slc35f-3

Overview
Nameslc35f-3 (AKN21653.1)
Smed IDSMED30033309
Length (bp)1473
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc35f-3 (SMED30033309) t-SNE clustered cells

Violin plots show distribution of expression levels for slc35f-3 (SMED30033309) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc35f-3 (SMED30033309) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc35f-3 (SMED30033309) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033309

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30033309SMESG000077937.1 SMESG000077930.1 SmedASXL_009138SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077937.1 SMESG000077930.1 Contig53661newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077937.1 SMESG000077930.1 Contig53661uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30033309SMESG000077930.1 dd_Smed_v4_18554_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033309SMESG000077937.1 SMESG000077930.1 dd_Smed_v4_13553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033309SMESG000077937.1 SMESG000077930.1 dd_Smed_v4_13553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033309SMESG000077937.1 SMESG000077930.1 dd_Smed_v4_13553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30033309SMESG000077937.1 SMESG000077930.1 dd_Smed_v4_13553_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077937.1 SMESG000055743.1 Contig23806newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077937.1 SMESG000055743.1 Contig23806uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077940.1 SMESG000077937.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 Contig17311newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033309SMESG000077940.1 SMESG000077937.1 SMESG000017570.1 SMESG000017358.1 SMESG000017347.1 SMESG000013728.1 Contig17311uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30033309SMESG000077930.1 dd_Smed_v6_18554_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30033309SMESG000077937.1 SMESG000077930.1 dd_Smed_v6_13553_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30033309SMESG000077930.1 Contig28795newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30033309SMESG000077930.1 Contig28795uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30033309SMESG000077930.1 Contig28795newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
lateral branchSMED30033309SMESG000077930.1 Contig28795uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30033309SMESG000077937.1 SMESG000077930.1 OX_Smed_1.0.22552ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc35f-3 vs. Ensembl Human
Match: SLC35F3 (solute carrier family 35 member F3 [Source:HGNC Symbol;Acc:HGNC:23616])

HSP 1 Score: 85.1149 bits (209), Expect = 5.147e-17
Identity = 69/303 (22.77%), Postives = 144/303 (47.52%), Query Frame = 3
Query:   72 ASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
            AS  R E    +  P   + P  ++    +  +    +  ++ K+FW + V L V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  + H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I +           ++++IPW     CG S+  L
Sbjct:   91 ASCKREERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRK--------FDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVASASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDIPWGNL--CGFSVLLL 382          
BLAST of slc35f-3 vs. Ensembl Human
Match: SLC35F3 (solute carrier family 35 member F3 [Source:HGNC Symbol;Acc:HGNC:23616])

HSP 1 Score: 80.8777 bits (198), Expect = 9.531e-16
Identity = 67/302 (22.19%), Postives = 142/302 (47.02%), Query Frame = 3
Query:   75 SVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
             V   E    +  P   + P  ++    +  +    +  ++ K+FW + V L V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  + H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I +           ++++IPW     CG S+  L
Sbjct:   23 KVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRK--------FDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVASASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDIPWGNL--CGFSVLLL 313          
BLAST of slc35f-3 vs. Ensembl Human
Match: SLC35F4 (solute carrier family 35 member F4 [Source:HGNC Symbol;Acc:HGNC:19845])

HSP 1 Score: 65.855 bits (159), Expect = 9.093e-11
Identity = 51/220 (23.18%), Postives = 111/220 (50.45%), Query Frame = 3
Query:  159 SKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            ++ K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   +   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:  148 NRIKARCLSCTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 358          
BLAST of slc35f-3 vs. Ensembl Human
Match: SLC35F4 (solute carrier family 35 member F4 [Source:HGNC Symbol;Acc:HGNC:19845])

HSP 1 Score: 65.0846 bits (157), Expect = 1.318e-10
Identity = 51/220 (23.18%), Postives = 111/220 (50.45%), Query Frame = 3
Query:  159 SKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            ++ K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   +   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:  112 NRIKARCLSCTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 322          
BLAST of slc35f-3 vs. Ensembl Human
Match: SLC35F4 (solute carrier family 35 member F4 [Source:HGNC Symbol;Acc:HGNC:19845])

HSP 1 Score: 61.2326 bits (147), Expect = 1.441e-9
Identity = 49/207 (23.67%), Postives = 104/207 (50.24%), Query Frame = 3
Query:  195 IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   +   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:    2 VLKGIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 199          
BLAST of slc35f-3 vs. Ensembl Fly
Match: CG42322 (gene:FBgn0259222 transcript:FBtr0305058)

HSP 1 Score: 78.5666 bits (192), Expect = 3.361e-15
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  447 GFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY----DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWN 932
            GF        +++ R     +LW + TY    S +++ + D + +F TN + +YLL WV+LH++FV +RI+A IL  +G+ +  Y      +  +   +L + A   YAVF V  R ++       I+ ++T LG +N L +WP+ V    +T  E +T  +IPWN
Sbjct:  289 GFRERGFTVGRFLNRCLCFCILWLVTTYLYTLSLHVLYATDALALFATNVACVYLLSWVILHEQFVGVRIVAIILCDTGIALLAYMDGITESRTLSGVVLATLAGAGYAVFRVMFRKVMGDPPVSQIAFIFTALGFLNALLLWPV-VLGLYLTGTESLTSESIPWN 453          
BLAST of slc35f-3 vs. Ensembl Fly
Match: CG42322 (gene:FBgn0259222 transcript:FBtr0305057)

HSP 1 Score: 78.5666 bits (192), Expect = 3.361e-15
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  447 GFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY----DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWN 932
            GF        +++ R     +LW + TY    S +++ + D + +F TN + +YLL WV+LH++FV +RI+A IL  +G+ +  Y      +  +   +L + A   YAVF V  R ++       I+ ++T LG +N L +WP+ V    +T  E +T  +IPWN
Sbjct:  289 GFRERGFTVGRFLNRCLCFCILWLVTTYLYTLSLHVLYATDALALFATNVACVYLLSWVILHEQFVGVRIVAIILCDTGIALLAYMDGITESRTLSGVVLATLAGAGYAVFRVMFRKVMGDPPVSQIAFIFTALGFLNALLLWPV-VLGLYLTGTESLTSESIPWN 453          
BLAST of slc35f-3 vs. Ensembl Fly
Match: CG42322 (gene:FBgn0259222 transcript:FBtr0299768)

HSP 1 Score: 78.5666 bits (192), Expect = 3.361e-15
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  447 GFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY----DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWN 932
            GF        +++ R     +LW + TY    S +++ + D + +F TN + +YLL WV+LH++FV +RI+A IL  +G+ +  Y      +  +   +L + A   YAVF V  R ++       I+ ++T LG +N L +WP+ V    +T  E +T  +IPWN
Sbjct:  289 GFRERGFTVGRFLNRCLCFCILWLVTTYLYTLSLHVLYATDALALFATNVACVYLLSWVILHEQFVGVRIVAIILCDTGIALLAYMDGITESRTLSGVVLATLAGAGYAVFRVMFRKVMGDPPVSQIAFIFTALGFLNALLLWPV-VLGLYLTGTESLTSESIPWN 453          
BLAST of slc35f-3 vs. Ensembl Fly
Match: CG42322 (gene:FBgn0259222 transcript:FBtr0345263)

HSP 1 Score: 78.9518 bits (193), Expect = 3.645e-15
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  447 GFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY----DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWN 932
            GF        +++ R     +LW + TY    S +++ + D + +F TN + +YLL WV+LH++FV +RI+A IL  +G+ +  Y      +  +   +L + A   YAVF V  R ++       I+ ++T LG +N L +WP+ V    +T  E +T  +IPWN
Sbjct:  289 GFRERGFTVGRFLNRCLCFCILWLVTTYLYTLSLHVLYATDALALFATNVACVYLLSWVILHEQFVGVRIVAIILCDTGIALLAYMDGITESRTLSGVVLATLAGAGYAVFRVMFRKVMGDPPVSQIAFIFTALGFLNALLLWPV-VLGLYLTGTESLTSESIPWN 453          
BLAST of slc35f-3 vs. Ensembl Fly
Match: CG42322 (gene:FBgn0259222 transcript:FBtr0299771)

HSP 1 Score: 78.9518 bits (193), Expect = 3.809e-15
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 3
Query:  447 GFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY----DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWN 932
            GF        +++ R     +LW + TY    S +++ + D + +F TN + +YLL WV+LH++FV +RI+A IL  +G+ +  Y      +  +   +L + A   YAVF V  R ++       I+ ++T LG +N L +WP+ V    +T  E +T  +IPWN
Sbjct:  289 GFRERGFTVGRFLNRCLCFCILWLVTTYLYTLSLHVLYATDALALFATNVACVYLLSWVILHEQFVGVRIVAIILCDTGIALLAYMDGITESRTLSGVVLATLAGAGYAVFRVMFRKVMGDPPVSQIAFIFTALGFLNALLLWPV-VLGLYLTGTESLTSESIPWN 453          
BLAST of slc35f-3 vs. Ensembl Zebrafish
Match: slc35f3a (solute carrier family 35 member F3a [Source:ZFIN;Acc:ZDB-GENE-080204-20])

HSP 1 Score: 73.559 bits (179), Expect = 1.271e-13
Identity = 62/304 (20.39%), Postives = 144/304 (47.37%), Query Frame = 3
Query:   63 EDKASVARSEVSVKTNSPPFHRPPPLID-QNSVSKFKS-RRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGIS 956
            E+++S  + EV V       H    L+D  + + + +    +T   +    W + + + +  S  G  + AK+        T+  +N P  LT+ STSW  + +P+  + H+   + +       +        + +     + R+    VLW + +Y  ++    +P+ D   +FC + + ++L+ W++L  +F+ +RI+A +L+  G+++  Y +     S+I   +++ +A+ A A++ V  + ++ +      ++  T+LG  N +F+  + +   L  + + I+  ++PW+    CG+S
Sbjct:   89 EEQSSSEKVEVKVDG-----HSGTALLDCADRLQRLRCCLHLTAVHLRGALWGVAMVICICMSWSGSTQLAKI--------TVRRLNIPFTLTWFSTSWNCAIFPVYYLGHLCWSKDRQTPRQRFRECCQFLGDDGLSLKMLLSRVAPFGVLWTLTSYLYLQGLRRIPATDACALFCCSRAFVFLISWIVLRDRFMGVRIVAAVLAIGGIVMMTYADGFHSYSVIGISLVVGSASTA-AIYKVLFKLVLGSAKLGEAAVYLTILGGANLIFISAVPLILLLTGAEDFISPRDLPWSSI--CGMS 376          
BLAST of slc35f-3 vs. Ensembl Zebrafish
Match: slc35f3a (solute carrier family 35 member F3a [Source:ZFIN;Acc:ZDB-GENE-080204-20])

HSP 1 Score: 73.559 bits (179), Expect = 1.839e-13
Identity = 62/304 (20.39%), Postives = 144/304 (47.37%), Query Frame = 3
Query:   63 EDKASVARSEVSVKTNSPPFHRPPPLID-QNSVSKFKS-RRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGIS 956
            E+++S  + EV V       H    L+D  + + + +    +T   +    W + + + +  S  G  + AK+        T+  +N P  LT+ STSW  + +P+  + H+   + +       +        + +     + R+    VLW + +Y  ++    +P+ D   +FC + + ++L+ W++L  +F+ +RI+A +L+  G+++  Y +     S+I   +++ +A+ A A++ V  + ++ +      ++  T+LG  N +F+  + +   L  + + I+  ++PW+    CG+S
Sbjct:   89 EEQSSSEKVEVKVDG-----HSGTALLDCADRLQRLRCCLHLTAVHLRGALWGVAMVICICMSWSGSTQLAKI--------TVRRLNIPFTLTWFSTSWNCAIFPVYYLGHLCWSKDRQTPRQRFRECCQFLGDDGLSLKMLLSRVAPFGVLWTLTSYLYLQGLRRIPATDACALFCCSRAFVFLISWIVLRDRFMGVRIVAAVLAIGGIVMMTYADGFHSYSVIGISLVVGSASTA-AIYKVLFKLVLGSAKLGEAAVYLTILGGANLIFISAVPLILLLTGAEDFISPRDLPWSSI--CGMS 376          
BLAST of slc35f-3 vs. Ensembl Zebrafish
Match: slc35f3a (solute carrier family 35 member F3a [Source:ZFIN;Acc:ZDB-GENE-080204-20])

HSP 1 Score: 73.1738 bits (178), Expect = 2.168e-13
Identity = 62/304 (20.39%), Postives = 144/304 (47.37%), Query Frame = 3
Query:   63 EDKASVARSEVSVKTNSPPFHRPPPLID-QNSVSKFKS-RRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGIS 956
            E+++S  + EV V       H    L+D  + + + +    +T   +    W + + + +  S  G  + AK+        T+  +N P  LT+ STSW  + +P+  + H+   + +       +        + +     + R+    VLW + +Y  ++    +P+ D   +FC + + ++L+ W++L  +F+ +RI+A +L+  G+++  Y +     S+I   +++ +A+ A A++ V  + ++ +      ++  T+LG  N +F+  + +   L  + + I+  ++PW+    CG+S
Sbjct:   91 EEQSSSEKVEVKVDG-----HSGTALLDCADRLQRLRCCLHLTAVHLRGALWGVAMVICICMSWSGSTQLAKI--------TVRRLNIPFTLTWFSTSWNCAIFPVYYLGHLCWSKDRQTPRQRFRECCQFLGDDGLSLKMLLSRVAPFGVLWTLTSYLYLQGLRRIPATDACALFCCSRAFVFLISWIVLRDRFMGVRIVAAVLAIGGIVMMTYADGFHSYSVIGISLVVGSASTA-AIYKVLFKLVLGSAKLGEAAVYLTILGGANLIFISAVPLILLLTGAEDFISPRDLPWSSI--CGMS 378          
BLAST of slc35f-3 vs. Ensembl Zebrafish
Match: slc35f3b (solute carrier family 35 member F3b [Source:ZFIN;Acc:ZDB-GENE-090312-118])

HSP 1 Score: 71.633 bits (174), Expect = 5.543e-13
Identity = 48/209 (22.97%), Postives = 106/209 (50.72%), Query Frame = 3
Query:  177 RITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSII 791
            R+T  ++ K  W + + + V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  I H+ +  ++       +     F  + +    +  ++    +LW +  Y  +++   + S D+  +FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+ A A++ V  + ++
Sbjct:   63 RVTAVQVRKAIWGVAMVMCVCSSWAGSTQLAKLTFKK--------YDAPFTLTWFATTWNCLFFPLYYIGHLCKSPERQTPKQRFRECCRFFGDDGLTAKVFFTKVAPFGLLWILTNYLYLQALRKINSTDVSALFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMLTYADGFHSHSVIGITLVVASAS-ASALYKVLFKLVL 262          
BLAST of slc35f-3 vs. Ensembl Zebrafish
Match: slc35f3b (solute carrier family 35 member F3b [Source:ZFIN;Acc:ZDB-GENE-090312-118])

HSP 1 Score: 69.3218 bits (168), Expect = 3.352e-12
Identity = 47/212 (22.17%), Postives = 105/212 (49.53%), Query Frame = 3
Query:  168 KSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSII 791
            + R     ++ K  W + + + V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  I H+ +  ++       +     F  + +    +  ++    +LW +  Y  +++   + S D+  +FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+ A A++ V  + ++
Sbjct:   55 RQRLRCCVRVRKAIWGVAMVMCVCSSWAGSTQLAKLTFKK--------YDAPFTLTWFATTWNCLFFPLYYIGHLCKSPERQTPKQRFRECCRFFGDDGLTAKVFFTKVAPFGLLWILTNYLYLQALRKINSTDVSALFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMLTYADGFHSHSVIGITLVVASAS-ASALYKVLFKLVL 257          
BLAST of slc35f-3 vs. Ensembl Xenopus
Match: ENSXETT00000051338.1 (solute carrier family 35 member F3 [Source:NCBI gene;Acc:100491052])

HSP 1 Score: 67.781 bits (164), Expect = 1.302e-11
Identity = 49/209 (23.44%), Postives = 104/209 (49.76%), Query Frame = 3
Query:  177 RITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSII 791
            + +V +I K  W I + L V  S  G  + AK        ST++  + P  LT+ ST+W   F+P+  + ++ +  +K       +     F    +    ++ +     VLW +  Y  + +   + + D+  +FC N + ++LL W++L  KF+ +RI+A I + +G+++  Y +     S+I   +++ +A+++ A++ V  + I+
Sbjct:   56 KYSVTQIKKCSWGIAIILCVCSSWSGSTQLAK--------STLSRFDAPFTLTWFSTNWNFFFFPIYYVGYVLKSNEKQSPKQKYQECCRFFGDNGLTLKAFLTKAAPFGVLWILTNYLYLHAIKKISTTDVSALFCCNKAFVFLLSWIILRDKFMGVRIVAAIFAIAGIVMMTYADGFHSHSVIGIALVVGSASMS-ALYKVLFKLIL 255          
BLAST of slc35f-3 vs. Ensembl Xenopus
Match: elp3 (elongator acetyltransferase complex subunit 3 [Source:Xenbase;Acc:XB-GENE-957348])

HSP 1 Score: 67.781 bits (164), Expect = 1.394e-11
Identity = 65/278 (23.38%), Postives = 135/278 (48.56%), Query Frame = 3
Query:  147 QNSVSKFKSRRIT--VNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDN----TSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFV--WPIFVFTSLVTSAELITWNNIPWNYFIGCGIS 956
            +NS    +  R     +   K  W  L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H    ++K  ++  ++     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + M+LL W++L  KF+ +RI+A I++ +G+++  Y +     SII   + + +A+ A A++ V  +  + T N    +  ++ LG  N +F+   P+ ++ + V      +++ +PW Y   CG++
Sbjct:   80 ENSTEDAEKSRCQSCTSTFLKFVWGFLIILSVSSSWVGTTQIIKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHFAMAQEKQTMLQKIRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFMFLLSWIVLKDKFMGVRIVAAIMAITGIVMMAYADGFHGDSIIGVALAVGSAS-ASALYKVLFKMFLGTANFGEAAHFFSTLGFFNLIFISCTPVILYFTKVEYWS--SFSALPWGYL--CGVA 344          
BLAST of slc35f-3 vs. Ensembl Mouse
Match: Slc35f3 (solute carrier family 35, member F3 [Source:MGI Symbol;Acc:MGI:2444426])

HSP 1 Score: 80.8777 bits (198), Expect = 9.013e-16
Identity = 70/302 (23.18%), Postives = 140/302 (46.36%), Query Frame = 3
Query:   75 SVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
            S  R E   +   P   + P   +    +   +   +  ++ KVFW + V   V  S  G  + A+L+F +         + P  LT+ +T+W   F+PL    H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N S ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I V           ++++IPW     CG SI  L
Sbjct:   92 SYKREERPREPPGPAEAQAPAGTEAGGRTSRHNWTCSQERLKKVFWGVAVVFCVCASWAGSTQLARLTFKT--------FDAPFTLTWFATNWNFLFFPLYYAGHVCKSTEKQSMKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINATDVSVLFCCNKSFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVGSASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPVILYFTRVEYWNSFDDIPWGNL--CGFSILLL 382          
BLAST of slc35f-3 vs. Ensembl Mouse
Match: Slc35f3 (solute carrier family 35, member F3 [Source:MGI Symbol;Acc:MGI:2444426])

HSP 1 Score: 79.7221 bits (195), Expect = 1.643e-15
Identity = 71/302 (23.51%), Postives = 137/302 (45.36%), Query Frame = 3
Query:   96 SVKTNSPPFHRPPPLIDQNSVSKFKSRR-------ITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
             V+    P   P P   Q         R        +  ++ KVFW + V   V  S  G  + A+L+F +         + P  LT+ +T+W   F+PL    H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N S ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I V           ++++IPW     CG SI  L
Sbjct:   23 KVEGEERPREPPGPAEAQAPAGTEAGGRTSRHNWTCSQERLKKVFWGVAVVFCVCASWAGSTQLARLTFKT--------FDAPFTLTWFATNWNFLFFPLYYAGHVCKSTEKQSMKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINATDVSVLFCCNKSFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVGSASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPVILYFTRVEYWNSFDDIPWGNL--CGFSILLL 313          
BLAST of slc35f-3 vs. Ensembl Mouse
Match: Slc35f4 (solute carrier family 35, member F4 [Source:MGI Symbol;Acc:MGI:1922538])

HSP 1 Score: 65.855 bits (159), Expect = 5.525e-11
Identity = 55/231 (23.81%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  126 RPPPLIDQNSVSKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            RP     +N +   K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   I   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:  104 RPESSSQENGL---KARCLSCTSMVLKTIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPIKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 322          
BLAST of slc35f-3 vs. Ensembl Mouse
Match: Slc35f3 (solute carrier family 35, member F3 [Source:MGI Symbol;Acc:MGI:2444426])

HSP 1 Score: 57.7658 bits (138), Expect = 1.304e-8
Identity = 43/158 (27.22%), Postives = 87/158 (55.06%), Query Frame = 3
Query:  507 VLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
            VLW +  Y  + +   + + D+ V+FC N S ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I V           ++++IPW     CG SI  L
Sbjct:   65 VLWTLTNYLYLHAIKKINATDVSVLFCCNKSFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVGSASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPVILYFTRVEYWNSFDDIPWGNL--CGFSILLL 219          
BLAST of slc35f-3 vs. Ensembl Mouse
Match: Slc35f4 (solute carrier family 35, member F4 [Source:MGI Symbol;Acc:MGI:1922538])

HSP 1 Score: 55.4546 bits (132), Expect = 6.211e-8
Identity = 42/183 (22.95%), Postives = 89/183 (48.63%), Query Frame = 3
Query:  126 RPPPLIDQNSVSKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFIL 671
            RP     +N +   K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   I   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +R++A ++
Sbjct:  104 RPESSSQENGL---KARCLSCTSMVLKTIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPIKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRVMAHLI 275          
BLAST of slc35f-3 vs. UniProt/SwissProt
Match: sp|Q8IY50|S35F3_HUMAN (Putative thiamine transporter SLC35F3 OS=Homo sapiens OX=9606 GN=SLC35F3 PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 4.577e-15
Identity = 67/302 (22.19%), Postives = 142/302 (47.02%), Query Frame = 3
Query:   75 SVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
             V   E    +  P   + P  ++    +  +    +  ++ K+FW + V L V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  + H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I +           ++++IPW     CG S+  L
Sbjct:   23 KVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRK--------FDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVASASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDIPWGNL--CGFSVLLL 313          
BLAST of slc35f-3 vs. UniProt/SwissProt
Match: sp|Q1LZI2|S35F3_MOUSE (Putative thiamine transporter SLC35F3 OS=Mus musculus OX=10090 GN=Slc35f3 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.149e-14
Identity = 71/302 (23.51%), Postives = 137/302 (45.36%), Query Frame = 3
Query:   96 SVKTNSPPFHRPPPLIDQNSVSKFKSRR-------ITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTL 968
             V+    P   P P   Q         R        +  ++ KVFW + V   V  S  G  + A+L+F +         + P  LT+ +T+W   F+PL    H+ +  +K  +    +     F    +    +  +     VLW +  Y  + +   + + D+ V+FC N S ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+++ A++ V  + ++ +      +L  ++LG+ N LF+  I V           ++++IPW     CG SI  L
Sbjct:   23 KVEGEERPREPPGPAEAQAPAGTEAGGRTSRHNWTCSQERLKKVFWGVAVVFCVCASWAGSTQLARLTFKT--------FDAPFTLTWFATNWNFLFFPLYYAGHVCKSTEKQSMKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINATDVSVLFCCNKSFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVGSASMS-ALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPVILYFTRVEYWNSFDDIPWGNL--CGFSILLL 313          
BLAST of slc35f-3 vs. UniProt/SwissProt
Match: sp|Q8BZK4|S35F4_MOUSE (Solute carrier family 35 member F4 OS=Mus musculus OX=10090 GN=Slc35f4 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 3.865e-10
Identity = 55/231 (23.81%), Postives = 114/231 (49.35%), Query Frame = 3
Query:  126 RPPPLIDQNSVSKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            RP     +N +   K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   I   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:  104 RPESSSQENGL---KARCLSCTSMVLKTIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPIKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 322          
BLAST of slc35f-3 vs. UniProt/SwissProt
Match: sp|A4IF30|S35F4_HUMAN (Solute carrier family 35 member F4 OS=Homo sapiens OX=9606 GN=SLC35F4 PE=2 SV=2)

HSP 1 Score: 65.855 bits (159), Expect = 4.367e-10
Identity = 51/220 (23.18%), Postives = 111/220 (50.45%), Query Frame = 3
Query:  159 SKFKSRRITVNK-IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-DN---TSIIWYKILISTATVAYAVFHVYTRSIIVTKN 803
            ++ K+R ++    + K  W +L+ L VS S +G  +  K+++ +           P F+T+ ST+W I F+P+    H+   ++K   +   +     F  + +    ++ R     +LW +  Y  + +   + + D+  +FC N + ++LL W++L  +F+ +RI+A I++ +G+++  Y DN    SII     + +A+ + A++ V  +  + + N
Sbjct:  148 NRIKARCLSCTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKN--------FYCPFFMTWFSTNWNIMFFPVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSALFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTS-ALYKVLFKMFLGSAN 358          
BLAST of slc35f-3 vs. TrEMBL
Match: A0A0H3YKG3 (Slc35f-3 OS=Schmidtea mediterranea OX=79327 GN=slc35f-3 PE=2 SV=1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 456/456 (100.00%), Postives = 456/456 (100.00%), Query Frame = 3
Query:   45 MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMRNLLFXXXXXXXXXXDTYWLKALSKXXXXXXXXXXXXXXXXXXXXTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG 1412
            MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRKEKKNDIINNLKLNLSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISLLYTLLGLVNTLFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMRNLLFIAAIPIIYIIDTYWLKALSKISDLQIVSLVLVIVSILLASTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG
Sbjct:    1 MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRKEKKNDIINNLKLNLSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISLLYTLLGLVNTLFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMRNLLFIAAIPIIYIIDTYWLKALSKISDLQIVSLVLVIVSILLASTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG 456          
BLAST of slc35f-3 vs. TrEMBL
Match: A0A4E0RI40 (Solute carrier family 35 member F4 OS=Fasciola hepatica OX=6192 GN=D915_001987 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.308e-41
Identity = 105/330 (31.82%), Postives = 172/330 (52.12%), Query Frame = 3
Query:   54 SEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVF-----WSILVCLIVSCSLIGFVESAKLSFVS--GSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMRNL 1022
            S+V+ ++   R  +  + N    HR    +     S  K  R    K  + F     WS L  + VS S+ G VE     ++S  G N+T  +V PPSF+T  +T+WL+  YP   I ++F   +     + +  +++    +     K + R  +   LW I  + +++S  ++ S+D   I        YLL W+++H++F ALR+IAFI+ SSG+I+N+Y +  ++W+K L S A VA ++F V  + II        +  Y    L N    WPIF+FTS+VTSAE ITW+ +PW YF G G+S+  L +S +++    +R +R +
Sbjct:  125 SDVQPRSDDERQSLDGRKNK---HRLRIDLPDTCPSMRKLSRAQTEKRLRRFCELCVWSALTWVAVSISMSGLVEFGSRIYLSRPGPNATQPLVKPPSFVTQFATAWLLLIYPTYLILNLFAHFEPIRSQDAMFTHVAILASDQPTIMKVLTRCSLFSALWQIFLHCLLRSLEVMSSIDCAAILAVLPCINYLLCWIIVHRRFCALRVIAFIMGSSGVILNIYSDLDLMWHKCLASIAVVALSLFIVIIKKIISRPTFGQFAAFYFGFSLFNLAIYWPIFLFTSIVTSAEPITWDLVPWKYFTGVGVSLLVLIVSMDMSSRKVSRAIRTV 451          
BLAST of slc35f-3 vs. TrEMBL
Match: A0A419PIE4 (Putative thiamine transporter SLC35F3 OS=Clonorchis sinensis OX=79923 GN=SLC35F3 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 8.663e-32
Identity = 91/285 (31.93%), Postives = 147/285 (51.58%), Query Frame = 3
Query:  186 VNKIYKVF-WSILVCLIVSCSLIGFVESAKLSFV-------SGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMR 1016
              K++ VF W++L   ++S S+  ++     S+V       + S S    V PPSFLT  +TSW +  YP+  + ++  + +K      L  ++     +     K + R  +L +LW +     ++S  +V  +D   I        YL  W+++H++F ALR+IAFIL+SSG+I N+Y +   +WYK L S A VA+A+FHV  + I         +      GL N L  WP+ V TS VTS E I W+++PW +FIG   S+    LS ++++    R +R
Sbjct:  186 AKKLFSVFCWAVLTTALLSISMTIWILCGTQSYVFVHLPNDTTSTSQQYFVRPPSFLTQFATSWTLLLYPIYLVCNVILRFEKASSSELLLNHMVILASDQPTIVKVLTRCILLSILWQLFLNCFLRSMEVVSPIDCAAIMAVLPCFHYLFSWIIVHRRFCALRVIAFILASSGVIFNIYSDQYSMWYKCLSSVAVVAFALFHVTLKRIASRPTFAQFAAFSFGFGLFNLLVFWPVVVITSFVTSVEPIEWHHVPWVHFIGVSASLLMFILSLDLSNRKVPRALR 470          
BLAST of slc35f-3 vs. TrEMBL
Match: A0A4S2MEQ9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000564 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.037e-31
Identity = 92/285 (32.28%), Postives = 147/285 (51.58%), Query Frame = 3
Query:  186 VNKIYKVF-WSILVCLIVSCSLIGFVESAKLSFV-------SGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMR 1016
              K++ VF W++L   ++S SL  ++     S+V       + S S    V PPSFLT  +TSW +  YP+  + ++  + +K      L  ++     +     K + R  +L +LW +  Y  ++S  +V  +D   I        YL  W+++H++F ALR+IAFIL+SSG+I N+Y +   +WYK L S A VA+A+F+V  + I         +      GL N L  WP+ V TS VTS E I W ++PW +FIG   S+    LS ++++    R +R
Sbjct:  171 AKKLFSVFCWAVLTTALLSISLTIWILCGTRSYVFANLPNDTTSPSQQYSVRPPSFLTQFATSWTLLLYPIYLVCNVILRFEKASSNELLLNHMVILASDQPTIVKVLTRCILLSILWQLFLYCFLRSMEVVSPIDCAAIMAVLPCFHYLFSWIIVHRRFCALRVIAFILASSGVIFNIYSDQYSMWYKCLSSVAVVAFALFNVTLKRIASRPTFAQFAAFCFGFGLFNLLVFWPVVVITSFVTSVEPIEWPHVPWVHFIGVSASLLMFILSLDLSNRKVPRALR 455          
BLAST of slc35f-3 vs. TrEMBL
Match: A0A5K4FC33 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.254e-30
Identity = 110/338 (32.54%), Postives = 189/338 (55.92%), Query Frame = 3
Query:  201 KVFWSILVCLIVSCSLIGFVESAKLSFVSG--SNSTIT-IVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFTLFLSTEIAHLTSTRGMRNLLFXXXXXXXXXXDTYWLKALSKXXXXXXXXXXXXXXXXXXXXTPSSWMNLCSSKIFKKHSP 1205
            ++ W  L    +S S + F+E     +V     NST   +VNPPS  +Y  + WLI  YP+  I ++  + +   +   +  +      +  +  K + R  +L  LW I  +  I+S  ++  +D   I       +YLL W+++H++F ALR+IAFI++SSG+I+N+Y +  ++WYK L S + + +++F V  + II       ++  Y  LG+ N L  WPIFVFTS++TS E+ITW  +PW+YFIG GIS   + +  +++   S R +R +  + A+PI  + + +W+K +  +S +QI SL+L+ ++ LL + P+SW    +  + K  SP
Sbjct:  190 QILWYFLTTAFISTSFVCFIECVPNIYVYTYWDNSTFQELVNPPSLASYTISFWLILIYPIYLIINLLFRLEALTVTEMIMNHAIIVASDQPKIMKIIARCSLLSSLWQIFIHCYIRSLRIITPIDCAAITAVLPCFLYLLCWIIVHRRFCALRVIAFIMASSGVILNIYSDQLVMWYKCLTSVSIIIFSLFIVVLKRIINKPTVGQMACFYFALGVFNILITWPIFVFTSIMTSTEVITWIYLPWDYFIGVGISYLGITVFMDMSCRKSKRIIRAIQPLCALPICIVYELFWMKRILTMSSVQISSLILITMACLLNAFPTSWQKHIAKMLKKNRSP 527          
BLAST of slc35f-3 vs. Ensembl Cavefish
Match: slc35f3a (solute carrier family 35 member F3a [Source:ZFIN;Acc:ZDB-GENE-080204-20])

HSP 1 Score: 68.5514 bits (166), Expect = 5.572e-12
Identity = 59/263 (22.43%), Postives = 123/263 (46.77%), Query Frame = 3
Query:  180 ITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGIS 956
            +T   + +  W +++ L +  S  G  + AKL        T+  +N P  LT+  TSW    +PL  + H+   + +       +        E +     + R+    VLW + +Y  ++    +P  D   +FC   + ++L+ W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+ A A++ V  + ++ +      +L  T+LG  N LFV  + +   L    +  +  ++PW     CG++
Sbjct:  127 VTAVHLRRALWGVIMVLCICGSWSGSTQLAKL--------TVRQLNIPFTLTWFCTSWNCIVFPLYYLGHLCCSKNRQTPRQRFRECCQFLGDEGLSVRTLLSRVAPFGVLWILTSYLYLQGLRRIPPTDACALFCCTRAFVFLISWIVLRDRFMGIRIVAAILAIAGIVMITYADGFHSPSVIGISLIVGSASTA-AMYKVLFKLVLGSAKLGEAALYLTVLGGANMLFVSIVPLILLLTGVEDFGSPGDVPWLSL--CGVA 378          
BLAST of slc35f-3 vs. Ensembl Cavefish
Match: slc35f3a (solute carrier family 35 member F3a [Source:ZFIN;Acc:ZDB-GENE-080204-20])

HSP 1 Score: 68.1662 bits (165), Expect = 7.222e-12
Identity = 58/259 (22.39%), Postives = 120/259 (46.33%), Query Frame = 3
Query:  180 ITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIG 944
            +T   + +  W +++ L +  S  G  + AKL        T+  +N P  LT+  TSW    +PL  + H+   + +       +        E +     + R+    VLW + +Y  ++    +P  D   +FC   + ++L+ W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++ +A+ A A++ V  + ++ +      +L  T+LG  N LFV  + +   L    +  +  ++PW    G
Sbjct:  155 VTAVHLRRALWGVIMVLCICGSWSGSTQLAKL--------TVRQLNIPFTLTWFCTSWNCIVFPLYYLGHLCCSKNRQTPRQRFRECCQFLGDEGLSVRTLLSRVAPFGVLWILTSYLYLQGLRRIPPTDACALFCCTRAFVFLISWIVLRDRFMGIRIVAAILAIAGIVMITYADGFHSPSVIGISLIVGSASTA-AMYKVLFKLVLGSAKLGEAALYLTVLGGANMLFVSIVPLILLLTGVEDFGSPGDVPWLSLCG 404          
BLAST of slc35f-3 vs. Ensembl Cavefish
Match: slc35f3b (solute carrier family 35 member F3b [Source:ZFIN;Acc:ZDB-GENE-090312-118])

HSP 1 Score: 55.8398 bits (133), Expect = 2.492e-8
Identity = 39/175 (22.29%), Postives = 78/175 (44.57%), Query Frame = 3
Query:  123 HRPPPLIDQNSVSKFKSR-RITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFV 644
             +P  +ID     K +   R+T  ++ K  W + + + V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  I H+ +  ++       +     F  + +    +  ++    +LW I  Y  +++   + + D+  +FC N + ++LL W++L    V
Sbjct:   72 KQPTTIIDCAGKRKLQCCVRVTAVQVRKALWGVAMVMCVCSSWAGSTQLAKLTFRQ--------FDAPFTLTWFATTWNCLFFPLYYIGHMCKSPERQTPRQRFRECCRFFGEDGLTAKVFFTKVAPFGLLWIITNYLYLQALRKINTTDVSALFCCNKAFVFLLSWIVLRDPLV 238          
BLAST of slc35f-3 vs. Ensembl Sea Lamprey
Match: slc35f4 (solute carrier family 35 member F4 [Source:ZFIN;Acc:ZDB-GENE-131121-49])

HSP 1 Score: 51.9878 bits (123), Expect = 8.095e-8
Identity = 36/142 (25.35%), Postives = 74/142 (52.11%), Query Frame = 3
Query:  459 ESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVY-------DNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVW 863
            E +    +V R F    LW    Y  + +   +P  D   +FC N + ++LL W++L  +FV +R++A IL+ +G+++ VY       ++ S++   + + +A+ + A++ +  + ++ +      S   + LGL + LFVW
Sbjct:    1 EGVTARLFVKRAFPFCALWLATHYLYLLALRKLPPSDASALFCCNKAFVFLLSWIVLKDRFVGVRMVAAILAIAGIVMMVYVQYVDGFNHDSVVGVALAVGSASTS-ALYKILCKMLLGSATLGEASQFLSSLGLFDLLFVW 141          
BLAST of slc35f-3 vs. Ensembl Medaka
Match: slc35f3b (solute carrier family 35 member F3 [Source:NCBI gene;Acc:101174371])

HSP 1 Score: 73.559 bits (179), Expect = 1.383e-13
Identity = 64/271 (23.62%), Postives = 133/271 (49.08%), Query Frame = 3
Query:  177 RITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLV------TSAELI-TWNNIPWNYFIGCGIS 956
            R+T  ++ K  W I + + V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  I H+ +  ++       +     F  + +    +  ++    +LW +  Y  +++   + + D+  +FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+++ A++ V  + ++ +      +L  +++G  N       FVF S V      T  E I +  +IPW Y   CG++
Sbjct:  145 RVTAVQVRKALWGIAMVVCVCSSWAGSTQLAKLTFRK--------FDAPFTLTWFATTWNGLFFPLYYIGHMCKSPERQTPKQRFRECCRFFGDDGLTPKVFFTKVAPFGLLWILTNYLYLQALRKINTTDVSALFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGITLVVASASMS-ALYKVLFKMVLGSAKFGEAALFLSIVGSAN-------FVFLSFVPVILYFTHVEYISSAADIPWAYL--CGVA 397          
BLAST of slc35f-3 vs. Ensembl Medaka
Match: slc35f3b (solute carrier family 35 member F3 [Source:NCBI gene;Acc:101174371])

HSP 1 Score: 72.7886 bits (177), Expect = 2.072e-13
Identity = 64/271 (23.62%), Postives = 133/271 (49.08%), Query Frame = 3
Query:  177 RITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNT----SIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLV------TSAELI-TWNNIPWNYFIGCGIS 956
            R+T  ++ K  W I + + V  S  G  + AKL+F           + P  LT+ +T+W   F+PL  I H+ +  ++       +     F  + +    +  ++    +LW +  Y  +++   + + D+  +FC N + ++LL W++L  +F+ +RI+A IL+ +G+++  Y +     S+I   +++++A+++ A++ V  + ++ +      +L  +++G  N       FVF S V      T  E I +  +IPW Y   CG++
Sbjct:   62 RVTAVQVRKALWGIAMVVCVCSSWAGSTQLAKLTFRK--------FDAPFTLTWFATTWNGLFFPLYYIGHMCKSPERQTPKQRFRECCRFFGDDGLTPKVFFTKVAPFGLLWILTNYLYLQALRKINTTDVSALFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGITLVVASASMS-ALYKVLFKMVLGSAKFGEAALFLSIVGSAN-------FVFLSFVPVILYFTHVEYISSAADIPWAYL--CGVA 314          
BLAST of slc35f-3 vs. Planmine SMEST
Match: SMESG000077930.1 (SMESG000077930.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 306/307 (99.67%), Postives = 307/307 (100.00%), Query Frame = 3
Query:   45 MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRXXXXXXXXXXXXXXXSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISXXXXXXXXXXXXFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFT 965
            MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRKEKKNDIINNLKLNLSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISLLYTLLGLVNTLFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIF+
Sbjct:    1 MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNKIYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLSTSWLISFYPLQCITHIFRKEKKNDIINNLKLNLSGFFPESMRWYKYVFRMFVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFVALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIVTKNQDHISLLYTLLGLVNTLFVWPIFVFTSLVTSAELITWNNIPWNYFIGCGISIFS 307          
BLAST of slc35f-3 vs. Planmine SMEST
Match: SMESG000077937.1 (SMESG000077937.1)

HSP 1 Score: 217.624 bits (553), Expect = 2.046e-68
Identity = 150/151 (99.34%), Postives = 150/151 (99.34%), Query Frame = 3
Query:  960 FTLFLSTEIAHLTSTRGMRNLLFXXXXXXXXXXDTYWLKALSKXXXXXXXXXXXXXXXXXXXXTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG 1412
             TLFLSTEIAHLTSTRGMRNLLFIAAIPIIYIIDTYWLKALSKISDLQIVSLVLVIVSILLASTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG
Sbjct:   42 LTLFLSTEIAHLTSTRGMRNLLFIAAIPIIYIIDTYWLKALSKISDLQIVSLVLVIVSILLASTPSSWMNLCSSKIFKKHSPYQMRRVSISARSNLIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQRLGSIFG 192          
The following BLAST results are available for this feature:
BLAST of slc35f-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC35F35.147e-1722.77solute carrier family 35 member F3 [Source:HGNC Sy... [more]
SLC35F39.531e-1622.19solute carrier family 35 member F3 [Source:HGNC Sy... [more]
SLC35F49.093e-1123.18solute carrier family 35 member F4 [Source:HGNC Sy... [more]
SLC35F41.318e-1023.18solute carrier family 35 member F4 [Source:HGNC Sy... [more]
SLC35F41.441e-923.67solute carrier family 35 member F4 [Source:HGNC Sy... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35f-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG423223.361e-1531.33gene:FBgn0259222 transcript:FBtr0305058[more]
CG423223.361e-1531.33gene:FBgn0259222 transcript:FBtr0305057[more]
CG423223.361e-1531.33gene:FBgn0259222 transcript:FBtr0299768[more]
CG423223.645e-1531.33gene:FBgn0259222 transcript:FBtr0345263[more]
CG423223.809e-1531.33gene:FBgn0259222 transcript:FBtr0299771[more]
back to top
BLAST of slc35f-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc35f3a1.271e-1320.39solute carrier family 35 member F3a [Source:ZFIN;A... [more]
slc35f3a1.839e-1320.39solute carrier family 35 member F3a [Source:ZFIN;A... [more]
slc35f3a2.168e-1320.39solute carrier family 35 member F3a [Source:ZFIN;A... [more]
slc35f3b5.543e-1322.97solute carrier family 35 member F3b [Source:ZFIN;A... [more]
slc35f3b3.352e-1222.17solute carrier family 35 member F3b [Source:ZFIN;A... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000051338.11.302e-1123.44solute carrier family 35 member F3 [Source:NCBI ge... [more]
elp31.394e-1123.38elongator acetyltransferase complex subunit 3 [Sou... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc35f39.013e-1623.18solute carrier family 35, member F3 [Source:MGI Sy... [more]
Slc35f31.643e-1523.51solute carrier family 35, member F3 [Source:MGI Sy... [more]
Slc35f45.525e-1123.81solute carrier family 35, member F4 [Source:MGI Sy... [more]
Slc35f31.304e-827.22solute carrier family 35, member F3 [Source:MGI Sy... [more]
Slc35f46.211e-822.95solute carrier family 35, member F4 [Source:MGI Sy... [more]
back to top
BLAST of slc35f-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8IY50|S35F3_HUMAN4.577e-1522.19Putative thiamine transporter SLC35F3 OS=Homo sapi... [more]
sp|Q1LZI2|S35F3_MOUSE1.149e-1423.51Putative thiamine transporter SLC35F3 OS=Mus muscu... [more]
sp|Q8BZK4|S35F4_MOUSE3.865e-1023.81Solute carrier family 35 member F4 OS=Mus musculus... [more]
sp|A4IF30|S35F4_HUMAN4.367e-1023.18Solute carrier family 35 member F4 OS=Homo sapiens... [more]
back to top
BLAST of slc35f-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKG30.000e+0100.00Slc35f-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4E0RI406.308e-4131.82Solute carrier family 35 member F4 OS=Fasciola hep... [more]
A0A419PIE48.663e-3231.93Putative thiamine transporter SLC35F3 OS=Clonorchi... [more]
A0A4S2MEQ92.037e-3132.28Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4FC332.254e-3032.54Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slc35f3a5.572e-1222.43solute carrier family 35 member F3a [Source:ZFIN;A... [more]
slc35f3a7.222e-1222.39solute carrier family 35 member F3a [Source:ZFIN;A... [more]
slc35f3b2.492e-822.29solute carrier family 35 member F3b [Source:ZFIN;A... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35f48.095e-825.35solute carrier family 35 member F4 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc35f-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35f-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc35f-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35f3b1.383e-1323.62solute carrier family 35 member F3 [Source:NCBI ge... [more]
slc35f3b2.072e-1323.62solute carrier family 35 member F3 [Source:NCBI ge... [more]
back to top
BLAST of slc35f-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077930.10.000e+099.67SMESG000077930.1[more]
SMESG000077937.12.046e-6899.34SMESG000077937.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033309
GenBankAKN21653.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033309 ID=SMED30033309|Name=slc35f-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1473bp
TTCTACTAGGAATTTGAGTTGCAGAGAAATTATTATTGATATGAATGTCT
GCGAGCGAAGTTGAAGATAAGGCATCTGTTGCGAGGAGTGAAGTGAGTGT
GAAAACCAATTCACCTCCATTCCATAGGCCCCCACCACTGATCGATCAGA
ATTCTGTATCAAAATTCAAATCTCGACGAATAACAGTAAACAAAATTTAT
AAAGTCTTTTGGAGTATTTTAGTATGTTTGATCGTCAGTTGCAGTCTCAT
TGGATTTGTTGAATCTGCAAAACTGTCCTTCGTCTCCGGTTCGAATAGCA
CTATTACAATTGTCAATCCTCCAAGTTTTCTTACATATCTTTCTACGTCA
TGGTTGATCAGTTTTTATCCTCTTCAATGTATAACACACATATTTCGGAA
AGAAAAGAAAAATGACATCATTAATAATTTGAAATTAAACCTTTCGGGAT
TTTTTCCTGAGAGCATGAGATGGTATAAATATGTATTTAGGATGTTTGTC
CTAGTTGTATTGTGGAATATTATTACGTACTCCATAATAAAATCTTCTAA
TCTCGTTCCATCTGTTGATATAGTCGTAATATTTTGCACTAATTCTTCTA
CCATGTATTTATTACATTGGGTTATGCTCCATAAGAAATTTGTAGCATTA
AGAATAATTGCTTTTATTCTCAGTTCAAGTGGAATGATTGTAAATGTGTA
CGACAATACTAGTATTATTTGGTACAAAATACTTATTTCAACAGCCACTG
TCGCTTATGCTGTATTTCATGTATATACACGATCGATAATAGTTACTAAA
AATCAAGATCATATATCTCTACTTTATACACTTCTAGGATTGGTGAACAC
ATTGTTCGTATGGCCCATTTTCGTTTTCACGTCACTTGTGACATCGGCAG
AGCTTATAACGTGGAATAATATTCCATGGAATTATTTCATCGGCTGCGGA
ATTTCGATATTTACTCTTTTTCTGTCTACTGAAATTGCTCATTTGACATC
AACTAGAGGAATGAGAAATTTGCTTTTCATTGCTGCTATTCCGATTATTT
ACATAATCGACACTTATTGGTTGAAAGCACTAAGCAAGATTTCAGACCTT
CAAATCGTGAGCTTGGTATTAGTAATTGTCTCTATCCTTTTGGCTTCAAC
TCCATCTAGCTGGATGAATTTATGTTCGTCGAAAATATTTAAAAAGCATT
CACCATATCAAATGAGAAGAGTTTCTATTTCAGCTCGATCCAACTTAATT
GGCAATGGTGGAGTTCGCATGAGCGCTTCTTTAAACAATAGTGCCTCATC
TCCGGGTCATCGAGATTCCTTGGCATCAGAGATGTTGCACAAAATCGGCA
ATATAAGCACCCACATATTTGCATCTCAAAAAACGAGGCAAAGACTCGGA
AGTATATTTGGATAACATGATAATGTTTGTATGATATGTTTGCAAATCAT
TCAATATAATCCTAATGCGTTAC
back to top

protein sequence of SMED30033309-orf-1

>SMED30033309-orf-1 ID=SMED30033309-orf-1|Name=SMED30033309-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=457bp
MSASEVEDKASVARSEVSVKTNSPPFHRPPPLIDQNSVSKFKSRRITVNK
IYKVFWSILVCLIVSCSLIGFVESAKLSFVSGSNSTITIVNPPSFLTYLS
TSWLISFYPLQCITHIFRKEKKNDIINNLKLNLSGFFPESMRWYKYVFRM
FVLVVLWNIITYSIIKSSNLVPSVDIVVIFCTNSSTMYLLHWVMLHKKFV
ALRIIAFILSSSGMIVNVYDNTSIIWYKILISTATVAYAVFHVYTRSIIV
TKNQDHISLLYTLLGLVNTLFVWPIFVFTSLVTSAELITWNNIPWNYFIG
CGISIFTLFLSTEIAHLTSTRGMRNLLFIAAIPIIYIIDTYWLKALSKIS
DLQIVSLVLVIVSILLASTPSSWMNLCSSKIFKKHSPYQMRRVSISARSN
LIGNGGVRMSASLNNSASSPGHRDSLASEMLHKIGNISTHIFASQKTRQR
LGSIFG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000461lateral branch
Vocabulary: INTERPRO
TermDefinition
IPR026505Solute_c_fam_35_mem_F3/F4
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availableTMHMMTMhelixcoord: 256..278
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 199..218
NoneNo IPR availableTMHMMTMhelixcoord: 170..192
NoneNo IPR availableTMHMMTMhelixcoord: 325..342
NoneNo IPR availableTMHMMTMhelixcoord: 54..75
NoneNo IPR availableTMHMMTMhelixcoord: 352..374
NoneNo IPR availableTMHMMTMhelixcoord: 146..165
NoneNo IPR availableTMHMMTMhelixcoord: 293..312
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
IPR026505Solute carrier family 35 member F3/F4PANTHERPTHR19346UNCHARACTERIZEDcoord: 44..378