++    +F  L+  +   ++  SN+F+N   Y LQ +I + LA ++  +G CP  +   L ++L+YN+N  N+YSD  Y   +I ++
Sbjct:  840 FEWIRIDSDLEWICQMHINQPDYMFSSQLRQDGDIEAQLEAIRYYEDVVVNGGVKSLVYSSILFRTAIDERYFFGIRLAACEALSKYVYDPDFT--GGVKHLIQIFQILFCLEDS-NIPKSNNFENPKLYFLQCNIPKYLAKVKNENGKCPKLVKQFLLDILVYNENGENKYSDDAYVRSLIENV 1021          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Match: EDO32839 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STW0])

HSP 1 Score: 490.345 bits (1261), Expect = 1.314e-156
Identity = 324/1002 (32.34%), Postives = 501/1002 (50.00%), Query Frame = 3
Query:   72 NQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKS----DYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPL-----ECKTLPNYSFSLLFAQAANATYVAMYK------------KKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQ--VNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEF--LPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNR-------QDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            +QTLCI  IDF    + G  E+ + PL   + R+ LN KQ RI           + I E      Y   F           D    NLD F+    ++    D + G GEL ++IP +  S   E K  ++ +E+SL  P +G+ FV P  +        +LFT T  N SRLWFPCVD  AE CTW I+ITV++DMVA+S G L+D V+T D   K +HY L  P  A  I + VG FEIY DP++  VT+FC P  +  LK +   +  +F+  E+ L+  YP+  YK VFVD A+    +YASM+IF+ +LLH + ++DQ+ IT +V+A A+ EQFFG +  M+ W  AW+  GI+GYL  LY+K   G NEY++ I KE + V  YE    G  L PL     E     + S S    ++A  + + ++              K+ L++R++E+++G   +L+VF KLL LA       VDS+             NLLL       ++  VSG  I  F++ W+   G  +    + FNR+RN+ EL +KQ     +G  +Y GP+ V  QE +G F   V+I+   +  +      +P H+K R+++K+K+ L  G EVD++L   DSD P LW+ +D  +T   ++   QPD +    LRHE+D +AQ+ ++  +     A     L DI    + FY+ R +A + +  + +        Q  + ++F  ++ +K+   +I  NDF N  +Y +  ++   +A ++  H  CP ++   L +LL YNDN  N+YSD Y+ A +I ++   I  GV       L    L  + +++L +V+R L L++  P+Y++ +T  CL  LR LQ  G +  +   F  Y    +  DVR +A+ CL        + + L +LM E++ KD     +R  T+  L D       S +        + ++   WS                DWRLR   + L
Sbjct:    1 HQTLCITSIDFQRRCLFGFVELRVLPLTSNLNRLKLNCKQCRIM---------RVCIREEKKEDWYEAGFQLEDSNRPVCPDGKKRNLDYFLACQQNAVSSADPDYGGGELVIRIPKEVLSCAMERKQFRVSIEYSLEHPDSGIQFVTPKGDGTMAQRAAHLFTYTYANSSRLWFPCVDSYAEVCTWSIDITVDKDMVAVSCGELVDQVFTIDERRKTFHYALNIPTSAVNIAVAVGPFEIYVDPIMPEVTNFCLPGLLANLKHSTAFLHDVFEMYEENLSCRYPYTHYKQVFVDQAYSVKAAYASMSIFNTSLLHSSRIIDQTFITRRVLAQALAEQFFGCYICMQDWSDAWLCSGIAGYLYSLYVKKAFGNNEYRYWIMKETESVCQYETDGPG--LPPLHSNMIESTANQSSSSSQHSPRSAAGSSIHLHPHLTSVKQREVAWSKSHLVLRMIEIRIGQEPLLQVFNKLLSLANTTAQPKVDSSL----------WRNLLLSTSGFLKSISTVSGKDINVFIDQWICHSGIAKFHGSFVFNRKRNIVELDIKQ--DLSKGTVKYVGPLTVCVQELDGSFNHTVQIEDITSRHE------LPCHSKSRRNKKKKIPLMTGEEVDMNLDAMDSDSPVLWLRIDPEVTWLRQVSFEQPDYMWQYQLRHERDIMAQVQSLVALERFPTAPTRDALMDIITQKECFYRVRQEACMCLAKVASASADSWTGQTAMLNIFKNMFGSKSAPQIIRYNDFSNFISYFVLKTLPIAIASVRNIHSQCPREVVLFLMDLLKYNDNRLNKYSDSYHLAALIEALSATITPGVAMVSTQRLLLVKLKDDTQLVLAEVIRRLNLEKLQPSYRYCVTVSCLKALRNLQVNGQVPADSVAFEFYAGFGHFEDVRCSAIECLADYTKVEVSEKTLNFLM-EIVEKDPV-PYIRHHTLRVLSDNPPFTRKSDSPLCTQVLVERLWHFMWSVN----------NTVHDWRLRCDAVDL 961          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Match: EDO26744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB73])

HSP 1 Score: 142.51 bits (358), Expect = 2.176e-38
Identity = 66/156 (42.31%), Postives = 99/156 (63.46%), Query Frame = 3
Query:  735 VPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKK 1202
            +P   +   +G FEIY DP++  VT+FC P  +  LK +   +  +F+  E+ L+  YP+  YK VFVD A+    +YASM+IF+ +LLH + ++DQ+ IT +V+A A+ EQFFG +  M+ W  AW+  GI+GYL  LY+K   G NEY++ I K
Sbjct:   63 IPKQVLSCAMGPFEIYVDPIMPEVTNFCLPGLLANLKHSTAFLHDVFEMYEENLSCRYPYTHYKQVFVDQAYSVKAAYASMSIFNTSLLHSSRIIDQTFITRRVLAQALAEQFFGCYICMQDWSDAWLCSGIAGYLYSLYVKKAFGNNEYRYWIMK 218          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:101170787])

HSP 1 Score: 556.214 bits (1432), Expect = 5.664e-179
Identity = 326/986 (33.06%), Postives = 546/986 (55.38%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDP--LECK----TLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKF-KMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITL 2978
            R + +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + + + +    Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W    EL  LK+ ++FSL +PK GL+FV P+   +      ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+S G L++++YT D+  K +HY L  P  A  I + VG FEI  DP +  VTHFC P+ +PLLK ++  + +IF+F E+ L   YP+  +KTVFVD A+    SYASM+IF  NLLH   ++DQ+ +T + +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+   K+E+D++V YE + GG++L P    CK      P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +LL       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++    QG   ++ +FT ++  K+  +++ +N+F +  +Y LQ ++   +ALL+    LCP D+   + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L  ++++IL+++ R L +++ +P+++ TIT  CL  +R+LQ  G+I  +P +F  Y    +  DVR  AL  L+      ++   L+WL+  V        R +  ++      F KM + +   + +        + +L++ ++  A  DWRLR   +  
Sbjct:   13 RPFKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIY---------RVRVNDLEAPFIYNDPTLEVCH-SESKQRNLNYFSSAYTAAVSAVDPDAGNGELVIKVPSELWKQGDELNVLKVYIDFSLDQPKGGLHFVVPDVEGSMAERAAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETIYTNDMRKKTFHYVLPIPTAAPNISLAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSPMIIDQTPLTRRCLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGVNEYRHWFKEELDKIVEYELKMGGVLLHPTFTGCKDKDSPTPHLHFSIKHPHTMSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHM----------WSQMLLSTYGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEEAISALEKFPTPASRLALTDILEQEQCFYKVRMLACFCLAKIANSMVSTWQGPPAMKSLFTRMFCCKSCPNIVKTNNFISFQSYFLQKTMPVAMALLRDVQNLCPKDVLNFILDLIKYNDNRKNKFSDNYYRAELIEALTNSLTPAISINNEVRTVDNLNPDVRLILEEITRFLNMEKLLPSFRNTITVSCLRAIRQLQRNGHIPSDPSLFTSYAEYGHFVDVRIAALEALVDYTRVERSSAELQWLLTLVHNDPVHYVRHKILSMLCKNPPFTKMTDSALCNEAL--------VDQLWKLMNSGACHDWRLRCGAVNF 963          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: taf2 (TATA-box binding protein associated factor 2 [Source:NCBI gene;Acc:101170787])

HSP 1 Score: 553.518 bits (1425), Expect = 9.504e-177
Identity = 315/918 (34.31%), Postives = 521/918 (56.75%), Query Frame = 3
Query:   54 RNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDC-AEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDP--LECK----TLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQG--GLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGD-SSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEV 2777
            R + +++Q +CIN I+F    + G  E+ I+P    + RI LN+KQ RI+          + + + +    Y+DP + +   S+    NL+ F   + ++   VD + G GEL +++P + W    EL  LK+ ++FSL +PK GL+FV P+   +      ++F+    N +R WFPCVD  +E CTWK+E TV+  MVA+S G L++++YT D+  K +HY L  P  A  I + VG FEI  DP +  VTHFC P+ +PLLK ++  + +IF+F E+ L   YP+  +KTVFVD A+    SYASM+IF  NLLH   ++DQ+ +T + +A A+ +QFFG F    +W   WV  GISGY+  LYLK   G+NEY+   K+E+D++V YE + GG++L P    CK      P+  FS+      +  Y  M++ KA L++RL+E ++    +L+VF KLL LA  A      S+            + +LL       ++  VSG  I   ++ WV++ G V+    + FNR+RNV EL ++Q  +   G  +Y GPI+V  QE +G F   ++I+      ++ +  DIP H+K R+++K+K+ L NG EVD+DL   D+D P LWI +D +M++  K++  Q D +    LR+E+D +AQ  AI  +      +    L DI +  + FY+ R+ A   +  I N++    QG   ++ +FT ++  K+  +++ +N+F +  +Y LQ ++   +ALL+    LCP D+   + +L+ YNDN  N++SD YY+AE+I ++ +++   +    +  +++ L  ++++IL+++ R L +++ +P+++ TIT  CL  +R+LQ  G+I  +P +F  Y    +  DVR  AL  L+      ++   L+WL+  V
Sbjct:   13 RPFKLTHQVVCINNINFQRKSVIGFVELTIFPTVVNLNRIKLNSKQCRIY---------RVRVNDLEAPFIYNDPTLEVCH-SESKQRNLNYFSSAYTAAVSAVDPDAGNGELVIKVPSELWKQGDELNVLKVYIDFSLDQPKGGLHFVVPDVEGSMAERAAHVFSFGYQNSTRFWFPCVDSYSELCTWKLEFTVDASMVAVSCGDLVETIYTNDMRKKTFHYVLPIPTAAPNISLAVGPFEILVDPYMHEVTHFCLPQLLPLLKHSMSFLHEIFEFYEEILTCRYPYSCFKTVFVDEAYVQVSSYASMSIFSTNLLHSPMIIDQTPLTRRCLAQALAQQFFGCFISRMSWADEWVLKGISGYIYGLYLKKTFGVNEYRHWFKEELDKIVEYELKMGGVLLHPTFTGCKDKDSPTPHLHFSIKHPHTMSWEYYKMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKYQSHM----------WSQMLLSTYGFLKSISNVSGKDIGPLIKQWVDQSGVVKFFGSFAFNRKRNVLELEIRQ-DYTSSGTQKYVGPIKVTVQELDGSFNHTLQIE------ENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSILRKVEFEQADFMWQYQLRYERDVVAQEEAISALEKFPTPASRLALTDILEQEQCFYKVRMLACFCLAKIANSMVSTWQGPPAMKSLFTRMFCCKSCPNIVKTNNFISFQSYFLQKTMPVAMALLRDVQNLCPKDVLNFILDLIKYNDNRKNKFSDNYYRAELIEALTNSLTPAISINNEVRTVDNLNPDVRLILEEITRFLNMEKLLPSFRNTITVSCLRAIRQLQRNGHIPSDPSLFTSYAEYGHFVDVRIAALEALVDYTRVERSSAELQWLLTLV 903          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: lta4h (leukotriene A4 hydrolase [Source:NCBI gene;Acc:101172215])

HSP 1 Score: 53.5286 bits (127), Expect = 1.107e-6
Identity = 78/322 (24.22%), Postives = 127/322 (39.44%), Query Frame = 3
Query:  540 YLFTSTMGNMSRLWFPCVDCAE-PCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVP--ASCIGMVVGEFE---IYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNML-DQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNI----KKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVD-SNY 1469
            YLF+    +  R   PC D      T+  +++V +D+VA+ + +       P+  +++ + F +QPVP  +  I +VVG  E   I P   +     F         +T       + K  ED L   Y +  Y  + +  +F     Y  M    L    P  +  D+SL T  V+A  I   + G+    K W H W+  G + YL ++  + + G    +F      K   D V  +   N    L P      P+ +FS +            Y+K  AL+  L EL  GP + +   +  + L      T+ D  NY
Sbjct:  127 YLFSQCQAHHCRSMVPCQDTPSVKHTYYAQVSVPKDLVAVMSAVRDGQEEDPEDSSRIVYRF-RQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEFVDKAAFEFSETET-----MLKTAED-LAGPYVWGQYDILVLPPSF----PYGGMENPCLTFATPTLLAGDKSLST--VIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRQMYGEQFRQFKAMGGWKDLQDSVNTFGPNNPLTNLVPSLQDVDPDDAFSSV-----------PYEKGFALLYHLEELMGGPEVFMGFVKSYIQLYAYGSVTTDDWKNY 424          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Match: npepps (puromycin-sensitive aminopeptidase [Source:NCBI gene;Acc:101158915])

HSP 1 Score: 52.7582 bits (125), Expect = 2.381e-6
Identity = 51/200 (25.50%), Postives = 86/200 (43.00%), Query Frame = 3
Query:  570 SRLWFPCVDCAEPC---TWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPAS-CIGMVVGEFEIYPDPLISHVTH--FCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFV-DNAFEDFHSYASMTIFDLNLL-HPNNMLDQSLITLK-VMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYL 1142
            +R  FPC D  EP    T+ I + V +D VA+SN  +++    PD  N V   F   P+ ++  +  V+GE++         VT   + P       K  +E   +   F +D  N  YP      + + D A     ++  +T  +  LL  P N    S   +  V+   +  Q+FG+   M+ W H W+  G + ++
Sbjct:  200 ARRAFPCWD--EPAIKATFDISLIVPKDRVALSNMNVIERKPYPDDENLVEVKFATTPIMSTYLVAFVIGEYDHVESQSSDGVTVRVYTPVGKAEQGKFALEVATKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSCSSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWI 397          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037715.1 (SMESG000037715.1)

HSP 1 Score: 2108.57 bits (5462), Expect = 0.000e+0
Identity = 1041/1041 (100.00%), Postives = 1041/1041 (100.00%), Query Frame = 3
Query:   51 MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE 3173
            MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE
Sbjct:    1 MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE 1041          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037715.1 (SMESG000037715.1)

HSP 1 Score: 2029.22 bits (5256), Expect = 0.000e+0
Identity = 1004/1004 (100.00%), Postives = 1004/1004 (100.00%), Query Frame = 3
Query:  162 MVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPXXXXXXXXXXXXXXXSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE 3173
            MVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE
Sbjct:    1 MVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKRKVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLILRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGMKDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISIIRQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGDAIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCLMILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYEVLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQKLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTTPRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVE 1004          
BLAST of Transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Match: SMESG000037189.1 (SMESG000037189.1)

HSP 1 Score: 158.688 bits (400), Expect = 2.448e-39
Identity = 144/564 (25.53%), Postives = 237/564 (42.02%), Query Frame = 3
Query:   57 NYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRIHSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHISSAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFVKPXXXXXXXXXXXYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITV-NEDMVAISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLISHVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAFEDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKAWPHAWVPWGISGYLGKLYLKSLMGI---NEYKFNIKKEMDEVVNYEEQNGGIVLDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMILKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDLVSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCFEYTGPIEVVTQE 1736
            +Y +  Q L I  IDF      G T+  I+PL+     I LN     I                 +L  S  D F AI     Y+ FN D+ I ++                   IP +  S + +L+P  L++ FS    + GL F       +  S  +Y++ +   N S   FPC++  + C W IEI      M  I +G L       D +N ++H  +++P  A  I   VG+FE + DP      ++ P  F   +K  ++ + +  KF++  + F YPF +YK+VFVD   ++F++ +S+T+F++NLL       +      V+     EQ+FG +     W  +W+ WG + Y+    L     I   +E  + I ++M+ +V YE +NGGI+LD    K+  N+ F     +     Y   Y+ K+ L+ R   L +    +  V R  L       +  ++S Y                                 TN +E  V + GH+ I A+  + + R   EL V Q  + +   F Y+G +E   +E
Sbjct:    2 SYKIKRQDLSIENIDFSKQSFEGITKFFIFPLECDFKSILLNCNGPIIKKIIF------------NLENSSTDGFNAI-----YDRFN-DDIISIY-------------------IPNELISAVYKLEPFFLLIYFSSQGNQCGLQFF----ISSTGSKTDYMYMAPYNNCSGSSFPCIEFGQSCEWFIEIASPCGSMTVICSGCL----KFIDDNNYLFH--IERPTTACKISFAVGQFEYFHDPDNPRFQYYFPASFNQYVKFYIDILIKALKFLQSNVKFGYPFGIYKSVFVDFLLDEFYTASSLTLFNINLLLQYGESHKLFQPNHVLIAGFCEQYFGAYVEAAQWKDSWICWGFAEYMAWEMLNEFFPIERSDESIYEIMEKMNHLVEYEYRNGGILLDASFSKS-ENFDFDPFNPRKMPIRYKRFYRIKSGLVFRSWTLCISFVGLCDVIRYYLKHEHFVDEKILESYY-----------------------------LGNWTNLIEGTVKRRGHIDIIAKAHYLKERKNIELIVYQGRNILS--FLYSGDMECDIRE 486          
The following BLAST results are available for this feature:
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF20.000e+033.50TATA-box binding protein associated factor 2 [Sour... [more]
TAF23.699e-4330.56TATA-box binding protein associated factor 2 [Sour... [more]
NPEPPS1.259e-723.42aminopeptidase puromycin sensitive [Source:HGNC Sy... [more]
NPEPPS1.568e-723.42aminopeptidase puromycin sensitive [Source:HGNC Sy... [more]
LTA4H8.748e-624.83leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf-25.166e-9026.65Transcription initiation factor TFIID subunit 2 [... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Taf26.950e-17433.77gene:FBgn0011836 transcript:FBtr0332688[more]
Taf26.950e-17433.77gene:FBgn0011836 transcript:FBtr0076361[more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
taf21.317e-17933.20TAF2 RNA polymerase II, TATA box binding protein (... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TAF20.000e+033.50uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF20.000e+033.50uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF20.000e+033.50uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF25.427e-17835.08uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
TAF23.587e-17032.69uncharacterized loc100125055 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Taf20.000e+033.50TATA-box binding protein associated factor 2 [Sour... [more]
Npepps4.872e-821.83aminopeptidase puromycin sensitive [Source:MGI Sym... [more]
Npepps6.621e-823.10aminopeptidase puromycin sensitive [Source:MGI Sym... [more]
Npepps8.008e-823.10aminopeptidase puromycin sensitive [Source:MGI Sym... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P1X5|TAF2_HUMAN0.000e+033.50Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q5ZIT8|TAF2_CHICK0.000e+033.50Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q8C176|TAF2_MOUSE0.000e+033.30Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q32PW3|TAF2_DANRE9.944e-17933.20Transcription initiation factor TFIID subunit 2 OS... [more]
sp|Q24325|TAF2_DROME6.966e-17333.77Transcription initiation factor TFIID subunit 2 OS... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NDT30.000e+036.86Transcription initiation factor TFIID subunit 2 OS... [more]
A0A4E0RFG70.000e+036.46Transcription initiation factor TFIID subunit 2 OS... [more]
A0A504Z4J30.000e+036.36Transcription initiation factor TFIID subunit 2 OS... [more]
A0A4V3SC140.000e+037.37Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X8070.000e+037.31Peptidase family M1 OS=Opisthorchis viverrini OX=6... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf26.461e-17833.40TATA-box binding protein associated factor 2 [Sour... [more]
taf26.033e-17333.30TATA-box binding protein associated factor 2 [Sour... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
taf24.723e-17234.81TAF2 RNA polymerase II, TATA box binding protein (... [more]
ENSPMAT00000005578.18.414e-6946.18pep scaffold:Pmarinus_7.0:GL491533:415:5877:-1 gen... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TAF23.945e-1324.09TFIID subunit (150 kDa); involved in RNA polymeras... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO328391.314e-15632.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267442.176e-3842.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
taf25.664e-17933.06TATA-box binding protein associated factor 2 [Sour... [more]
taf29.504e-17734.31TATA-box binding protein associated factor 2 [Sour... [more]
lta4h1.107e-624.22leukotriene A4 hydrolase [Source:NCBI gene;Acc:101... [more]
npepps2.381e-625.50puromycin-sensitive aminopeptidase [Source:NCBI ge... [more]
back to top
BLAST of Transcription initiation factor TFIID subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000037715.10.000e+0100.00SMESG000037715.1[more]
SMESG000037715.10.000e+0100.00SMESG000037715.1[more]
SMESG000037189.12.448e-3925.53SMESG000037189.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033338 ID=SMED30033338|Name=Transcription initiation factor TFIID subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3214bp
GCTAATTATTTGCAATTGTTTAAATATTAATTATTTTTAAATGTTTTAAA
ATGAGAAATTATTATGTTAGTAATCAGACTTTATGTATAAATAAAATTGA
TTTTGACAATAACTGGATATGTGGCCATACAGAAATAGTCATATGGCCGT
TGGATCCTACCATGGTACGAATTCATTTAAATGCAAAACAAATAAGAATT
CATAGTACTCAACTTTGCACTTTACACAATGAGATCAGCATAATGGAAAC
AGATTTGGCTATGAGCTATCATGATCCATTTATGGCCATCAGTCGGAAGT
CAGATTACAATTTTTTTAATTTAGATAACTTTATCAAAATGCACATTTCA
TCTGCTAAACGTGTTGATTTAGAAGAAGGTATTGGAGAATTAACCCTTCA
AATTCCACCTGATTTTTGGTCATACATATCAGAGTTGAAGCCTTTAAAAC
TTATTGTTGAATTTTCACTTTATCGTCCTAAAGCTGGTCTATATTTTGTT
AAACCAAATAACAATAAAAATGGTAATTCTAATGGTAATTATTTATTTAC
ATCGACAATGGGAAATATGTCTAGACTGTGGTTTCCGTGCGTTGATTGTG
CTGAACCGTGTACTTGGAAAATTGAAATAACTGTTAATGAGGATATGGTA
GCAATATCAAATGGTATGCTACTAGATTCAGTCTATACTCCAGATTTACA
CAATAAAGTTTATCATTATTTTTTAAAACAGCCAGTACCAGCATCATGTA
TAGGAATGGTTGTTGGTGAATTTGAAATTTACCCCGATCCCTTAATTAGC
CATGTAACACATTTCTGTCCTCCAAAGTTTATGCCTCTATTAAAAACAAC
AGTTGAAGCGATGCCACAAATTTTTAAATTTATTGAAGACAAATTAAATT
TTAACTATCCTTTCGATATGTACAAAACAGTTTTTGTTGACAATGCTTTT
GAAGATTTTCATTCCTATGCTTCAATGACAATATTTGATTTAAATTTGTT
GCACCCAAATAATATGTTAGATCAAAGTTTAATTACATTGAAAGTCATGG
CAATGGCAATACCGGAGCAATTCTTTGGACATTTTACAGTAATGAAAGCT
TGGCCTCATGCATGGGTGCCATGGGGAATATCCGGATATCTTGGGAAATT
ATATTTGAAGTCTTTAATGGGAATTAATGAATATAAGTTCAACATTAAAA
AAGAAATGGATGAGGTAGTGAATTACGAAGAACAGAATGGAGGAATCGTT
TTAGATCCTTTGGAATGTAAAACTCTCCCAAATTATAGCTTTAGTTTGTT
ATTTGCCCAGGCTGCAAATGCAACTTATGTTGCAATGTATAAGAAAAAGG
CGGCTCTTATTATAAGACTACTTGAATTAAAATTAGGGCCTTCTATGATT
TTAAAAGTTTTTCGAAAATTGCTTCTTCTAGCAAAGATGGCGCAAGATAC
TTCGGTTGATTCAAATTACAATTTGGCCGCTCCTGTTATTGATGAACATC
GAACAAATCTATTATTGTGCGCAGAATTGTTGAAATATGCAGTCGATCTT
GTATCTGGATCCCAAATAACAAATTTTCTTGAAATGTGGGTAAATAAACC
CGGTCATGTAAGAATACAAGCCGAATATCAGTTTAATAGGCGTCGTAATG
TAGCGGAATTGAGTGTTAAACAGTTTCATCACAGAATAAGAGGTTGTTTT
GAGTACACAGGGCCCATTGAAGTTGTTACTCAAGAATTTGAGGGTTTTTT
TCAACAAAAAGTCCGAATAGATAGGCCTGTTAATCCCAGTCAATCTCGGA
TTGTTGTAGACATTCCTTTGCACACTAAAGTTCGGAAACATAGAAAAAGA
AAAGTCACTCTATCAAACGGTGCAGAAGTCGATGTAGATTTACCTCCAAA
CGACAGCGATATTCCTTATCTCTGGATAATGCTCGATATAAATATGACAC
TTTTCGGTAAAATTGACCTCATTCAACCCGATAGAATTTGCCTGTTGATT
TTACGACATGAACAAGATGCCTTAGCTCAGATCTCGGCAATTGAAACCAT
TTCTGCTGTTAGAGATGCTTCGTATCTATCGATTTTGAGAGACATCGCAC
AAAACAACAAAATTTTTTACCAAACTCGCATCCAAGCCGCCATAGGAATG
AAAGATATAATGAATAACATTCACCAAGTAAACCAAGGCGGGCTCCGCGA
CGTATTTACGACTTTATATTACACCAAAACCGGAAAATCTATGATTTGCA
GTAATGATTTCAAGAATCTCGGAAATTATCGATTACAAATCTCTATAATT
CGACAATTAGCCTTGCTGCAGACCTCTCATGGATTATGTCCATCTGATAT
TCCTACTCTACTATTCAATCTACTCCTCTATAATGACAACTCAACTAATC
GATACTCTGATGTCTATTACAAAGCTGAAATTATCCGTTCTATGGGTGAC
GCTATTAGAATGGGAGTTTTCCACCGAGGAGACTCTTCTCTAGAGTTTCT
TCCATCTGAAATTAAAATGATTCTGAAAGATGTATTGCGGTGTTTGACAC
TTGACCAAGCCATGCCAACATATAAGTTTACAATCACCCAGCCTTGCCTG
ATGATTTTGCGCCGATTACAGGAATATGGATACATTGTTGATGAGCCGGG
AATTTTCTATCCGTATGTATCTGAAAATTACACATATGATGTTCGTAAAA
CGGCTCTGTTGTGCCTAATCTCAGCGGTAGATGGAATGAAAAACTATGAG
GTTTTGGAATGGTTAATGGCTGAAGTCATTATGAAGGATAGTTTTTCCGC
TCGACTGCGTTTTGACACTGTGAATGGATTGGTGGATAAATTCAAAATGA
ACAATTATTCCAGCAATCGGCAAGATATATATAGGATGTATTGGAGTCAG
AAGCTACCTGAATTGTATCGATTTGTCGATTGCCAAGCATCATCTGATTG
GAGATTAAGAAGTGCAGTGATCACCCTGACTAAATGCATTGCAGATATTG
GATCAACTAATGTCAATTCGATGGATCATAATTCTGGACGGAACACTACG
CCAAGAGATATTTCGGATTGTACGCCTTTTGAATCCGGCCAGAGGATCAA
TATATTCGATGCATGCCGAAGTCCTCAGCGTCAAAATGATATTACGAGAT
TAAGTGACGATTCTGACGTTGAAATTTTGTAAATAACCTTGTTGAATATA
TTTTTCTTACCTAA
back to top

protein sequence of SMED30033338-orf-1

>SMED30033338-orf-1 ID=SMED30033338-orf-1|Name=SMED30033338-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1044bp
MRNYYVSNQTLCINKIDFDNNWICGHTEIVIWPLDPTMVRIHLNAKQIRI
HSTQLCTLHNEISIMETDLAMSYHDPFMAISRKSDYNFFNLDNFIKMHIS
SAKRVDLEEGIGELTLQIPPDFWSYISELKPLKLIVEFSLYRPKAGLYFV
KPNNNKNGNSNGNYLFTSTMGNMSRLWFPCVDCAEPCTWKIEITVNEDMV
AISNGMLLDSVYTPDLHNKVYHYFLKQPVPASCIGMVVGEFEIYPDPLIS
HVTHFCPPKFMPLLKTTVEAMPQIFKFIEDKLNFNYPFDMYKTVFVDNAF
EDFHSYASMTIFDLNLLHPNNMLDQSLITLKVMAMAIPEQFFGHFTVMKA
WPHAWVPWGISGYLGKLYLKSLMGINEYKFNIKKEMDEVVNYEEQNGGIV
LDPLECKTLPNYSFSLLFAQAANATYVAMYKKKAALIIRLLELKLGPSMI
LKVFRKLLLLAKMAQDTSVDSNYNLAAPVIDEHRTNLLLCAELLKYAVDL
VSGSQITNFLEMWVNKPGHVRIQAEYQFNRRRNVAELSVKQFHHRIRGCF
EYTGPIEVVTQEFEGFFQQKVRIDRPVNPSQSRIVVDIPLHTKVRKHRKR
KVTLSNGAEVDVDLPPNDSDIPYLWIMLDINMTLFGKIDLIQPDRICLLI
LRHEQDALAQISAIETISAVRDASYLSILRDIAQNNKIFYQTRIQAAIGM
KDIMNNIHQVNQGGLRDVFTTLYYTKTGKSMICSNDFKNLGNYRLQISII
RQLALLQTSHGLCPSDIPTLLFNLLLYNDNSTNRYSDVYYKAEIIRSMGD
AIRMGVFHRGDSSLEFLPSEIKMILKDVLRCLTLDQAMPTYKFTITQPCL
MILRRLQEYGYIVDEPGIFYPYVSENYTYDVRKTALLCLISAVDGMKNYE
VLEWLMAEVIMKDSFSARLRFDTVNGLVDKFKMNNYSSNRQDIYRMYWSQ
KLPELYRFVDCQASSDWRLRSAVITLTKCIADIGSTNVNSMDHNSGRNTT
PRDISDCTPFESGQRINIFDACRSPQRQNDITRLSDDSDVEIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005669transcription factor TFIID complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037813TAF2
IPR042097Aminopeptidase_N-like_N
IPR014782Peptidase_M1_dom
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 375..395
NoneNo IPR availableGENE3DG3DSA:1.10.390.60coord: 250..518
e-value: 9.1E-23
score: 82.9
NoneNo IPR availablePFAMPF17900Peptidase_M1_Ncoord: 130..228
e-value: 2.9E-5
score: 24.4
NoneNo IPR availableCDDcd09839M1_like_TAF2coord: 6..514
e-value: 5.98419E-108
score: 344.598
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 252..520
IPR037813Transcription initiation factor TFIID subunit 2PANTHERPTHR15137TRANSCRIPTION INITIATION FACTOR TFIIDcoord: 9..989
IPR042097Aminopeptidase N-like , N-terminalSUPERFAMILYSSF63737Leukotriene A4 hydrolase N-terminal domaincoord: 3..240