tRNA 2-thiocytidine biosynthesis protein TtcA

Overview
NametRNA 2-thiocytidine biosynthesis protein TtcA
Smed IDSMED30033303
Length (bp)2810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of tRNA 2-thiocytidine biosynthesis protein TtcA (SMED30033303) t-SNE clustered cells

Violin plots show distribution of expression levels for tRNA 2-thiocytidine biosynthesis protein TtcA (SMED30033303) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of tRNA 2-thiocytidine biosynthesis protein TtcA (SMED30033303) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for tRNA 2-thiocytidine biosynthesis protein TtcA (SMED30033303) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033303

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 SmedASXL_016356SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermal cellSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 dd_Smed_v4_16438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 dd_Smed_v6_16438_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 dd_Smed_v4_16438_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 dd_Smed_v4_16438_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30033303SMESG000040454.1 SMESG000040451.1 SMESG000038134.1 SMESG000038132.1 dd_Smed_v4_16438_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Human
Match: DCDC2 (doublecortin domain containing 2 [Source:HGNC Symbol;Acc:HGNC:18141])

HSP 1 Score: 51.2174 bits (121), Expect = 8.806e-6
Identity = 49/214 (22.90%), Postives = 104/214 (48.60%), Query Frame = 2
Query:   56 LMNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLN--DLTMLTSVGSR-NLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQEL 688
            ++  + +Y+NGD     +++++ +   +  +  FL+E+T  +Q     V+ I     G +++ +D       YVA  + E F K +Y+  G+I    +   +  +   + SR N++ R  +    +   I +  NGD    A  + +   +  +  ++L+ + E++ L S   + RLY L G+ ++   E+ENG+ YV    +K++ + Y + L
Sbjct:   15 VVKSVLVYRNGDPFYAGRRVVIHEKK-VSSFEVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIQSGGNYVAGGQ-EAFKKLNYLDIGEIKKRPMEVVNTEVKPVIHSRINVSARF-RKPLQEPCTIFLIANGDLINPASRLLIPRKTLNQWDHVLQMVTEKITLRSGA-VHRLYTLEGKLVESGAELENGQFYVAVGRDKFKKLPYSELL 224          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Celegans
Match: Y71H2B.5 (pep chromosome:WBcel235:III:2608017:2618856:1 gene:WBGene00022195.1 transcript:Y71H2B.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71H2B.5)

HSP 1 Score: 401.749 bits (1031), Expect = 1.106e-124
Identity = 234/608 (38.49%), Postives = 339/608 (55.76%), Query Frame = 2
Query:  836 AENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPP---IIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVL--MKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAK-RIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKYLQDDSYLFEECTDG-------------------LRWFMLPSEAAK 2584
            AEN  S   +L  ++  + IGR  +  GPFG R   YCDYTAS R    IE ++  EVLP Y NTH++ T  + QTT F HEAR+ I       D D VIFTGSG+T A+  L + MS  K     I+V    EHHSNLLPWRKIA     I+  + G++D+  L++VL  +++ H     + ++IG F AASN+TGIL D+  V+ I+  ++   +WD+ASA PY+ I +N   P         DAV+FS HKF GG  SPGVLIVK+++  +  T P   GGGTVFFV      +LK++E REEGGT + VG++R  +  ++K SI  + +   E  +      K++  +NLV+LG +    R+P+FSFLIR   +    L+ HH++I  LLNDLFGIQ+R+GC CAGPY   LLGIDE+L+ +++S +      +  HL    ++ +++  +PGF RI+ PYF   +EV+ IL+AI F+A+H   FL  YQ   ++ EW H + +     + L       G + +    +KTK   P +           + ++ +  K L+    L +E +D                    LRWF+LP E A+
Sbjct:   28 AENSNS--TELLSWMRNDEIGRKSVMDGPFGARKVTYCDYTASARAFTSIETYIQHEVLPFYGNTHSSVTVTAEQTTLFMHEARQEIRAFSGCGDQDSVIFTGSGSTCAVELLVHLMSDGKDDEEVIVVHSSQEHHSNLLPWRKIAKECRNIEELENGQIDLVHLQNVLKEIRESH----GSIKIIGTFCAASNLTGILIDIQNVTKILKMFDAIAIWDFASAAPYIPILVNGTYP--------LDAVFFSGHKFPGGVSSPGVLIVKKSIIQA--TKPKRIGGGTVFFVNSTDEWYLKEVEHREEGGTADAVGAVRLAMAVKMKRSIGEDTIKNLESSISHLVLQKIRTIENLVLLGPSVVDHRLPVFSFLIR---DPQSQLFFHHNYISVLLNDLFGIQTRAGCMCAGPYSQKLLGIDEELSQRFVSAIQESPDLDRTHLRRQAEYSQQEFLRPGFTRISFPYFFKMAEVDEILEAIRFIAKHAADFLHLYQVNCETGEWHHQNQRVFHGRRWL-------GHVQFTPTGLKTK---PLA-----------VPEVPDMKKCLEAAKVLAQESSDALNISKIPDGRLAINSEYHELRWFVLPIEVAE 595          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Zebrafish
Match: si:dkey-25g12.4 (si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-73])

HSP 1 Score: 53.9138 bits (128), Expect = 6.015e-7
Identity = 47/203 (23.15%), Postives = 90/203 (44.33%), Query Frame = 2
Query:   68 IQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKY 676
            + +++NGD     ++ I+ +   + +  +FL  +T  +      V+ I   P G +V ++   +   +YVA   GE   K DY    +      ++ ++   V SR +     + I  ++  I V+ NGD       + +   +     N+L  + E+V L +   + RL  LNG  ++   E++N  SYV    EK+  + Y
Sbjct:   12 VTVFRNGDAFYPGRRFIINQRQSVTF-DTFLNTVTRDITAPFGAVRNIYT-PNGHRVVSLQQLMHGQMYVAA-GGERLKKMDYNNITQKPAKKKSE-SIQPVVHSRIIVPARWKRISNESCTINVFINGDILVPPARILIPKHTLASWENVLAMVTEKVSLRTGA-VHRLCMLNGRPLRGAYELQNNHSYVAVGAEKFRSLPY 209          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Xenopus
Match: DCDC2 (doublecortin domain containing 2 [Source:NCBI gene;Acc:100493004])

HSP 1 Score: 68.5514 bits (166), Expect = 2.961e-11
Identity = 70/259 (27.03%), Postives = 120/259 (46.33%), Query Frame = 2
Query:   68 IQIYKNGD-FRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVG-SR-NLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKY-----------------GQELPEIKGNRVALKNLQLKQ--SHDGQKNIVDKLM 778
            + +++NGD F    + +I +K  G F    FL+++T  +Q     V+ I     G +V ++DD    + YVA    E F K DY+  G+I   +++ L+ +  V  SR N++ R  +N   +   + +  NGD     I + +   +  +   +L  + E+V L S   + RLY L G  I++  E+ENG+ YV    EK++ + Y                    LP I G R + +N   +Q  S  G  + VD ++
Sbjct:   26 VHVFRNGDPFYRGRRMLIHEKRVGTF--DVFLKDVTGGVQAPFGAVRNIYTPRNGHRVTSLDDLQPGECYVAGGR-ETFKKLDYLHIGEIKRKTVDPLSQVKPVSHSRINVSARFRKNF-QEPCTVFLVANGDTMNPFIRLLIPRKTLEQWELVLALVTEKVKLRSGA-VHRLYTLEGTPIQNGLELENGQFYVAVGREKFKKLPYSDLIFSKASMRRAHGSKASSLPPINGFRKSKENRHERQIKSTGGSSDTVDNMI 279          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 57.3806 bits (137), Expect = 5.254e-8
Identity = 51/227 (22.47%), Postives = 110/227 (48.46%), Query Frame = 2
Query:   17 NTEISQKNTLKI*LMNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKI---SIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQEL 688
            N   S+ + L   ++  + +Y+NGD     +++++ +   +  +  FL+E+T  +Q     V+ I     G +++ +D       YVA    E F K +Y+  G+I    ++++N           N++ R  +++  +   I +  NGD  + A  + +   +  +  ++L+ + E++ L S   + RLY L G+ ++   E+ENG+ YV    +K++ + Y + L
Sbjct:    2 NGPSSRSSHLSQPVVKSVLVYRNGDPFFAGRRVVIHEKK-VSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVAGGP-EAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVSARFRKSL-HEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLRSGA-VHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELL 224          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Mouse
Match: Dcdc2a (doublecortin domain containing 2a [Source:MGI Symbol;Acc:MGI:2652818])

HSP 1 Score: 51.6026 bits (122), Expect = 4.094e-6
Identity = 53/228 (23.25%), Postives = 114/228 (50.00%), Query Frame = 2
Query:   17 NTEISQKNTLKI*LMNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKI---SIDSLNDLTMLTSVGSR-NLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQEL 688
            N   S+ + L   ++  + +Y+NGD     +++++ +   +  +  FL+E+T  +Q     V+ I     G +++ +D       YVA    E F K +Y+  G+I    ++++N   +   + SR N++ R  +++  +   I +  NGD  + A  + +   +  +  ++L+ + E++ L S   + RLY L G+ ++   E+ENG+ YV    +K++ + Y + L
Sbjct:    2 NGPSSRSSHLSQPVVKSVLVYRNGDPFFAGRRVVIHEKK-VSSFDVFLKEVTGGVQAPFGAVRNIYTPRTGHRIRKLDQIESGGNYVAGGP-EAFKKLNYLDIGEIKKRPMEAVN-TEVKPVIHSRINVSARFRKSL-HEPCTIFLIANGDLISPASRLLIPKKALNQWDHVLQMVTEKITLRSGA-VHRLYTLEGKLVESGAELENGQFYVAVGRDKFKRLPYSELL 224          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Match: sp|P99177|CSD_STAAN (Probable cysteine desulfurase OS=Staphylococcus aureus (strain N315) OX=158879 GN=csd PE=1 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.005e-29
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 2
Query:  926 GERLAVYCDYTASGR-PLRFIEEFLTKEVLPEY-----SNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSH---RKPPIIVTGPFEHHSNLLPWRKIA----YSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGP 2050
            G+RLA Y D TA+ + P++ +       VL +Y     SN H     L    T+    ARE + R  NA   + +IFT  G T +IN +A++       +   IV    EHH+N++PW+++A     ++  I +   GEL+IED++  +         +++  I   +  SNV G + DV  ++ I H++   +  D A A P++++DM      MN      D   FS HK + GP   GVL  KR L    E  P   GG  + FV +    +  D+  + E GTP I  +I      +  + I  + +H+ E+ L  +A+ ++   + + I G  K +R  + +F ++          +H H + + + D  G+  R+G  CA P
Sbjct:   24 GKRLA-YLDSTATSQTPMQVLN------VLEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI---------NDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQE----MN-----ADFYSFSGHKML-GPTGIGVLFGKRELLQKME--PIEFGGDMIDFVSKYDATW-ADLPTKFEAGTPLIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQD---------VHPHDVATAV-DTEGVAVRAGHHCAQP 371          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Match: sp|P63518|CSD_STAAM (Probable cysteine desulfurase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=csd PE=3 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 9.005e-29
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 2
Query:  926 GERLAVYCDYTASGR-PLRFIEEFLTKEVLPEY-----SNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSH---RKPPIIVTGPFEHHSNLLPWRKIA----YSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGP 2050
            G+RLA Y D TA+ + P++ +       VL +Y     SN H     L    T+    ARE + R  NA   + +IFT  G T +IN +A++       +   IV    EHH+N++PW+++A     ++  I +   GEL+IED++  +         +++  I   +  SNV G + DV  ++ I H++   +  D A A P++++DM      MN      D   FS HK + GP   GVL  KR L    E  P   GG  + FV +    +  D+  + E GTP I  +I      +  + I  + +H+ E+ L  +A+ ++   + + I G  K +R  + +F ++          +H H + + + D  G+  R+G  CA P
Sbjct:   24 GKRLA-YLDSTATSQTPMQVLN------VLEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI---------NDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQE----MN-----ADFYSFSGHKML-GPTGIGVLFGKRELLQKME--PIEFGGDMIDFVSKYDATW-ADLPTKFEAGTPLIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQD---------VHPHDVATAV-DTEGVAVRAGHHCAQP 371          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Match: sp|Q8NXH0|CSD_STAAW (Probable cysteine desulfurase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=csd PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.179e-28
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 2
Query:  926 GERLAVYCDYTASGR-PLRFIEEFLTKEVLPEY-----SNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSH---RKPPIIVTGPFEHHSNLLPWRKIA----YSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGP 2050
            G+RLA Y D TA+ + P++ +       VL +Y     SN H     L    T+    ARE + R  NA   + +IFT  G T +IN +A++       +   IV    EHH+N++PW+++A     ++  I +   GEL+IED++  +         +++  I   +  SNV G + DV  ++ I H++   +  D A A P++++DM      MN      D   FS HK + GP   GVL  KR L    E  P   GG  + FV +    +  D+  + E GTP I  +I      +  + I  + +H+ E+ L  +A+ ++   + + I G  K +R  + +F ++          +H H + + + D  G+  R+G  CA P
Sbjct:   24 GKRLA-YLDSTATSQTPVQVLN------VLEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI---------NDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQE----MN-----ADFYSFSGHKML-GPTGIGVLFGKRELLQKME--PIEFGGDMIDFVSKYDATW-ADLPTKFEAGTPLIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQD---------VHPHDVATAV-DTEGVAVRAGHHCAQP 371          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Match: sp|Q6GB11|CSD_STAAS (Probable cysteine desulfurase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=csd PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.179e-28
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 2
Query:  926 GERLAVYCDYTASGR-PLRFIEEFLTKEVLPEY-----SNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSH---RKPPIIVTGPFEHHSNLLPWRKIA----YSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGP 2050
            G+RLA Y D TA+ + P++ +       VL +Y     SN H     L    T+    ARE + R  NA   + +IFT  G T +IN +A++       +   IV    EHH+N++PW+++A     ++  I +   GEL+IED++  +         +++  I   +  SNV G + DV  ++ I H++   +  D A A P++++DM      MN      D   FS HK + GP   GVL  KR L    E  P   GG  + FV +    +  D+  + E GTP I  +I      +  + I  + +H+ E+ L  +A+ ++   + + I G  K +R  + +F ++          +H H + + + D  G+  R+G  CA P
Sbjct:   24 GKRLA-YLDSTATSQTPVQVLN------VLEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI---------NDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQE----MN-----ADFYSFSGHKML-GPTGIGVLFGKRELLQKME--PIEFGGDMIDFVSKYDATW-ADLPTKFEAGTPLIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQD---------VHPHDVATAV-DTEGVAVRAGHHCAQP 371          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Match: sp|Q6GIH2|CSD_STAAR (Probable cysteine desulfurase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=csd PE=3 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 1.179e-28
Identity = 109/388 (28.09%), Postives = 182/388 (46.91%), Query Frame = 2
Query:  926 GERLAVYCDYTASGR-PLRFIEEFLTKEVLPEY-----SNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSH---RKPPIIVTGPFEHHSNLLPWRKIA----YSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGP 2050
            G+RLA Y D TA+ + P++ +       VL +Y     SN H     L    T+    ARE + R  NA   + +IFT  G T +IN +A++       +   IV    EHH+N++PW+++A     ++  I +   GEL+IED++  +         +++  I   +  SNV G + DV  ++ I H++   +  D A A P++++DM      MN      D   FS HK + GP   GVL  KR L    E  P   GG  + FV +    +  D+  + E GTP I  +I      +  + I  + +H+ E+ L  +A+ ++   + + I G  K +R  + +F ++          +H H + + + D  G+  R+G  CA P
Sbjct:   24 GKRLA-YLDSTATSQTPVQVLN------VLEDYYKRYNSNVHRGVHTLGSLATDGYENARETVRRFINAKYFEEIIFT-RGTTASINLVAHSYGDANVEEGDEIVVTEMEHHANIVPWQQLAKRKNATLKFIPMTADGELNIEDIKQTI---------NDKTKIVAIAHISNVLGTINDVKTIAEIAHQHGAIISVDGAQAAPHMKLDMQE----MN-----ADFYSFSGHKML-GPTGIGVLFGKRELLQKME--PIEFGGDMIDFVSKYDATW-ADLPTKFEAGTPLIAQAIGLAEAIRYLERIGFDAIHKYEQELTIYAYEQMSAIEGIEIYGPPKDRRAGVITFNLQD---------VHPHDVATAV-DTEGVAVRAGHHCAQP 371          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Match: A0A504YJA7 (tRNA 2-thiocytidine biosynthesis protein TtcA OS=Fasciola gigantica OX=46835 GN=FGIG_05804 PE=4 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 298/619 (48.14%), Postives = 406/619 (65.59%), Query Frame = 2
Query:  836 AENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIR-------CEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKY-----LQDDSYLFEECTDGLRWFMLPSEAAKILW---DSPSISKPSKCIFTPGTI 2647
            AEN  S  + L  YI  NIIGR+ IF+GPFG+R  +YCD+TAS + L FIE+F+  EVLP Y NTHTT    S+QTT FRHEAR+II  +   +D D VIF GSG TGAI+KL + +   +PPI++ GPFEHHSN+LPWR +A+ + R   +  G + +E LES+L  +  +      +LI   +AASNVTGIL DVN  S + H+Y G   WDYA+A PY++IDMNPVV G +   VYKDAVYFSMHKFIGGPQ+PGVL+ KR+LF + E  P   GGGTVFFV R+  ++LK++EEREEGGTP IV SIR+GLV QLK+++T E + ERE+  V   W +L   +N+++LGG +A R+PI S ++R        +  R   L+LHH+F+ SLLNDLFG+Q+R GCACAGPY MDLLGIDE LA  Y   LVG  + E      + D  +R++ +PGF R++LP+F   +E +FILDAI FVA HG+ FLP Y++ P ++EW H  H  +   K L  ++Y  G M W+   ++T+   P  F   +  A+ ++ + V    +     + DD+  F+E T  LRWF+LPSEAA  +    +  ++S P+   + PG++
Sbjct:   93 AENNASDPLHLIGYINENIIGRNKIFRGPFGDRQTIYCDWTASAKSLFFIEDFINSEVLPNYGNTHTTTNVTSLQTTMFRHEARDIIRNAVRGSDEDAVIFVGSGCTGAIHKLIHNLHLEQPPIVIVGPFEHHSNILPWRHLAHKVCRASTDSSGTVSLESLESLLRVESVVAQELGCKLIVCMAAASNVTGILVDVNAFSSLTHRYGGLAFWDYATAAPYVKIDMNPVVTGPDHDYVYKDAVYFSMHKFIGGPQTPGVLVAKRSLFKAGEVQPSGCGGGTVFFVRRDGQVYLKEVEEREEGGTPAIVESIRAGLVMQLKEAVTCEAIMEREEQHVRRIWDRLADCRNIIVLGGKEAPRLPIISVVVRHSYPIPSTDNSRASCLFLHHNFVASLLNDLFGVQARGGCACAGPYAMDLLGIDEALAKLYEETLVGCRL-ETHKRDGLLDNSQREVIRPGFTRVSLPFFTPDAEADFILDAIKFVATHGWAFLPLYRYSPSTAEWVHRQHDPSRDRKWLGNVNYTDGKMTWSSTRLRTEMPAPQDFEACMKAAYEELCRAVKTIDFSAASPVPDDTACFDEPTRELRWFLLPSEAAAQIRNEINQLAVSNPNPSPWHPGSL 710          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Match: A0A4E0RJU7 (tRNA 2-thiocytidine biosynthesis protein TtcA OS=Fasciola hepatica OX=6192 GN=D915_001180 PE=4 SV=1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 297/619 (47.98%), Postives = 405/619 (65.43%), Query Frame = 2
Query:  836 AENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIR-------CEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKY-----LQDDSYLFEECTDGLRWFMLPSEAAKILW---DSPSISKPSKCIFTPGTI 2647
            AEN  S  + L  YI  NIIGR+ IF+GPFG+R  +YCD+TAS + L FIE+F++ EVLP Y NTHTT    S+QTT FRHEAR+II  +   +D D VIF GSG TGAI+KL + +   +PPI++ GPFEHHSN+LPWR +A+ + R   +  G + +E LES+L  +  +      +LI   +AASNVTGIL DVN  S + H+Y G   WDYA+A PY++IDMNPVV G +   VYKDAVYFSMHKFIGGPQ+PGVL+ KR+LF + E  P   GGGTVFFV R+  ++LK++EEREEGGTP IV SIR+GLV QLK+++T E + ERE+  V   W +L   +N+++LGG +A R+PI S ++R        +  R   L+LHH+F+ SLLNDLFG+Q+R GCACAGPY MDLLGIDE LA  Y   LVG  + E      + D  + ++ +PGF R++LP+F   +E +FILDAI FVA HG+ FLP Y + P ++EW H  H  +   K L  ++Y  G M W+   ++T+   P  F   +  A+ ++ + V    +     + DD+  F+E T  LRWF+LPSEAA  +    +  ++S P+   + PG++
Sbjct:   93 AENNASDPLHLIGYINENIIGRNKIFRGPFGDRQTIYCDWTASAKSLFFIEDFISSEVLPNYGNTHTTTNVTSLQTTMFRHEARDIIRNAVRGSDEDAVIFVGSGCTGAIHKLIHNLHLEQPPIVIVGPFEHHSNILPWRHLAHKVCRASTDSSGTVSLESLESLLRVESVVAQELGCKLIVCMAAASNVTGILVDVNAFSSLTHRYGGLAFWDYATAAPYVKIDMNPVVTGPDHDYVYKDAVYFSMHKFIGGPQTPGVLVAKRSLFKAGEVQPSGCGGGTVFFVRRDGQVYLKEVEEREEGGTPAIVESIRAGLVMQLKEAVTCEAIMEREEQHVRRIWDRLADCRNIIVLGGKEAPRLPIISVVVRHSYPIPSTDNSRASCLFLHHNFVASLLNDLFGVQARGGCACAGPYAMDLLGIDEALAKLYEETLVGCRL-ETHKRDGMLDSSQHEVIRPGFTRVSLPFFTPDAEADFILDAIKFVATHGWAFLPLYSYNPSTAEWVHRQHDPSRDRKWLGNVNYTDGKMTWSSTRLRTEMPAPQDFEACMKAAYEELCRAVKTIDFSAASPVPDDTACFDEPTRELRWFLLPSEAAAQIRNEINQLAVSNPNPSPWHPGSL 710          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Match: A0A4S2M5T2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002453 PE=4 SV=1)

HSP 1 Score: 603.979 bits (1556), Expect = 0.000e+0
Identity = 287/587 (48.89%), Postives = 390/587 (66.44%), Query Frame = 2
Query:  866 LFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEI----------ERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKY-----LQDDSYLFEECTDGLRWFMLPSEAA 2581
            L  YI  NI+G++FIF+GPFG+R  VYCD+TASGR L FIE F++ EVLP Y NTHTT +  S+QTT FRHEAR+II  +  A+++D VIF GSG TGA++KL + +   +PPI++ GPFEHHSN+LPWR +A+ + R + ++ G + ++ LES+L  +         +LI   +AASNVTGI+ DV+  S + H+Y G   WDYA+A PY +IDMNPV  G +R  VYKDAVYFSMHKFIGGPQ+PGVL+ KR LF + E  P   GGGTVFFV R + ++LKD+EEREEGGTP IV SIR+GLV QLK+++T + + ERE  LV   W +L   +N+++LGG +A R+PI S ++R                  L+LHH+F+ +LLNDLFGIQ+R GCACAGPY MDLLGIDE LA  Y   LVG  ++  +      D P+ ++ +PGF RI++P+FI  +EV+FILDA+ FVA HG+ FLP Y++   + EW H  H+ +   K L  + Y  G M W+   + T+   P S+   +  A  +M + V    +     + DD+  F+E +  LRWF+LPSEAA
Sbjct:   87 LMNYINDNIVGKEFIFRGPFGDRKTVYCDWTASGRALAFIENFISMEVLPTYGNTHTTTSVTSLQTTMFRHEARDIIRNAVRASEDDAVIFVGSGCTGAVHKLIHNLHLEQPPIVIVGPFEHHSNILPWRHLAFKVCRAEADQSGTVSLKSLESLLQVESVSAQEMGCKLIVCMAAASNVTGIMVDVDAFSCLTHRYGGLAFWDYATAAPYTKIDMNPVRTGPDRDLVYKDAVYFSMHKFIGGPQTPGVLVAKRRLFKAGEAQPDGCGGGTVFFVRRNAQVYLKDVEEREEGGTPAIVESIRAGLVMQLKEAVTCDAIMEREDVLVRRIWDRLADCRNIIVLGGKEAPRLPIISVVVRHPYPSVGTAGGPKAETRCLFLHHNFVSALLNDLFGIQARGGCACAGPYAMDLLGIDEALAKLYEETLVGCPLDAYKRARHY-DTPQLEVIRPGFTRISVPFFIPDAEVDFILDALKFVANHGWIFLPLYRYISSTGEWSHRQHEISRDRKWLRNVDYSEGRMSWSSARITTEMPVPESYEACLRAAHEEMCRTVRLVDFSTSFPVPDDTISFDESSRELRWFLLPSEAA 672          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Match: A0A4S2M6C0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002453 PE=4 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 287/587 (48.89%), Postives = 390/587 (66.44%), Query Frame = 2
Query:  866 LFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEI----------ERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKY-----LQDDSYLFEECTDGLRWFMLPSEAA 2581
            L  YI  NI+G++FIF+GPFG+R  VYCD+TASGR L FIE F++ EVLP Y NTHTT +  S+QTT FRHEAR+II  +  A+++D VIF GSG TGA++KL + +   +PPI++ GPFEHHSN+LPWR +A+ + R + ++ G + ++ LES+L  +         +LI   +AASNVTGI+ DV+  S + H+Y G   WDYA+A PY +IDMNPV  G +R  VYKDAVYFSMHKFIGGPQ+PGVL+ KR LF + E  P   GGGTVFFV R + ++LKD+EEREEGGTP IV SIR+GLV QLK+++T + + ERE  LV   W +L   +N+++LGG +A R+PI S ++R                  L+LHH+F+ +LLNDLFGIQ+R GCACAGPY MDLLGIDE LA  Y   LVG  ++  +      D P+ ++ +PGF RI++P+FI  +EV+FILDA+ FVA HG+ FLP Y++   + EW H  H+ +   K L  + Y  G M W+   + T+   P S+   +  A  +M + V    +     + DD+  F+E +  LRWF+LPSEAA
Sbjct:   87 LMNYINDNIVGKEFIFRGPFGDRKTVYCDWTASGRALAFIENFISMEVLPTYGNTHTTTSVTSLQTTMFRHEARDIIRNAVRASEDDAVIFVGSGCTGAVHKLIHNLHLEQPPIVIVGPFEHHSNILPWRHLAFKVCRAEADQSGTVSLKSLESLLQVESVSAQEMGCKLIVCMAAASNVTGIMVDVDAFSCLTHRYGGLAFWDYATAAPYTKIDMNPVRTGPDRDLVYKDAVYFSMHKFIGGPQTPGVLVAKRRLFKAGEAQPDGCGGGTVFFVRRNAQVYLKDVEEREEGGTPAIVESIRAGLVMQLKEAVTCDAIMEREDVLVRRIWDRLADCRNIIVLGGKEAPRLPIISVVVRHPYPSVGTAGGPKAETRCLFLHHNFVSALLNDLFGIQARGGCACAGPYAMDLLGIDEALAKLYEETLVGCPLDAYKRARHY-DTPQLEVIRPGFTRISVPFFIPDAEVDFILDALKFVANHGWIFLPLYRYISSTGEWSHRQHEISRDRKWLRNVDYSEGRMSWSSARITTEMPVPESYEACLRAAHEEMCRTVRLVDFSTSFPVPDDTISFDESSRELRWFLLPSEAA 672          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Match: A0A4S2MAB2 (Aminotran_5 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002453 PE=4 SV=1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 287/587 (48.89%), Postives = 390/587 (66.44%), Query Frame = 2
Query:  866 LFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEI----------ERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKY-----LQDDSYLFEECTDGLRWFMLPSEAA 2581
            L  YI  NI+G++FIF+GPFG+R  VYCD+TASGR L FIE F++ EVLP Y NTHTT +  S+QTT FRHEAR+II  +  A+++D VIF GSG TGA++KL + +   +PPI++ GPFEHHSN+LPWR +A+ + R + ++ G + ++ LES+L  +         +LI   +AASNVTGI+ DV+  S + H+Y G   WDYA+A PY +IDMNPV  G +R  VYKDAVYFSMHKFIGGPQ+PGVL+ KR LF + E  P   GGGTVFFV R + ++LKD+EEREEGGTP IV SIR+GLV QLK+++T + + ERE  LV   W +L   +N+++LGG +A R+PI S ++R                  L+LHH+F+ +LLNDLFGIQ+R GCACAGPY MDLLGIDE LA  Y   LVG  ++  +      D P+ ++ +PGF RI++P+FI  +EV+FILDA+ FVA HG+ FLP Y++   + EW H  H+ +   K L  + Y  G M W+   + T+   P S+   +  A  +M + V    +     + DD+  F+E +  LRWF+LPSEAA
Sbjct:   87 LMNYINDNIVGKEFIFRGPFGDRKTVYCDWTASGRALAFIENFISMEVLPTYGNTHTTTSVTSLQTTMFRHEARDIIRNAVRASEDDAVIFVGSGCTGAVHKLIHNLHLEQPPIVIVGPFEHHSNILPWRHLAFKVCRAEADQSGTVSLKSLESLLQVESVSAQEMGCKLIVCMAAASNVTGIMVDVDAFSCLTHRYGGLAFWDYATAAPYTKIDMNPVRTGPDRDLVYKDAVYFSMHKFIGGPQTPGVLVAKRRLFKAGEAQPDGCGGGTVFFVRRNAQVYLKDVEEREEGGTPAIVESIRAGLVMQLKEAVTCDAIMEREDVLVRRIWDRLADCRNIIVLGGKEAPRLPIISVVVRHPYPSVGTAGGPKAETRCLFLHHNFVSALLNDLFGIQARGGCACAGPYAMDLLGIDEALAKLYEETLVGCPLDAYKRARHY-DTPQLEVIRPGFTRISVPFFIPDAEVDFILDALKFVANHGWIFLPLYRYISSTGEWSHRQHEISRDRKWLRNVDYSEGRMSWSSARITTEMPVPESYEACLRAAHEEMCRTVRLVDFSTSFPVPDDTISFDESSRELRWFLLPSEAA 672          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Cavefish
Match: ENSAMXT00000050955.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:19696740:19722139:-1 gene:ENSAMXG00000037587.1 transcript:ENSAMXT00000050955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 1.851e-8
Identity = 52/210 (24.76%), Postives = 94/210 (44.76%), Query Frame = 2
Query:   68 IQIYKNGD-FRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNL-NKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELP 691
            I +Y+NGD F    K +I ++    F   SFL  +T  ++     V+ I     G ++++++ F   + YVA    E     DY+         + +  +   V S+ +   R  +NI  +   I V+ NGD       + +  ++     ++L  + E+V L S   + RL+ L+G  +    E++N + YV    EK+ H  Y Q +P
Sbjct:   19 ILVYRNGDAFYPGKKFVINQRQTATF--ESFLGSVTRGIEAPFGAVRHIYTPREGHRIRSLEQFSHGERYVAA-GAERLKNIDYLHITPNRPQRMKNKQIRPVVHSKIIVPARWRKNI-DEPCTINVFANGDILVPPARILLPKYTLNSWESVLAMVTEKVHLRSGA-VHRLFTLDGTPLLGTAELKNNQYYVAVGMEKFRHKPYVQNIP 223          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Nematostella
Match: EDO49825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG26])

HSP 1 Score: 469.929 bits (1208), Expect = 3.450e-150
Identity = 257/565 (45.49%), Postives = 354/565 (62.65%), Query Frame = 2
Query:  974 LRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAG------TIAEAFNKMNQIVNNPK----YLQDDSYLFEECTDGLRWFMLPSEAAKILWDSPSISKPSKCIFTP 2638
            LRFIE+++ KEVLP Y NTHTT T  S+QTT +RHEAR+II  + NA + D VIFTGSG T A++KL + +  ++PPI+  GP+EHHSNLLPW++    I  I  +  G +D+ DL+  L        +  RQLIG F+AASNVTGIL D N ++  +H++    LWDYA+AGPY+EI+MNPV+   ++  VYKDA++ S HKFIGG  +PG+L+ K+ LF +        GGG+VFFV   SH +LK+ E REEGGTP IV SIR+GLVFQLK+++  +++  +E  +   A       +NLV+LG T   R+P+FSFL+R  +     L+LHH++ C+LLNDLFGIQ+R GCACAGPY  DLLGIDEKLA ++ +LL+  +  +  HL    ++ + +I +PGFVR+N PYF+++    F+  A+L VAE G+K LP Y F P++ EWRH  HK     K L  I+Y  G           +  YP+S AG       + E  +   +I  N +     L D S    E  + LRWF+LPSE+A I+  S     P +  F P
Sbjct:    1 LRFIEDYIRKEVLPHYGNTHTTTTVTSLQTTLYRHEARDIIRNAVNAGEGDAVIFTGSGCTAAVHKLIHALHLQQPPIVFVGPYEHHSNLLPWKEAGAEIVWISQDGQGVVDVNDLDQKLQTSI----SSGRQLIGCFAAASNVTGILVDTNSITACLHRHGALALWDYATAGPYIEINMNPVITSKDQSLVYKDAIFISTHKFIGGVGTPGILVAKKKLFRNPVPSGG--GGGSVFFVTENSHRYLKETEMREEGGTPAIVESIRAGLVFQLKEAVGHDVIFAKETEMCRKALDAWSDLENLVLLGSTTPSRLPVFSFLVRHPVSG---LFLHHNYTCALLNDLFGIQARGGCACAGPYAQDLLGIDEKLAKRFEALLLEDSRLDRGHLRRYNEYSEHEILRPGFVRLNFPYFMSEDSAAFVRKAVLMVAESGWKLLPQYMFNPETGEWRHRKHKVFHDRKWLGSINYSTG-----------ELTYPSSSAGYEGLPKDLQECLSNAEEIFRNAEKMSTSLSDQSLFLGEEAEKLRWFVLPSESAVII--SGQTHAPRRPPFVP 543          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Nematostella
Match: EDO35942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK32])

HSP 1 Score: 431.795 bits (1109), Expect = 1.856e-142
Identity = 232/479 (48.43%), Postives = 309/479 (64.51%), Query Frame = 2
Query:  866 LFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTM----SHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLP 2290
            L ++I  N+IG D +F GP+G++  VYCDYTASG+PLRFIE+++   V   Y+NTHTT T  S QTT FR+EAREII +  NA+  D VIF GSG T AI+KL + +       K   +  GPFEHHSN+LPW++    I RI+ N  G +D+  LE    ++F +    +  +   FSAASNVTGILTD   VS + HKY G   WDYASA PY+ I+MN    G      Y DAV  S HKF+GG  +PGVLI K+++F  +   P   GGGTV FV R++HL+LKDIE REEGGTP IV SIR+G+VFQLK S+   ++ +RE  L   A+   +K+  L ILG  KA+R+PIFSF++     ++    LHH+F+  LLNDL+GIQ+R GCACAGPY  DLLG+ E LA ++   +   +   +E    +P     +I KPGF RINLPYF++   V+++L+A+  VA HG+K LP
Sbjct:    4 LLEFINANVIGWDTVFNGPYGKKQVVYCDYTASGKPLRFIEDYIQNYVYAFYANTHTTTTTTSRQTTKFRNEAREIIKKCVNASAEDRVIFVGSGTTSAIHKLIHVLELEGEKAKKTAVFVGPFEHHSNILPWKETGAKIVRIRDNDHGTVDMAMLE----REFKVNRHKDYTIFTAFSAASNVTGILTDTKAVSEMCHKYGGLAFWDYASASPYITINMNATPTG------YMDAVVLSPHKFVGGVGTPGVLIAKKSVF--TNKVPDGCGGGTVLFVTRDTHLYLKDIEAREEGGTPAIVESIRAGMVFQLKQSVGPSLIEQREDELCRKAFEVWRKNSCLEILGSDKARRLPIFSFIV---YHKDSGKLLHHNFVSVLLNDLYGIQARGGCACAGPYAWDLLGVSESLAKQFSWFMEEHHGENVEAKLQVP----LEIMKPGFARINLPYFMDDETVHYVLEAVDMVATHGWKLLP 463          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Nematostella
Match: EDO49134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGY9])

HSP 1 Score: 429.098 bits (1102), Expect = 1.789e-141
Identity = 230/482 (47.72%), Postives = 308/482 (63.90%), Query Frame = 2
Query:  866 LFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGR---PLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTM----SHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLP 2290
            +  Y++ N+IG D +F+GP+G++  +YCDYTASGR   P R       +  L          T    QTT+FRHEAREII    NA D+DVVIFTGSG TGAI+KL + +       K  ++  GPFEHHSN+LPW++    I RI+  K G +D + LE+ L K +   S     ++  FSAASNVTGI+TD  +++ + H+Y     WDYA+A PYL+IDMN    G      YKDAV+ S HKF GGP +PGVLI K++LF  +   P   GGGTV FV R++HL+L+DIE REEGGTP IV SIR+GLVFQLK+SI S+++  RE+ L   A+   K + N+ ILG + A+R+PIFSFL+      +    LHH+F+  LLNDL+GIQ+R GCACAGPY  DLLGIDE +A K+   L     ++ E + C       +I KPGF R+NLP+F++   V+F+L+A+  VA HG+K LP
Sbjct:    4 MLDYLDENVIGGDTLFEGPYGQKKVIYCDYTASGRRHSPDR-------RRTLDMKQGEVYKYTTFFRQTTHFRHEAREIIKECVNATDDDVVIFTGSGTTGAIHKLIHALEMGGDKAKTTVVFVGPFEHHSNILPWKESGAKIVRIRDTKQGTVDQDMLETNL-KYY---SRRGMHMLAAFSAASNVTGIMTDTVLIAELCHRYGALSFWDYATAAPYLKIDMNASKLG------YKDAVFLSPHKFAGGPGTPGVLIAKKSLF--TNPIPGGCGGGTVLFVTRDTHLYLQDIESREEGGTPAIVESIRAGLVFQLKESIGSDLIEAREEELCRKAFKIWKANPNISILGSSSARRLPIFSFLV---YHPDSGKLLHHNFVSVLLNDLYGIQARGGCACAGPYAQDLLGIDESVAQKFTWFLESHESDDGE-VHCKEPL---EIMKPGFARLNLPFFMDDETVHFVLEAVDMVATHGWKLLP 459          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Nematostella
Match: EDO26022 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD33])

HSP 1 Score: 74.7146 bits (182), Expect = 8.679e-16
Identity = 33/62 (53.23%), Postives = 43/62 (69.35%), Query Frame = 2
Query: 1085 REIIHRSCNANDNDVVIFTGSGATGAINKLAYTM----SHRKPPIIVTGPFEHHSNLLPWRK 1258
            +EII    NA D+DVVIFTGSG TGAI+KL + +       K  ++  GPFEHHSN+LPW++
Sbjct:   78 KEIIKECVNATDDDVVIFTGSGTTGAIHKLIHALEMGGDKAKTTVVFVGPFEHHSNILPWKE 139          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Match: SMESG000040454.1 (SMESG000040454.1)

HSP 1 Score: 1417.52 bits (3668), Expect = 0.000e+0
Identity = 687/687 (100.00%), Postives = 687/687 (100.00%), Query Frame = 2
Query:   59 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGK 2119
            MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGK
Sbjct:    1 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGK 687          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Match: SMESG000040454.1 (SMESG000040454.1)

HSP 1 Score: 1228.39 bits (3177), Expect = 0.000e+0
Identity = 596/596 (100.00%), Postives = 596/596 (100.00%), Query Frame = 2
Query:   59 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVE 1846
            MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVE
Sbjct:    1 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYKMGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVE 596          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Match: SMESG000015154.1 (SMESG000015154.1)

HSP 1 Score: 752.666 bits (1942), Expect = 0.000e+0
Identity = 353/599 (58.93%), Postives = 452/599 (75.46%), Query Frame = 2
Query:  857 YIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHLFLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWSKLKKSK-NLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDLFGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPDFPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKPDSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTIAEAFNKMNQIVNNPKYLQDDSYLFEECTDGLRWFMLPSEAAKILWDSPSISKPSKCIFTPGTIA 2650
            YIDLF YIE NIIGRD  F+GPFG+RL +YCDYTASGR L+FIEEF+  EVLPEY+NTHTTNT  S+QTT FRHEAR+II  SC A + DV++F GSG TGAI+KL + ++  KPPI++ GPFEHHSNLLPWRK+A+SIHR++INK G LDIE LES+L  Q  + S ++  LI  F+A SNVTGI+++VN++S ++HKY G V WDYA+  PYL IDMNP++   +R  VYKDA+YFSMHKFIGG QSPG+LI KR+LF   E  P   GGGTVFFV RE+ ++LKD EEREEGGTP+IVG +R+GL FQLK++ T++ + +RE Y+V++AWSKL +S  NL+ILGG++  RIPIFSFLIR EI  NEYL+LHH+F+CSLLNDLFGIQSRSGCACAGPY MDL+GI+E+LA ++ + LVG  + E+  ++   + P R+I +PGFVRIN PY++   EV F+LDAI F+A +GYKFL  Y+F P +SEWRH +H+     K L  ISYK G+M W     +    YP+SFA  + EA    ++IV  P  + D+S  F++ T GLRWF+LPSE A ILW+S ++   SK  F PG+IA
Sbjct:   63 YIDLFSYIEKNIIGRDKGFRGPFGDRLILYCDYTASGRSLKFIEEFIYNEVLPEYANTHTTNTVTSLQTTMFRHEARDIIRNSCQATEKDVILFVGSGCTGAIHKLIHNLNLIKPPIVIVGPFEHHSNLLPWRKLAHSIHRVRINKEGNLDIEHLESILKVQSELASKEDTPLIATFAAVSNVTGIISNVNLISAMVHKYRGIVFWDYATGAPYLPIDMNPIISSDDRELVYKDAIYFSMHKFIGGVQSPGILIAKRSLFTPGEIYPEGAGGGTVFFVRRENQIYLKDTEEREEGGTPDIVGCVRAGLAFQLKEAATTDAIVKRENYIVKYAWSKLSESSPNLIILGGSQIHRIPIFSFLIRQEIRENEYLFLHHNFVCSLLNDLFGIQSRSGCACAGPYAMDLIGINEELAQQFENALVGNGL-EMNVISKYFENPNREIVRPGFVRINFPYYMPDVEVKFVLDAIKFIARNGYKFLTLYKFNPVTSEWRHGNHELFRDRKWLSHISYKRGYMTWRRPNPQMPGKYPSSFAEVLKEAKRISDEIVKTPINIHDESLGFDDSTKGLRWFLLPSEVATILWNSQTVVNQSKAPFAPGSIA 660          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Match: SMESG000038132.1 (SMESG000038132.1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 318/352 (90.34%), Postives = 321/352 (91.19%), Query Frame = 2
Query:  569 KRLYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK 1624
            + LYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKN+VDKLMDG MQNITQRMKMNGNKMKAENKIS                            +VYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYV WDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK
Sbjct:   84 QELYKLNGEEIKDITEIENGKSYVVTANEKYEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNVVDKLMDGHMQNITQRMKMNGNKMKAENKIS----------------------------SVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVFWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK 407          

HSP 2 Score: 171.4 bits (433), Expect = 6.595e-46
Identity = 85/101 (84.16%), Postives = 91/101 (90.10%), Query Frame = 2
Query:   59 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLT 361
            MNYIQIYKN DFRSTPKKIILKKDNGLFYWRSFLEEI SCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQ+     K++ + + D+T
Sbjct:    1 MNYIQIYKNRDFRSTPKKIILKKDNGLFYWRSFLEEIASCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQE---LYKLNGEEIKDIT 98          
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Match: SMESG000038132.1 (SMESG000038132.1)

HSP 1 Score: 551.977 bits (1421), Expect = 0.000e+0
Identity = 269/302 (89.07%), Postives = 272/302 (90.07%), Query Frame = 2
Query:  719 KNLQLKQSHDGQKNIVDKLMDGIMQNITQRMKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK 1624
            +NLQLKQSHDGQKN+VDKLMDG MQNITQRMKMNGNKMKAENKIS                            +VYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYV WDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK
Sbjct:   85 ENLQLKQSHDGQKNVVDKLMDGHMQNITQRMKMNGNKMKAENKIS----------------------------SVYCDYTASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSCNANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRKIAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVTGILTDVNMVSGIMHKYNGYVFWDYASAGPYLEIDMNPVVPGMNRYAVYKDAVYFSMHKFIGGPQSPGVLIVK 358          

HSP 2 Score: 172.555 bits (436), Expect = 8.011e-47
Identity = 87/118 (73.73%), Postives = 95/118 (80.51%), Query Frame = 2
Query:   59 MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDLTMLTSVGSRNLNKRIPQN 412
            MNYIQIYKN DFRSTPKKIILKKDNGLFYWRSFLEEI SCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQ+ +   +      N +  L     +N+ +R+  N
Sbjct:    1 MNYIQIYKNRDFRSTPKKIILKKDNGLFYWRSFLEEIASCLQVKDNLVKEIRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQENLQLKQSHDGQKNVVDKLMDGHMQNITQRMKMN 118          
The following BLAST results are available for this feature:
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DCDC28.806e-622.90doublecortin domain containing 2 [Source:HGNC Symb... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71H2B.51.106e-12438.49pep chromosome:WBcel235:III:2608017:2618856:1 gene... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-25g12.46.015e-723.15si:dkey-25g12.4 [Source:ZFIN;Acc:ZDB-GENE-160113-7... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DCDC22.961e-1127.03doublecortin domain containing 2 [Source:NCBI gene... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dcdc2a5.254e-822.47doublecortin domain containing 2a [Source:MGI Symb... [more]
Dcdc2a4.094e-623.25doublecortin domain containing 2a [Source:MGI Symb... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P99177|CSD_STAAN9.005e-2928.09Probable cysteine desulfurase OS=Staphylococcus au... [more]
sp|P63518|CSD_STAAM9.005e-2928.09Probable cysteine desulfurase OS=Staphylococcus au... [more]
sp|Q8NXH0|CSD_STAAW1.179e-2828.09Probable cysteine desulfurase OS=Staphylococcus au... [more]
sp|Q6GB11|CSD_STAAS1.179e-2828.09Probable cysteine desulfurase OS=Staphylococcus au... [more]
sp|Q6GIH2|CSD_STAAR1.179e-2828.09Probable cysteine desulfurase OS=Staphylococcus au... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YJA70.000e+048.14tRNA 2-thiocytidine biosynthesis protein TtcA OS=F... [more]
A0A4E0RJU70.000e+047.98tRNA 2-thiocytidine biosynthesis protein TtcA OS=F... [more]
A0A4S2M5T20.000e+048.89Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M6C00.000e+048.89Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2MAB20.000e+048.89Aminotran_5 domain-containing protein OS=Opisthorc... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000050955.11.851e-824.76pep primary_assembly:Astyanax_mexicanus-2.0:9:1969... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO498253.450e-15045.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359421.856e-14248.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491341.789e-14147.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260228.679e-1653.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of tRNA 2-thiocytidine biosynthesis protein TtcA vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040454.10.000e+0100.00SMESG000040454.1[more]
SMESG000040454.10.000e+0100.00SMESG000040454.1[more]
SMESG000015154.10.000e+058.93SMESG000015154.1[more]
SMESG000038132.16.595e-4690.34SMESG000038132.1[more]
SMESG000038132.18.011e-4789.07SMESG000038132.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033303 ID=SMED30033303|Name=tRNA 2-thiocytidine biosynthesis protein TtcA|organism=Schmidtea mediterranea sexual|type=transcript|length=2810bp
ATTTTTTTAAAGTTACAATACTGAAATCAGTCAAAAGAATACTTTGAAAA
TATAACTGATGAATTATATTCAGATTTATAAAAATGGAGATTTCAGATCA
ACACCAAAAAAGATAATATTAAAAAAAGATAATGGACTATTTTATTGGAG
AAGTTTTCTTGAAGAAATTACAAGTTGTTTGCAGGTCAAAGACAATTTAG
TGAAAGAAATTCGAGTGTTGCCGCGCGGAGAAAAAGTTAAAAACATCGAC
GATTTTATTGAATCAGATATTTATGTGGCGGTTTTTGAAGGAGAAATATT
TTCCAAACAAGATTATATAGGTTTTGGAAAGATTTCGATAGATTCCTTAA
ATGATTTGACCATGCTTACATCAGTTGGTTCAAGAAATCTAAACAAAAGG
ATTCCACAAAACATATGCATGAAAAATGTAGAGATAAAAGTTTATAAAAA
TGGTGATCCAAATACTCGAGCCATTCATGTCAAAGTTCAACCTTTCAGCA
GATACAAAATGGGTAATCTGTTAAAAAGTATTGAAGAGCAAGTATTTCTG
TCTTCTAAGAAACCAATTAAAAGATTATATAAACTGAATGGAGAGGAAAT
TAAAGATATTACGGAAATCGAAAATGGAAAATCCTACGTAGTGACTGCTA
ATGAAAAATATGAACACGTAAAATATGGACAAGAATTGCCAGAAATTAAA
GGAAACAGAGTAGCACTGAAAAATCTTCAATTGAAACAATCTCACGATGG
TCAGAAAAACATTGTGGACAAACTTATGGATGGAATCATGCAAAATATTA
CTCAGAGAATGAAAATGAATGGCAACAAAATGAAAGCAGAAAATAAAATA
TCTTGTTATATAGATTTGTTTAAATATATCGAAATGAATATCATCGGCAG
GGACTTTATTTTCAAGGGTCCCTTTGGTGAGAGGCTAGCGGTTTATTGTG
ACTACACAGCATCTGGAAGACCATTAAGGTTTATAGAGGAATTTCTAACC
AAAGAAGTGTTACCTGAATATTCTAACACCCATACAACAAATACTGCTTT
GTCAATGCAAACAACAAATTTCAGACATGAAGCCAGGGAAATCATCCACA
GGTCATGCAATGCCAACGACAATGACGTTGTGATATTTACCGGAAGTGGT
GCAACCGGTGCTATTAATAAGTTGGCCTATACGATGTCTCACCGAAAACC
TCCGATAATCGTGACCGGACCATTTGAGCATCACTCAAATCTTTTGCCGT
GGAGAAAAATTGCCTACTCAATTCATAGAATCAAAATAAATAAAATTGGA
GAACTTGACATTGAAGATCTTGAATCGGTTTTAATGAAGCAATTTCACAT
TTGTTCAACAGACAATCGTCAACTGATCGGGGTGTTTTCGGCTGCGTCAA
ACGTAACGGGTATTTTAACGGACGTGAATATGGTCTCAGGAATCATGCAC
AAATACAATGGATATGTGCTTTGGGATTATGCAAGTGCAGGCCCATATTT
GGAAATTGATATGAATCCTGTCGTTCCTGGTATGAATCGCTACGCAGTCT
ATAAGGATGCCGTTTATTTTTCAATGCATAAATTTATCGGTGGTCCCCAG
TCACCGGGTGTTTTAATTGTGAAGAGAAATTTGTTTTACTCCTCAGAAAC
CGATCCTCATTGTCCAGGAGGAGGGACAGTGTTTTTTGTTGGTCGTGAAA
GCCATTTATTTCTTAAAGACATCGAAGAAAGAGAAGAAGGAGGAACCCCA
GAAATTGTAGGTTCAATTCGATCTGGATTAGTCTTTCAATTGAAAGACTC
TATTACATCAGAAATATTACATGAAAGAGAGAAATATTTAGTAGAATTTG
CTTGGTCAAAACTGAAAAAATCAAAAAATCTGGTGATTTTGGGTGGCACG
AAAGCTAAACGAATTCCAATATTTTCATTTTTAATCCGTTGTGAAATTGA
GAGAAATGAATATCTGTATTTGCATCATCATTTTATTTGTTCGCTTCTAA
ATGATTTGTTTGGTATTCAATCTCGCAGCGGATGTGCTTGCGCGGGTCCC
TACGGAATGGATTTGTTAGGAATAGATGAAAAATTAGCTGTGAAATATTT
GAGCCTGTTGGTTGGAAAAAACATGAATGAAATCGAACATTTAACTTGCA
TTCCAGATTTTCCTAAACGGGATATTTTCAAGCCAGGATTTGTGAGAATA
AATCTGCCATATTTTATTAACCAGAGTGAAGTAAATTTTATATTGGACGC
CATATTGTTTGTAGCCGAGCATGGCTACAAGTTTCTGCCATACTATCAGT
TCAAACCAGATTCCAGTGAATGGAGGCACATTGACCACAAAACCACTACT
AAAGTAAAAAAATTGGAAGAGATTTCCTACAAACACGGATTCATGGATTG
GAATTATGATACAATGAAAACTAAAACCAATTATCCCGCCAGTTTTGCCG
GCACAATAGCGGAGGCCTTTAACAAAATGAACCAAATTGTGAATAATCCA
AAATATCTTCAAGATGATAGTTATTTATTTGAGGAGTGCACAGACGGATT
GAGATGGTTTATGCTACCCTCAGAAGCCGCTAAAATCTTATGGGACAGCC
CTTCAATATCTAAACCATCCAAATGTATATTCACTCCAGGAACTATTGCT
TTGTCTCATCCTGAAACTAATGAAAATATACAAAACAGATTTATTCCAAT
AATGAATAGAGAGAGGTTAAATGCAAGAAAACTACAAAAAAATATCGTGA
ACGAACCTTCAAATTTTTATACAGGGAGATACTATAATCAAATTGTAACT
CGTTTCTGAT
back to top

protein sequence of SMED30033303-orf-1

>SMED30033303-orf-1 ID=SMED30033303-orf-1|Name=SMED30033303-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=917bp
MNYIQIYKNGDFRSTPKKIILKKDNGLFYWRSFLEEITSCLQVKDNLVKE
IRVLPRGEKVKNIDDFIESDIYVAVFEGEIFSKQDYIGFGKISIDSLNDL
TMLTSVGSRNLNKRIPQNICMKNVEIKVYKNGDPNTRAIHVKVQPFSRYK
MGNLLKSIEEQVFLSSKKPIKRLYKLNGEEIKDITEIENGKSYVVTANEK
YEHVKYGQELPEIKGNRVALKNLQLKQSHDGQKNIVDKLMDGIMQNITQR
MKMNGNKMKAENKISCYIDLFKYIEMNIIGRDFIFKGPFGERLAVYCDYT
ASGRPLRFIEEFLTKEVLPEYSNTHTTNTALSMQTTNFRHEAREIIHRSC
NANDNDVVIFTGSGATGAINKLAYTMSHRKPPIIVTGPFEHHSNLLPWRK
IAYSIHRIKINKIGELDIEDLESVLMKQFHICSTDNRQLIGVFSAASNVT
GILTDVNMVSGIMHKYNGYVLWDYASAGPYLEIDMNPVVPGMNRYAVYKD
AVYFSMHKFIGGPQSPGVLIVKRNLFYSSETDPHCPGGGTVFFVGRESHL
FLKDIEEREEGGTPEIVGSIRSGLVFQLKDSITSEILHEREKYLVEFAWS
KLKKSKNLVILGGTKAKRIPIFSFLIRCEIERNEYLYLHHHFICSLLNDL
FGIQSRSGCACAGPYGMDLLGIDEKLAVKYLSLLVGKNMNEIEHLTCIPD
FPKRDIFKPGFVRINLPYFINQSEVNFILDAILFVAEHGYKFLPYYQFKP
DSSEWRHIDHKTTTKVKKLEEISYKHGFMDWNYDTMKTKTNYPASFAGTI
AEAFNKMNQIVNNPKYLQDDSYLFEECTDGLRWFMLPSEAAKILWDSPSI
SKPSKCIFTPGTIALSHPETNENIQNRFIPIMNRERLNARKLQKNIVNEP
SNFYTGRYYNQIVTRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036572Doublecortin_dom_sf
IPR003533Doublecortin_dom
IPR000192Aminotrans_V_dom
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015421PyrdxlP-dep_Trfase_major
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003533Doublecortin domainSMARTSM00537doub1_11coord: 126..207
e-value: 8.0E-4
score: 23.3
IPR003533Doublecortin domainPFAMPF03607DCXcoord: 151..200
e-value: 7.7E-7
score: 29.1
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 124..207
score: 16.712
IPR003533Doublecortin domainPROSITEPS50309DCcoord: 2..87
score: 10.046
IPR036572Doublecortin domain superfamilyGENE3DG3DSA:3.10.20.230coord: 2..89
e-value: 3.9E-9
score: 38.0
coord: 124..210
e-value: 5.0E-16
score: 60.1
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 124..210
IPR036572Doublecortin domain superfamilySUPERFAMILYSSF89837Doublecortin (DC)coord: 3..87
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 310..576
e-value: 1.0E-60
score: 206.9
IPR000192Aminotransferase class V domainPFAMPF00266Aminotran_5coord: 312..693
e-value: 7.1E-39
score: 133.8
NoneNo IPR availablePANTHERPTHR43586:SF8CYSTEINE DESULFURASEcoord: 259..825
NoneNo IPR availablePANTHERPTHR43586FAMILY NOT NAMEDcoord: 259..825
NoneNo IPR availableCDDcd17071DCX1_DCDC2_likecoord: 4..83
e-value: 8.6286E-5
score: 39.8974
NoneNo IPR availableCDDcd16113DCX2_DCDC2_likecoord: 126..195
e-value: 7.70062E-13
score: 62.5938
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 294..733