RNA-binding protein MEX3B

Overview
NameRNA-binding protein MEX3B
Smed IDSMED30033302
Length (bp)4165
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA-binding protein MEX3B (SMED30033302) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA-binding protein MEX3B (SMED30033302) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA-binding protein MEX3B (SMED30033302) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA-binding protein MEX3B (SMED30033302) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033302

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 20

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30033302SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30033302SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033302SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033302SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033302SMESG000025422.1 Contig31355newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033302SMESG000025422.1 Contig31355uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30033302SMESG000025422.1 SMESG000044270.1 SMESG000030021.1 dd_Smed_v6_1999_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033302SMESG000025422.1 SMESG000044270.1 SMESG000030021.1 dd_Smed_v6_1999_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Match: MEX3D (mex-3 RNA binding family member D [Source:HGNC Symbol;Acc:HGNC:16734])

HSP 1 Score: 77.7962 bits (190), Expect = 1.063e-13
Identity = 57/175 (32.57%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  712 ISNFFKHKHGSSGSHLTQKQYLVLGVR-----------VPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
             + F  H        L   Q  V+G R           VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       TR+K G + G      + PP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  147 FAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAA----QGPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDK 314          
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Match: MEX3D (mex-3 RNA binding family member D [Source:HGNC Symbol;Acc:HGNC:16734])

HSP 1 Score: 76.6406 bits (187), Expect = 1.273e-13
Identity = 51/139 (36.69%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       TR+K G + G      + PP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:    7 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAA----QGPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDK 138          
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Match: MEX3C (mex-3 RNA binding family member C [Source:HGNC Symbol;Acc:HGNC:28040])

HSP 1 Score: 76.2554 bits (186), Expect = 1.996e-13
Identity = 48/139 (34.53%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       +RNK G   G +   P  P          T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   66 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQ-------TTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 197          
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Match: MEX3B (mex-3 RNA binding family member B [Source:HGNC Symbol;Acc:HGNC:25297])

HSP 1 Score: 75.485 bits (184), Expect = 4.335e-13
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  N A L G  P  PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   70 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNK--NTA-LNGAVP-GPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 201          
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Match: MEX3C (mex-3 RNA binding family member C [Source:HGNC Symbol;Acc:HGNC:28040])

HSP 1 Score: 75.485 bits (184), Expect = 5.162e-13
Identity = 48/139 (34.53%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       +RNK G   G +   P  P          T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:  236 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQ-------TTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 367          
BLAST of RNA-binding protein MEX3B vs. Ensembl Celegans
Match: mex-3 (Muscle EXcess [Source:UniProtKB/TrEMBL;Acc:V6CKQ3])

HSP 1 Score: 71.2478 bits (173), Expect = 1.770e-12
Identity = 44/134 (32.84%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTP-LATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKD 1185
            V VP+ EHV+EIVG++G KIK +R  T   I TP   ED +F++    E   +  + I   A+  T+        +   R  +  + G   P   T+ + VP R+VG V+G +G+ I  +Q++T T I +P ++
Sbjct:   51 VEVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEDPIFVVTGRLEDVNEAKREIDCAAEHFTQ--------IRASRRHTQVVPGAHAPGQITSYVRVPLRVVGLVVGPKGATIKRIQQDTHTYIITPSRE 176          
BLAST of RNA-binding protein MEX3B vs. Ensembl Celegans
Match: mex-3 (Muscle EXcess [Source:UniProtKB/TrEMBL;Acc:V6CKQ3])

HSP 1 Score: 68.9366 bits (167), Expect = 1.319e-11
Identity = 42/133 (31.58%), Postives = 67/133 (50.38%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKD 1185
            V VP+ EHV+EIVG++G KIK +R  T   I TP   ED +F++    E   +  + I   A+  T+ +           P             T+ + VP R+VG V+G +G+ I  +Q++T T I +P ++
Sbjct:   82 VEVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEDPIFVVTGRLEDVNEAKREIDCAAEHFTQIRASRRHTQGAHAPGQ----------ITSYVRVPLRVVGLVVGPKGATIKRIQQDTHTYIITPSRE 204          
BLAST of RNA-binding protein MEX3B vs. Ensembl Fly
Match: CG11360 (gene:FBgn0039920 transcript:FBtr0310539)

HSP 1 Score: 73.559 bits (179), Expect = 9.644e-13
Identity = 61/202 (30.20%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  763 QKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQ--ITRNKLGNIA-----GLMGE----------RPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR 1317
            + Q +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E   K  + I   AD   + R     ++     G++G           R   PP +  +    T  + VP R+VG V+G +G+ I  +Q+ET T I +P +++         FE++    G  ++ +TA       KQ+ AH+ +R
Sbjct:  119 KSQNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKAKREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQ---VTIQVRVPYRVVGLVVGPKGATIKHIQQETQTYIVTPSREK------EPIFEVT----GLPDNVDTAR------KQIEAHIALR 301          
BLAST of RNA-binding protein MEX3B vs. Ensembl Fly
Match: CG11360 (gene:FBgn0039920 transcript:FBtr0310540)

HSP 1 Score: 73.559 bits (179), Expect = 9.644e-13
Identity = 61/202 (30.20%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  763 QKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQ--ITRNKLGNIA-----GLMGE----------RPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR 1317
            + Q +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E   K  + I   AD   + R     ++     G++G           R   PP +  +    T  + VP R+VG V+G +G+ I  +Q+ET T I +P +++         FE++    G  ++ +TA       KQ+ AH+ +R
Sbjct:  119 KSQNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKAKREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQ---VTIQVRVPYRVVGLVVGPKGATIKHIQQETQTYIVTPSREK------EPIFEVT----GLPDNVDTAR------KQIEAHIALR 301          
BLAST of RNA-binding protein MEX3B vs. Ensembl Fly
Match: CG11360 (gene:FBgn0039920 transcript:FBtr0310541)

HSP 1 Score: 73.559 bits (179), Expect = 9.644e-13
Identity = 61/202 (30.20%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  763 QKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQ--ITRNKLGNIA-----GLMGE----------RPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR 1317
            + Q +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E   K  + I   AD   + R     ++     G++G           R   PP +  +    T  + VP R+VG V+G +G+ I  +Q+ET T I +P +++         FE++    G  ++ +TA       KQ+ AH+ +R
Sbjct:  119 KSQNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKAKREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQ---VTIQVRVPYRVVGLVVGPKGATIKHIQQETQTYIVTPSREK------EPIFEVT----GLPDNVDTAR------KQIEAHIALR 301          
BLAST of RNA-binding protein MEX3B vs. Ensembl Fly
Match: CG11360 (gene:FBgn0039920 transcript:FBtr0089091)

HSP 1 Score: 73.559 bits (179), Expect = 9.644e-13
Identity = 61/202 (30.20%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  763 QKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQ--ITRNKLGNIA-----GLMGE----------RPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR 1317
            + Q +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E   K  + I   AD   + R     ++     G++G           R   PP +  +    T  + VP R+VG V+G +G+ I  +Q+ET T I +P +++         FE++    G  ++ +TA       KQ+ AH+ +R
Sbjct:  119 KSQNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVNKAKREILSAADHFSLIRASRKPVSDSQNNGMVGSTTSSGGGAVPRMSGPPCMPGQ---VTIQVRVPYRVVGLVVGPKGATIKHIQQETQTYIVTPSREK------EPIFEVT----GLPDNVDTAR------KQIEAHIALR 301          
BLAST of RNA-binding protein MEX3B vs. Ensembl Zebrafish
Match: mex3b (mex-3 RNA binding family member B [Source:ZFIN;Acc:ZDB-GENE-030131-2628])

HSP 1 Score: 75.0998 bits (183), Expect = 3.517e-13
Identity = 61/184 (33.15%), Postives = 92/184 (50.00%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEIS-VYENGTVNSEETAWLQIHRAKQLI-AHLVMR 1317
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  ++ G        PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+         FE++ + EN            + RA++ I AH+ MR
Sbjct:   62 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRREDVAMARREIISAAEHFSMIRASRNKNSSLNG--NATVPGPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPV------FEVTGMPEN------------VDRAREEIEAHIAMR 222          
BLAST of RNA-binding protein MEX3B vs. Ensembl Zebrafish
Match: FO082781.1 (mex-3 RNA binding family member A [Source:NCBI gene;Acc:100332760])

HSP 1 Score: 74.3294 bits (181), Expect = 4.993e-13
Identity = 69/205 (33.66%), Postives = 93/205 (45.37%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPL---ATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR---VWDQQPRNSTPSSDEGN 1368
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VFLI    E      + I   A+       +RNK             SPP      PL    T  + VP R+VG V+G +GS I  +Q++T T I +P +D  R P     FEI+    G+  + E A  +I       AH+  R   + D    N     + GN
Sbjct:  122 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFLITGRKEDVALARREIISAAEHFSMLRASRNKFSG----------SPP-----APLPGQTTIQVRVPYRVVGLVVGPKGSTIKRIQQQTCTYIVTPSRD--RDP----VFEIT----GSPGNAERAREEIE------AHIAFRTGGLHDHNNENDCLGPESGN 295          
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Match: mex3d (mex-3 RNA binding family member D [Source:NCBI gene;Acc:100144717])

HSP 1 Score: 83.1889 bits (204), Expect = 1.599e-15
Identity = 53/140 (37.86%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  784 GVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            GV VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       TRNK   I G      +SPP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  239 GVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPIRGEEPIFIVTGRKEDVEMAKREILAAAEHFSIIRATRNKASGIPGAT----QSPPSLPGQT---TIQVRVPYRVVGLVVGPKGATIKKIQQSTHTYIVTPSRDK 371          
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Match: mex3d (mex-3 RNA binding family member D [Source:NCBI gene;Acc:100144717])

HSP 1 Score: 83.1889 bits (204), Expect = 1.850e-15
Identity = 53/140 (37.86%), Postives = 75/140 (53.57%), Query Frame = 1
Query:  784 GVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            GV VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       TRNK   I G      +SPP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  239 GVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPIRGEEPIFIVTGRKEDVEMAKREILAAAEHFSIIRATRNKASGIPGAT----QSPPSLPGQT---TIQVRVPYRVVGLVVGPKGATIKKIQQSTHTYIVTPSRDK 371          
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Match: MEX3B (mex-3 RNA binding family member B [Source:NCBI gene;Acc:100490923])

HSP 1 Score: 82.0333 bits (201), Expect = 3.277e-15
Identity = 53/139 (38.13%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  N A L G    +PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   63 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNK--NAAALNGGSVPAPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 196          
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Match: atp6ap2 (ATPase, H+ transporting, lysosomal accessory protein 2 [Source:Xenbase;Acc:XB-GENE-964301])

HSP 1 Score: 74.3294 bits (181), Expect = 6.557e-13
Identity = 50/143 (34.97%), Postives = 75/143 (52.45%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNK----LGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK    +GN+        +  P L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   80 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNAPAVGNV--------QCAPNLPGQT---TVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 211          
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Match: MEX3A (mex-3 RNA binding family member A [Source:HGNC Symbol;Acc:HGNC:33482])

HSP 1 Score: 51.9878 bits (123), Expect = 5.321e-6
Identity = 39/122 (31.97%), Postives = 57/122 (46.72%), Query Frame = 1
Query:  835 GKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKD 1185
            G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK G   G       S P L  +    T  + VP R+VG V+G +G+ I  +Q++T T I +P +D
Sbjct:   63 GCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVAMARREIISAAEHFSMIRASRNKAGTAFG-------SAPTLPGQ---VTIRVRVPYRVVGLVVGPKGATIKRIQQQTNTYIITPSRD 174          
BLAST of RNA-binding protein MEX3B vs. Ensembl Mouse
Match: Mex3d (mex3 RNA binding family member D [Source:MGI Symbol;Acc:MGI:2681847])

HSP 1 Score: 80.4925 bits (197), Expect = 1.166e-14
Identity = 63/190 (33.16%), Postives = 92/190 (48.42%), Query Frame = 1
Query:  667 VLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVR-----------VPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            +L+   + + S     ++F  H      S L  +Q  V+G R           VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       TR+K G   GL G  P  PP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  187 LLDPDVSPRPSPPDVFASFAPHPAALGPSTLLAEQLNVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSLIRATRSKAG---GLSGATP-GPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDK 369          
BLAST of RNA-binding protein MEX3B vs. Ensembl Mouse
Match: Mex3b (mex3 RNA binding family member B [Source:MGI Symbol;Acc:MGI:1918252])

HSP 1 Score: 75.485 bits (184), Expect = 3.322e-13
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  N A L G  P  PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   77 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNK--NTA-LNGAVP-GPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 208          
BLAST of RNA-binding protein MEX3B vs. Ensembl Mouse
Match: Mex3c (mex3 RNA binding family member C [Source:MGI Symbol;Acc:MGI:2652843])

HSP 1 Score: 75.0998 bits (183), Expect = 4.094e-13
Identity = 48/139 (34.53%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       +RNK G   G +   P  P          T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:  229 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQ-------TTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 360          
BLAST of RNA-binding protein MEX3B vs. Ensembl Mouse
Match: Mex3a (mex3 RNA binding family member A [Source:MGI Symbol;Acc:MGI:1919890])

HSP 1 Score: 72.7886 bits (177), Expect = 1.582e-12
Identity = 52/170 (30.59%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  691 KNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKD 1185
            K +N +++   +K         L         V VP+ EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK G   G+      +P + G      T  + VP R+VG V+G +G+ I  +Q++T T I +P +D
Sbjct:  108 KGANDAKLCALYKEAE----LRLKGSSNTTECVPVPTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDVATARREIISAAEHFSMIRASRNKSGAAFGV------APALPGQ----VTIRVRVPYRVVGLVVGPKGATIKRIQQQTNTYIITPSRD 263          
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Match: sp|A1L3F4|MEX3B_XENLA (RNA-binding protein MEX3B OS=Xenopus laevis OX=8355 GN=mex3b PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.355e-15
Identity = 53/139 (38.13%), Postives = 77/139 (55.40%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V+VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  N A L G    +PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   63 VQVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVALARREIISAAEHFSMIRASRNK--NAAALNGGSVPAPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 196          
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Match: sp|Q3UE17|MEX3D_MOUSE (RNA-binding protein MEX3D OS=Mus musculus OX=10090 GN=Mex3d PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 4.546e-13
Identity = 59/186 (31.72%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  667 VLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVR-----------VPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPE-TAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            +L+   + + S     ++F  H      S L  +Q  V+G R           VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E   +   +I+      + R       GL G  P  PP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  113 LLDPDVSPRPSPPDVFASFAPHPAALGPSTLLAEQLNVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAEHFSLIRATRSKAGGLSGATP-GPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDK 294          
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Match: sp|Q86XN8|MEX3D_HUMAN (RNA-binding protein MEX3D OS=Homo sapiens OX=9606 GN=MEX3D PE=1 SV=3)

HSP 1 Score: 77.7962 bits (190), Expect = 5.103e-13
Identity = 57/175 (32.57%), Postives = 82/175 (46.86%), Query Frame = 1
Query:  712 ISNFFKHKHGSSGSHLTQKQYLVLGVR-----------VPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
             + F  H        L   Q  V+G R           VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       TR+K G + G      + PP L  +T   T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:  147 FAGFAPHPAALGPPTLLADQMSVIGSRKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREILSAAEHFSIIRATRSKAGGLPGAA----QGPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDK 314          
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Match: sp|Q6ZN04|MEX3B_HUMAN (RNA-binding protein MEX3B OS=Homo sapiens OX=9606 GN=MEX3B PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.082e-12
Identity = 54/139 (38.85%), Postives = 76/139 (54.68%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+       +RNK  N A L G  P  PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   70 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNK--NTA-LNGAVP-GPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 201          
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Match: sp|Q5U5Q3|MEX3C_HUMAN (RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens OX=9606 GN=MEX3C PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 2.479e-12
Identity = 48/139 (34.53%), Postives = 71/139 (51.08%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ +F++    E      + I   A+       +RNK G   G +   P  P          T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:  236 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNGPALGGLSCSPNLPGQ-------TTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 367          
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Match: A0A0R3UGA8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6241 PE=4 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 5.647e-62
Identity = 147/376 (39.10%), Postives = 204/376 (54.26%), Query Frame = 1
Query:  613 YQSMASKMGFLVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLG----------NIAGLM----------------------------GERPRSPPML---------------------GN-------RTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEG---------NCTPNTC------------SPEWIWPEVSRMDDGDAKEIIDRILRSSKAK 1479
            Y SMA K G++VG +L+ +   S    +    RIS  F++++G + +  T+  Y+ LGVRVPSK+HVSEIVGK G+KIK IR+ TGALI TP E EDHVF+IEA PE A+ V ++I   A +IT++K+           +I G M                            G  P   P+L                     GN       R  LA + I VPQ +VGK+IGTQGSIITT+QK+TGTEIKSPPK+  R P  T++FEIS Y++  + S + A  ++ +AKQLI HLVMR ++   R ++   DEG         N T + C            +  W+WP+V++MD  +A+E++DRIL  SK+K
Sbjct:  218 YNSMAQKRGYIVGAELERIKENSRRSTSHTYGRISAHFRNRYGETEAK-TKASYMQLGVRVPSKDHVSEIVGKGGQKIKLIREETGALITTPGEYEDHVFIIEAPPEIALHVAELISTRAQEITQSKMSASERRRGSTSSIPGCMALFSMNSINGSAPSNGRLMNRSPDDLPTGSLPSPAPLLKTNVNSGSDAATFAFSNGLSSGNNVGGSSGRILLARSKISVPQDMVGKIIGTQGSIITTIQKDTGTEIKSPPKEAARGPSATSEFEISAYQSLGMTSNQAAECRVQQAKQLIGHLVMRQFE---RRASEELDEGGGCSGKPRANSTGDDCDENGSASSRNSKTVGWMWPDVAQMDSTEAREVLDRILAESKSK 589          
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Match: A0A0R3T6J8 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS2685 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.189e-37
Identity = 124/393 (31.55%), Postives = 193/393 (49.11%), Query Frame = 1
Query:  595 PVELIEYQSMASKMGFLVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITR-------------NKLGNIAGLMGER---------------PRSPPMLGNRT-----PLATATI------------------GVPQRLVGKVIGTQGSIIT---------TVQKETGTE---IKSPPKD---ELRAP--------GDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQ-----PRNSTPSSDEGNCTPNTCSPE-------------------WIWPEVSRMDDGDAKEIIDRILRSSKAK 1479
            P++ ++Y + A   GF+VGQ+L+ +   S    +    RIS  F++++G + +  T+  YL LGVRVP+K+HVSEIVGK G+KIK IR+ TGALI TP E EDHVF+IEA PE A+KV  +I   A +I++             N +   A L G                  RSP  L N T     PL  +++                  G+P  +     GT  ++++          V K  GT+   I +  KD   E+++P          T++FEIS Y++  + +++ A  ++ +AKQLI HLVMR ++++       N+T +   G    N+   E                   W+WP+V +MD  +A++++DRIL  SK+K
Sbjct:  174 PIDRLQYINYARSKGFIVGQELEHIKENSRRSTSHTYGRISAHFRNRYGETEAK-TKASYLQLGVRVPTKDHVSEIVGKGGQKIKLIREETGALITTPGENEDHVFIIEAPPEIALKVADLITNRAQEISQSKSNASERRRGSTNSIPGCASLFGGSGVVSATAANGGQRLVSRSPDDLPNVTIPSPSPLLKSSLTNGGNYSNENGFFSSNGNGLPNGVSNSNGGTTRTLLSRSKISVPQDMVGKIIGTQGSIITTIQKDTGTEIKSPPKEAARGPSATSEFEISAYQSQGMTAQD-AEARVQQAKQLIGHLVMRQFERRYSEELEDNNTGNGSSGKSRNNSNGEESDRNSNGKTATTNVSNGVAWMWPDVQQMDAKEAQDVLDRILAESKSK 564          
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Match: A0A183L5V8 (KH domain-containing protein OS=Schistosoma curassoni OX=6186 PE=4 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.393e-32
Identity = 100/265 (37.74%), Postives = 133/265 (50.19%), Query Frame = 1
Query: 1048 GNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSPE----------------------------WIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPPTSTG------MSPQFSMSSLHDSNKQQSSSG---------FHSLNSTPFKMMPEDSWNRNSISDCYSSSTDA 1713
            G+R  LA   I VPQ +VGK+IGTQGSIITT+QK+TGTEIKSPPK+ +R P  T++FEIS Y+   ++S + A  ++ +AKQLI HLVMR   Q  R ++   +E + + N  S E                            W+WP+V++MD  +A+E++DRIL  SK K       T       +V   P ST       M+ Q S+ +L   N  QS SG          H LN T F     DS   N   D  S  T A
Sbjct:  195 GSRVLLARGRISVPQEMVGKIIGTQGSIITTIQKDTGTEIKSPPKEAVRGPNATSEFEISAYQGLGLSSNQAAECRVQQAKQLIGHLVMR---QLERRASEEVEEASGSSNISSEEQRVNGPSASTVSGVCNSTSKTNGGGNNGWMWPDVAQMDSQEAREVLDRILVESKNK-------TRRAKELAVVSTGPASTSVCSIATMNTQGSLLNLKGCNGSQSLSGDNQHSNHFQSHLLNGTYF-----DSAQTNGCEDVISGDTSA 444          

HSP 2 Score: 67.781 bits (164), Expect = 1.197e-7
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  835 GKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPR 1032
            G+KIK IR+ TGALI TP E+E+HVF+IEA PE A++V   +   A +IT++K+     + GER R
Sbjct:    8 GQKIKLIREETGALITTPGEQEEHVFIIEAPPEIAMRVAHHLATRAQEITQSKI-----VAGERRR 68          
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Match: A0A3P8H840 (KH domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS22725 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 1.486e-32
Identity = 100/265 (37.74%), Postives = 133/265 (50.19%), Query Frame = 1
Query: 1048 GNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSPE----------------------------WIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPPTSTG------MSPQFSMSSLHDSNKQQSSSG---------FHSLNSTPFKMMPEDSWNRNSISDCYSSSTDA 1713
            G+R  LA   I VPQ +VGK+IGTQGSIITT+QK+TGTEIKSPPK+ +R P  T++FEIS Y+   ++S + A  ++ +AKQLI HLVMR   Q  R ++   +E + + N  S E                            W+WP+V++MD  +A+E++DRIL  SK K       T       +V   P ST       M+ Q S+ +L   N  QS SG          H LN T F     DS   N   D  S  T A
Sbjct:  195 GSRVLLARGRISVPQEMVGKIIGTQGSIITTIQKDTGTEIKSPPKEAVRGPNATSEFEISAYQGLGLSSNQAAECRVQQAKQLIGHLVMR---QLERRASEEVEEASGSSNISSEEQRVNGPSASTVSGVCNSTSKTNGGGNNGWMWPDVAQMDSQEAREVLDRILVESKNK-------TRRAKELAVVSTGPASTSVCSIATMNTQGSLLNLKGCNGSQSLSGDNQHSNHFQSHLLNGTYF-----DSAQTNGCEDVISGDTSA 444          

HSP 2 Score: 67.781 bits (164), Expect = 1.176e-7
Identity = 33/66 (50.00%), Postives = 46/66 (69.70%), Query Frame = 1
Query:  835 GKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPR 1032
            G+KIK IR+ TGALI TP E+E+HVF+IEA PE A++V   +   A +IT++K+     + GER R
Sbjct:    8 GQKIKLIREETGALITTPGEQEEHVFIIEAPPEIAMRVAHHLATRAQEITQSKI-----VAGERRR 68          
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Match: A0A1S8WYK3 (KH domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_04642 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 4.658e-32
Identity = 80/163 (49.08%), Postives = 106/163 (65.03%), Query Frame = 1
Query: 1033 SPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVW--------DQQPRNSTPSSDE------GNCTPNTCSPEWIWPEVSRMDDGDAKEIIDRILRSSKAK 1479
            SP   G+R  LA   I VPQ LVGK+IGTQGSIITT+QK+TGTEIKSPPK+  R P  T++FEIS Y+   ++S + A  ++ +AKQLI HLVMR          D+   +S  SSD+      G  TP T +  W+WP+V++MD  +A+E++DRIL  SK K
Sbjct:  197 SPNTPGSRILLARGRISVPQELVGKIIGTQGSIITTIQKDTGTEIKSPPKEAARGPNATSEFEISAYQGVGLSSNQAAECRVQQAKQLIGHLVMRQLERRASEEIDEASGSSNLSSDDQRMGLGGGNTPRTTT-AWMWPDVAQMDSQEAREVLDRILAESKNK 358          

HSP 2 Score: 65.4698 bits (158), Expect = 1.133e-6
Identity = 33/65 (50.77%), Postives = 43/65 (66.15%), Query Frame = 1
Query:  838 KKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPR 1032
            +KIK IR+ TGALI TP E E+HVF+IEA PE A++V   +   A +IT++KL       GER R
Sbjct:    1 QKIKLIREETGALITTPGEHEEHVFIIEAPPEIAMRVAHHLSTRAQEITQSKLA-----AGERRR 60          
BLAST of RNA-binding protein MEX3B vs. Ensembl Cavefish
Match: ENSAMXT00000025356.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000037.1:51923:60658:1 gene:ENSAMXG00000024633.2 transcript:ENSAMXT00000025356.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 6.285e-15
Identity = 72/201 (35.82%), Postives = 97/201 (48.26%), Query Frame = 1
Query:  739 GSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPL---ATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMR 1317
            GS+G    +   +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VFLI    E      + I   A+       +RNKLG      G    SPP     TPL    T  + VP R+VG V+G +GS I  +Q++T T I +P +D  R P     FEI+    G+  + E A  +I       AH+  R
Sbjct:   97 GSAGETKARGCNITECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFLITGRKEDVALARREIISAAEHFSMLRASRNKLG--VSFNG----SPP-----TPLPGQTTIQVRVPYRVVGLVVGPKGSTIKRIQQQTCTYIVTPSRD--RDP----VFEIT----GSPGNAERAREEIE------AHIAFR 270          
BLAST of RNA-binding protein MEX3B vs. Ensembl Cavefish
Match: mex3b (mex-3 RNA binding family member B [Source:NCBI gene;Acc:103046405])

HSP 1 Score: 75.0998 bits (183), Expect = 2.487e-13
Identity = 61/182 (33.52%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQIT--RNKLGNIAGLMGERPR-SPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEIS-VYENGTVNSEETAWLQIHRAKQLI-AHLVMR 1317
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+  +  R      + L G  P   PP L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+         FE++ + EN            + RA++ I AH+ MR
Sbjct:   62 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRREDVAMARREIISAAEHFSMIRASRNKNSSLNGSTPVPGPPNLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPV------FEVTGMPEN------------VDRAREEIEAHIAMR 222          
BLAST of RNA-binding protein MEX3B vs. Ensembl Cavefish
Match: MEX3D (mex-3 RNA binding family member D [Source:HGNC Symbol;Acc:HGNC:16734])

HSP 1 Score: 64.6994 bits (156), Expect = 4.446e-10
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  730 HKH---GSSGSHLTQKQY---LVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTP-LATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            H H   G  GS L  ++    +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+  +  +        G             P   T  + VP R+VG V+G +G+ I  +Q++T T I +P +++
Sbjct:   20 HSHVVLGEQGSVLCNRKRSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRREDVEMAKREIISAAEHFSMIRASRCKAGAGGNGGGSLPGPPHLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSREK 179          
BLAST of RNA-binding protein MEX3B vs. Ensembl Sea Lamprey
Match: mex3b (mex-3 RNA binding family member B [Source:ZFIN;Acc:ZDB-GENE-030131-2628])

HSP 1 Score: 49.6766 bits (117), Expect = 4.178e-6
Identity = 38/143 (26.57%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKE---------DHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++  ++ T          T  + E          +++   AV E  + +  ++ +     + + +G++ G        PP+ G      T  + VP R+VG V+G +G+ I  +Q+ T T I +P +D+
Sbjct:   13 VAVPSSEHVAEIVGRQDTRLLTFGADVNVHTFTRVDTERPLYIHVHRSYIYWTVAVSEHLVVMKTVVLRGFKCSSDDLVGDLYG------PXPPVPGQ----TTIQVRVPYRVVGLVVGPKGATIKRIQQGTHTYIVTPSRDK 145          
BLAST of RNA-binding protein MEX3B vs. Ensembl Nematostella
Match: EDO32414 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SV60])

HSP 1 Score: 70.0922 bits (170), Expect = 2.320e-13
Identity = 47/141 (33.33%), Postives = 69/141 (48.94%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETA-------IKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   ED VF++    E         I   +   Q+  Q   N L ++A                   +T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:   10 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEDPVFVVTGRKEDVTLAKREIISAAEHFSQIRAQRKNNSLNSLAPGPPSPSVPGQ--------STILVRVPYRVVGLVVGPKGATIKRIQQQTNTYIVTPSRDK 142          
BLAST of RNA-binding protein MEX3B vs. Ensembl Medaka
Match: ENSORLT00000028704.1 (mex-3 RNA binding family member A [Source:NCBI gene;Acc:111948930])

HSP 1 Score: 80.1073 bits (196), Expect = 8.481e-15
Identity = 60/161 (37.27%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  730 HKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLG-NIAGLMGERPRSPPMLGNRTPL---ATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKD 1185
            ++ GS G    +   +   V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VFLI    E      + I   A+       +RNKLG + +G       SPP     TPL    T  + VP R+VG V+G +GS I  +Q++T T I +P +D
Sbjct:  157 YESGSGGETKGRGCNITECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFLITGRKEDVALARREIISAAEHFSMLRASRNKLGVSFSG-------SPP-----TPLPGQTTIQVRVPYRVVGLVVGPKGSTIKRIQQQTCTYIVTPSRD 305          
BLAST of RNA-binding protein MEX3B vs. Ensembl Medaka
Match: ENSORLT00000006291.2 (RNA-binding protein MEX3B [Source:NCBI gene;Acc:101170521])

HSP 1 Score: 74.7146 bits (182), Expect = 4.961e-13
Identity = 50/139 (35.97%), Postives = 72/139 (51.80%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQI-----TRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E  VF++    E      + I   A+       +RNK G    L+       P L  +T   T  + VP R+VG V+G +G+ I  +Q++T T I +P +D+
Sbjct:  199 VAVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEQPVFVVTGRKEDVAMAKREILSAAEHFSLIRASRNKTGP---LLSVTALGTPTLPGQT---TIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 331          
BLAST of RNA-binding protein MEX3B vs. Ensembl Medaka
Match: MEX3D (mex-3 RNA binding family member D [Source:NCBI gene;Acc:101171527])

HSP 1 Score: 64.6994 bits (156), Expect = 5.430e-10
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+  +  +             S P   +     T  + VP R+VG V+G +G+ I  +Q++T T I +P +++
Sbjct:  152 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRREDVEMAKREIVSAAEHFSMIRASRCKAGGSGGGGSLPGPPHLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSREK 285          
BLAST of RNA-binding protein MEX3B vs. Ensembl Medaka
Match: MEX3D (mex-3 RNA binding family member D [Source:NCBI gene;Acc:101171527])

HSP 1 Score: 63.929 bits (154), Expect = 8.339e-10
Identity = 43/134 (32.09%), Postives = 67/134 (50.00%), Query Frame = 1
Query:  787 VRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDE 1188
            V VPS EHV+EIVG++G KIK +R  T   I TP   E+ VF++    E      + I   A+  +  +             S P   +     T  + VP R+VG V+G +G+ I  +Q++T T I +P +++
Sbjct:  152 VPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRREDVEMAKREIVSAAEHFSMIRASRCKAGGSGGGGSLPGPPHLPGQTTIQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSREK 285          
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Match: SMESG000025422.1 (SMESG000025422.1)

HSP 1 Score: 1423.68 bits (3684), Expect = 0.000e+0
Identity = 798/800 (99.75%), Postives = 800/800 (100.00%), Query Frame = 1
Query:   43 MLSASFNQTPNQGLRFNLSDNSMNEFSSQIGYHENYIPKPEMYNQFYNQTSHFMQSLNQDSKMYSISEVDXXXXXXXXXXXXXDMSQLDHNKDFDYILSSRLQAMNIKPNCNISRSNSAHNSPYDNRVTPRHFSQSTSNTPLPVSNRLGREMDMMRLNAPIMQLFXXXXXXXXXXXXXXXXRQSPVELIEYQSMASKMGFLVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSPEWIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPPTSTGMSPQFSMSSLHDSNKQQSSSGFHSLNSTPFKMMPEDSWNRNSISDCYSSSTDAQVRNRLNVFKDTPVFYPPQYSNMQPSMSGGDSHHRATAGSNHYYPSNDSAFXXXXXXXXXXXXXNRDSNQQLFLSDNNYILDHLSADXXXXXXXXXXXXXXXXXXXXXDSWAASKPGFYXXXXXXXXXXXXXXXXXHQNYADDTRFGNVKYLWKNCPSDSNHDSVASWASKLDXXXXXXXXXIDNXXXXXXXXVSSAPVATAAGVLLRQSHRTIAPPPESMFGTIGDGRKRNSAASNSDERED 2442
            MLSASFNQTPNQGLRFNLSDNSMNEFSSQIGYHENYIPKPEMYNQFYNQTSHFMQSLNQDSKMYSISEVDSLHHHSNSNSISNDMSQLDHNKDFDYILSSRLQAMNIKPNCNISRSNSAHNSPYDNRVTPRHFSQSTSNTPLPVSNRLGREMDMMRLNAPIMQLFPQNSPSSNPVNSYSMSRQSPVELIEYQSMASKMGFLVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSPEWIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPPTSTGMSPQFSMSSLHD+NKQQSSSGFHSLNSTPFKMMPEDSWNRNSISDCYSSSTDAQVRNRLNVFKDTPVFYPPQYSNMQPSMSGGDSHHRATAGSNHYYPSNDSAFYDSYYPSVYSPPSNRDSNQQLFLSDNNYILDHLSADSPPPNCNNNNSNHHLVNGNNSDSWAASKPGFYSNGNPNNSSNGVGGCCNHQNYADDTRFGNVKYLWKNCPSDSNHDSVASWASKLDNNNGGSNGGIDNHHHQQQQQVSSAPVATAAGVLLRQS+RTIAPPPESMFGTIGDGRKRNSAASNSDERED
Sbjct:    1 MLSASFNQTPNQGLRFNLSDNSMNEFSSQIGYHENYIPKPEMYNQFYNQTSHFMQSLNQDSKMYSISEVDSLHHHSNSNSISNDMSQLDHNKDFDYILSSRLQAMNIKPNCNISRSNSAHNSPYDNRVTPRHFSQSTSNTPLPVSNRLGREMDMMRLNAPIMQLFPQNSPSSNPVNSYSMSRQSPVELIEYQSMASKMGFLVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSPEWIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPPTSTGMSPQFSMSSLHDTNKQQSSSGFHSLNSTPFKMMPEDSWNRNSISDCYSSSTDAQVRNRLNVFKDTPVFYPPQYSNMQPSMSGGDSHHRATAGSNHYYPSNDSAFYDSYYPSVYSPPSNRDSNQQLFLSDNNYILDHLSADSPPPNCNNNNSNHHLVNGNNSDSWAASKPGFYSNGNPNNSSNGVGGCCNHQNYADDTRFGNVKYLWKNCPSDSNHDSVASWASKLDNNNGGSNGGIDNHHHQQQQQVSSAPVATAAGVLLRQSNRTIAPPPESMFGTIGDGRKRNSAASNSDERED 800          
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Match: SMESG000062702.1 (SMESG000062702.1)

HSP 1 Score: 223.402 bits (568), Expect = 2.663e-60
Identity = 147/360 (40.83%), Postives = 198/360 (55.00%), Query Frame = 1
Query:  625 ASKMGFLVGQDLDEVLNRS--ATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQIT--RN----KLGNIAGLMGERP--RSPP-----MLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTP-----------------SSDEGNCTPNTC-------------------------SP-EWIWPEVSRMDDGDAKEIIDRILRSSKAKI-TPSTSSTEGTNIDGL 1527
            A K+GF+VG +L+ V  +S  + ++N+   RI N FK ++G S S  ++K YL LGVRVPSKEHVSEIVGK+G KIK IR+ TGALI TP E+EDHVF+IEA P TA+ V QI++  A+ IT  RN    +  +       RP  RSP        G++  LA+  I VP+ +VG++IGTQGSIITT+Q++TGTEI+SPPK+  +     ADFEI VY+   +     A  ++  AKQLIAH+ M   ++      P                 SSDE N                                P EWIW +V +++D  A+E+++RIL  SK K  T S  S    N  GL
Sbjct:  175 AQKIGFIVGDELENVKAKSHRSVIQNT-PDRIINTFKDRYGQSDSS-SKKTYLQLGVRVPSKEHVSEIVGKQGSKIKQIREKTGALITTPGEQEDHVFIIEAPPRTALHVAQILKNRAEDITMSRNQESRRRSSCPITNNNRPSNRSPAASGITQAGSKVVLASGRIQVPKIIVGRIIGTQGSIITTIQRDTGTEIRSPPKEIGKPKNSMADFEILVYQTTNLTDLHEAKQRVLNAKQLIAHVAMHQLEKIRAEEAPYSNYQVQSHVSTSNGDQSSDEDNLAGKMAMNNDHNESRHSLITGNRDKLLLDQMKPHEWIWSDVEKLEDNLAQEVVNRILEESKKKTKTRSEPSIYDDNTKGL 532          
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Match: SMESG000062702.1 (SMESG000062702.1)

HSP 1 Score: 223.016 bits (567), Expect = 2.748e-60
Identity = 147/360 (40.83%), Postives = 198/360 (55.00%), Query Frame = 1
Query:  625 ASKMGFLVGQDLDEVLNRS--ATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQIT--RN----KLGNIAGLMGERP--RSPP-----MLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTP-----------------SSDEGNCTPNTC-------------------------SP-EWIWPEVSRMDDGDAKEIIDRILRSSKAKI-TPSTSSTEGTNIDGL 1527
            A K+GF+VG +L+ V  +S  + ++N+   RI N FK ++G S S  ++K YL LGVRVPSKEHVSEIVGK+G KIK IR+ TGALI TP E+EDHVF+IEA P TA+ V QI++  A+ IT  RN    +  +       RP  RSP        G++  LA+  I VP+ +VG++IGTQGSIITT+Q++TGTEI+SPPK+  +     ADFEI VY+   +     A  ++  AKQLIAH+ M   ++      P                 SSDE N                                P EWIW +V +++D  A+E+++RIL  SK K  T S  S    N  GL
Sbjct:  159 AQKIGFIVGDELENVKAKSHRSVIQNT-PDRIINTFKDRYGQSDSS-SKKTYLQLGVRVPSKEHVSEIVGKQGSKIKQIREKTGALITTPGEQEDHVFIIEAPPRTALHVAQILKNRAEDITMSRNQESRRRSSCPITNNNRPSNRSPAASGITQAGSKVVLASGRIQVPKIIVGRIIGTQGSIITTIQRDTGTEIRSPPKEIGKPKNSMADFEILVYQTTNLTDLHEAKQRVLNAKQLIAHVAMHQLEKIRAEEAPYSNYQVQSHVSTSNGDQSSDEDNLAGKMAMNNDHNESRHSLITGNRDKLLLDQMKPHEWIWSDVEKLEDNLAQEVVNRILEESKKKTKTRSEPSIYDDNTKGL 516          
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Match: SMESG000071674.1 (SMESG000071674.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.649e-55
Identity = 131/327 (40.06%), Postives = 186/327 (56.88%), Query Frame = 1
Query:  610 EYQSMASKMGFLVGQDLDEVLNRSA-TMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNK----------LGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDT-ADFEISVYE-NGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSD----------------EGNCTPNT--------CSPEWIWPEVSRMDDGDAKEIIDRILRSSKAK 1479
            +Y   A   GF+VG +L+ V  +S  ++    S+ IS  F+  +G   + + Q  Y  +GVRVP+KEHVSEIVGK+G KIK IR+ TGALI TP E EDHVF+IEA+P  A+ V ++I+  A++IT N+          L NI+   G       +   R  LAT  I VP+ +VG++IGT GSIITT+QK+TGTEI+SPPKD   +  +  A FEI VY+ N T++ +E A  +I  AKQLIAH+ M   ++     +P S+                +GN   +          S  W+W ++ R++D  A E++ RIL  SK K
Sbjct:   46 DYIQEAQTDGFIVGLELENVKAKSRRSLMQQMSNHISINFQSLYGKENNGVRQ-NYFQIGVRVPTKEHVSEIVGKQGLKIKEIREKTGALIITPGESEDHVFIIEALPGIALTVARLIKDRANEITINRQRENNQKVSLLMNISNRFGTVKPYNAISSLRPILATGIIEVPKNIVGRIIGTHGSIITTIQKDTGTEIRSPPKDNNPSHNNCKAKFEILVYQRNNTIDVQE-AVQRIKNAKQLIAHVAMHQMERIRAEESPFSNYRLKSISSWEKNLPASDGNVFADKEKLLNYQMQSISWLWTDIDRLEDQMADEVVLRILEESKKK 370          
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Match: SMESG000071674.1 (SMESG000071674.1)

HSP 1 Score: 204.912 bits (520), Expect = 1.859e-55
Identity = 131/327 (40.06%), Postives = 186/327 (56.88%), Query Frame = 1
Query:  610 EYQSMASKMGFLVGQDLDEVLNRSA-TMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVRVPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAIKVGQIIQQLADQITRNK----------LGNIAGLMGERPRSPPMLGNRTPLATATIGVPQRLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDT-ADFEISVYE-NGTVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSD----------------EGNCTPNT--------CSPEWIWPEVSRMDDGDAKEIIDRILRSSKAK 1479
            +Y   A   GF+VG +L+ V  +S  ++    S+ IS  F+  +G   + + Q  Y  +GVRVP+KEHVSEIVGK+G KIK IR+ TGALI TP E EDHVF+IEA+P  A+ V ++I+  A++IT N+          L NI+   G       +   R  LAT  I VP+ +VG++IGT GSIITT+QK+TGTEI+SPPKD   +  +  A FEI VY+ N T++ +E A  +I  AKQLIAH+ M   ++     +P S+                +GN   +          S  W+W ++ R++D  A E++ RIL  SK K
Sbjct:   51 DYIQEAQTDGFIVGLELENVKAKSRRSLMQQMSNHISINFQSLYGKENNGVRQ-NYFQIGVRVPTKEHVSEIVGKQGLKIKEIREKTGALIITPGESEDHVFIIEALPGIALTVARLIKDRANEITINRQRENNQKVSLLMNISNRFGTVKPYNAISSLRPILATGIIEVPKNIVGRIIGTHGSIITTIQKDTGTEIRSPPKDNNPSHNNCKAKFEILVYQRNNTIDVQE-AVQRIKNAKQLIAHVAMHQMERIRAEESPFSNYRLKSISSWEKNLPASDGNVFADKEKLLNYQMQSISWLWTDIDRLEDQMADEVVLRILEESKKK 375          
The following BLAST results are available for this feature:
BLAST of RNA-binding protein MEX3B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEX3D1.063e-1332.57mex-3 RNA binding family member D [Source:HGNC Sym... [more]
MEX3D1.273e-1336.69mex-3 RNA binding family member D [Source:HGNC Sym... [more]
MEX3C1.996e-1334.53mex-3 RNA binding family member C [Source:HGNC Sym... [more]
MEX3B4.335e-1338.85mex-3 RNA binding family member B [Source:HGNC Sym... [more]
MEX3C5.162e-1334.53mex-3 RNA binding family member C [Source:HGNC Sym... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mex-31.770e-1232.84Muscle EXcess [Source:UniProtKB/TrEMBL;Acc:V6CKQ3... [more]
mex-31.319e-1131.58Muscle EXcess [Source:UniProtKB/TrEMBL;Acc:V6CKQ3... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG113609.644e-1330.20gene:FBgn0039920 transcript:FBtr0310539[more]
CG113609.644e-1330.20gene:FBgn0039920 transcript:FBtr0310540[more]
CG113609.644e-1330.20gene:FBgn0039920 transcript:FBtr0310541[more]
CG113609.644e-1330.20gene:FBgn0039920 transcript:FBtr0089091[more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mex3b3.517e-1333.15mex-3 RNA binding family member B [Source:ZFIN;Acc... [more]
FO082781.14.993e-1333.66mex-3 RNA binding family member A [Source:NCBI gen... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mex3d1.599e-1537.86mex-3 RNA binding family member D [Source:NCBI gen... [more]
mex3d1.850e-1537.86mex-3 RNA binding family member D [Source:NCBI gen... [more]
MEX3B3.277e-1538.13mex-3 RNA binding family member B [Source:NCBI gen... [more]
atp6ap26.557e-1334.97ATPase, H+ transporting, lysosomal accessory prote... [more]
MEX3A5.321e-631.97mex-3 RNA binding family member A [Source:HGNC Sym... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Mex3d1.166e-1433.16mex3 RNA binding family member D [Source:MGI Symbo... [more]
Mex3b3.322e-1338.85mex3 RNA binding family member B [Source:MGI Symbo... [more]
Mex3c4.094e-1334.53mex3 RNA binding family member C [Source:MGI Symbo... [more]
Mex3a1.582e-1230.59mex3 RNA binding family member A [Source:MGI Symbo... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A1L3F4|MEX3B_XENLA6.355e-1538.13RNA-binding protein MEX3B OS=Xenopus laevis OX=835... [more]
sp|Q3UE17|MEX3D_MOUSE4.546e-1331.72RNA-binding protein MEX3D OS=Mus musculus OX=10090... [more]
sp|Q86XN8|MEX3D_HUMAN5.103e-1332.57RNA-binding protein MEX3D OS=Homo sapiens OX=9606 ... [more]
sp|Q6ZN04|MEX3B_HUMAN2.082e-1238.85RNA-binding protein MEX3B OS=Homo sapiens OX=9606 ... [more]
sp|Q5U5Q3|MEX3C_HUMAN2.479e-1234.53RNA-binding E3 ubiquitin-protein ligase MEX3C OS=H... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UGA85.647e-6239.10Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3T6J83.189e-3731.55Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A183L5V81.393e-3237.74KH domain-containing protein OS=Schistosoma curass... [more]
A0A3P8H8401.486e-3237.74KH domain-containing protein OS=Schistosoma curass... [more]
A0A1S8WYK34.658e-3249.08KH domain protein (Fragment) OS=Opisthorchis viver... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000025356.26.285e-1535.82pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
mex3b2.487e-1333.52mex-3 RNA binding family member B [Source:NCBI gen... [more]
MEX3D4.446e-1030.63mex-3 RNA binding family member D [Source:HGNC Sym... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mex3b4.178e-626.57mex-3 RNA binding family member B [Source:ZFIN;Acc... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO324142.320e-1333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000028704.18.481e-1537.27mex-3 RNA binding family member A [Source:NCBI gen... [more]
ENSORLT00000006291.24.961e-1335.97RNA-binding protein MEX3B [Source:NCBI gene;Acc:10... [more]
MEX3D5.430e-1032.09mex-3 RNA binding family member D [Source:NCBI gen... [more]
MEX3D8.339e-1032.09mex-3 RNA binding family member D [Source:NCBI gen... [more]
back to top
BLAST of RNA-binding protein MEX3B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025422.10.000e+099.75SMESG000025422.1[more]
SMESG000062702.12.663e-6040.83SMESG000062702.1[more]
SMESG000062702.12.748e-6040.83SMESG000062702.1[more]
SMESG000071674.11.649e-5540.06SMESG000071674.1[more]
SMESG000071674.11.859e-5540.06SMESG000071674.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033302 ID=SMED30033302|Name=RNA-binding protein MEX3B|organism=Schmidtea mediterranea sexual|type=transcript|length=4165bp
TCTATATAAATCTTATATGACAATTTTGTTAGTATTCATCCGATGTTAAG
TGCTTCGTTCAACCAAACACCAAATCAAGGCCTTCGATTTAATTTATCAG
ATAATTCAATGAATGAATTCTCATCTCAAATCGGATATCACGAAAATTAT
ATCCCTAAACCAGAAATGTATAATCAATTTTATAACCAAACCAGTCATTT
TATGCAAAGTTTAAATCAAGATTCTAAGATGTATTCTATTTCTGAAGTAG
ATTCCCTACACCACCATTCCAACAGTAATTCCATTTCGAATGACATGTCC
CAATTAGATCACAACAAAGATTTTGATTATATCTTATCTTCGAGACTTCA
AGCCATGAATATCAAACCTAATTGTAATATAAGCCGATCAAACAGTGCAC
ATAATTCTCCTTATGATAATCGGGTTACTCCGCGTCACTTTTCACAGTCG
ACATCAAATACACCACTTCCCGTTTCAAACCGATTAGGTCGAGAAATGGA
CATGATGAGATTAAATGCTCCAATAATGCAGTTATTCCCTCAGAATTCTC
CCAGCTCAAATCCAGTAAATTCGTACTCAATGAGCAGACAAAGTCCCGTG
GAATTAATTGAATATCAATCAATGGCGTCGAAAATGGGATTTCTTGTCGG
GCAAGATTTAGATGAAGTGCTTAATCGTTCTGCGACAATGAAAAATAGCA
ATAGTAGCCGGATTTCTAACTTCTTCAAACACAAACACGGCAGCTCAGGG
TCTCATTTAACCCAAAAGCAATATTTGGTACTGGGTGTTCGCGTTCCCAG
TAAGGAGCATGTCTCAGAAATCGTGGGAAAAGAAGGCAAAAAAATCAAAA
CGATCCGCCAAACAACAGGCGCATTGATCGCCACTCCGAACGAGAAAGAG
GATCACGTTTTCCTGATCGAAGCAGTTCCAGAAACTGCAATTAAAGTCGG
ACAGATTATCCAGCAATTAGCCGATCAAATAACTCGCAATAAACTCGGTA
ACATCGCCGGTTTAATGGGAGAGCGACCTCGTAGTCCTCCTATGCTCGGC
AACCGAACGCCATTGGCAACGGCAACAATTGGGGTACCGCAGCGACTGGT
TGGCAAGGTTATTGGTACGCAAGGATCGATCATCACGACAGTACAGAAAG
AAACTGGAACTGAGATTAAAAGTCCCCCGAAGGATGAGTTGCGTGCTCCT
GGAGACACGGCAGATTTTGAGATATCAGTTTATGAGAATGGAACTGTGAA
CAGTGAAGAAACCGCTTGGCTGCAAATCCATCGGGCCAAGCAATTAATAG
CCCATCTTGTAATGCGAGTTTGGGATCAGCAGCCCCGCAATTCCACTCCG
TCGAGTGACGAGGGCAACTGCACCCCGAATACTTGCAGCCCCGAATGGAT
TTGGCCCGAAGTGTCTCGCATGGACGACGGAGATGCCAAAGAAATCATTG
ATCGAATCTTGCGGTCATCGAAAGCGAAAATCACCCCATCGACCAGCTCA
ACGGAAGGAACGAATATTGACGGTCTCGTCATGCCGCCTCCAACGAGCAC
TGGCATGTCTCCCCAGTTCTCTATGTCGTCTCTCCATGACTCCAATAAGC
AGCAATCATCATCAGGCTTCCATTCTCTCAATTCTACCCCGTTCAAAATG
ATGCCCGAGGACAGCTGGAACCGTAACAGCATTTCCGACTGTTACTCGTC
ATCAACTGATGCTCAAGTTCGCAACCGACTCAACGTATTCAAAGATACTC
CTGTATTTTATCCACCACAATACTCAAATATGCAGCCGTCGATGTCCGGT
GGAGATTCCCATCACCGCGCGACAGCGGGCAGCAATCACTATTACCCTAG
CAATGACAGCGCCTTCTACGATTCGTATTATCCAAGCGTCTATTCTCCGC
CTTCCAATCGCGACAGTAACCAACAGTTGTTCCTGTCAGATAACAACTAC
ATTCTCGACCACCTTTCGGCCGATTCCCCGCCGCCCAATTGCAATAATAA
CAACAGTAATCATCACCTTGTCAACGGCAATAACTCGGATTCCTGGGCCG
CATCGAAACCCGGTTTCTATTCGAATGGGAACCCCAACAATAGCAGCAAC
GGTGTTGGAGGCTGTTGCAACCACCAAAACTATGCCGACGACACCCGATT
CGGCAATGTGAAATATCTCTGGAAGAATTGTCCTAGTGATTCGAATCACG
ATTCCGTCGCGTCCTGGGCATCGAAACTTGATAACAACAATGGCGGTAGT
AATGGAGGTATCGATAATCATCACCATCAGCAGCAGCAGCAAGTCTCATC
AGCACCCGTTGCCACGGCTGCTGGCGTCCTCCTACGACAATCCCATCGGA
CAATTGCACCGCCTCCCGAATCGATGTTCGGCACGATCGGGGACGGACGG
AAACGCAACTCGGCCGCTAGTAACAGCGATGAAAGAGAAGATTTATAAAT
TGAAATTTAATTAATTAATCAAGAGTTAAATTAATCCAGAACAAATATTC
TACCGACATTAGAGTTGATGATTTATAGAAATATATTGATGTCCTTGTAC
TATTTATTGATTTTTGTTTCCTCTCTGTGTTTGTACCGTTGTTCCCCTTG
TTTACCGTTATTATTATTATTCCTGTGTTTTCACTTTTATATTGCGCGTG
CTATTCGGTTCGATTGCGTTACTAGATGTCTACTCGATTAGTTTATGTAT
ATATATTGCTATTATTATTTGATTGTGTTACCGTGGTGATGAGAGTTATT
TGGGGACTATTTATAAATATATCAGCCTCATGAACTATCAATTCACGATT
TTACTCTTGTTTGAGCACAAGTTTATATATTTTATTATTATTGATTATTT
GGTGATGGCAGAAACTACAAGAGTTGTATTACATTTTTTCTCTGTTTGAA
AATGTTTTTATTCTGAGTTATTGAGAATAATTTTTTCCGTTTGTAATGAT
TTGAATTATTATTATTAAATTAATTATATTGATTATTGCTGTTGTTTGAT
GAATGTGCAAATGTTCTCTTTCTATATATTTATTTAGATATCCGTCTGCA
TTTACCTTGGTTTCAATCTGCGTGTAATTGTACTATACATATTATATATA
ACCACATTGCTTATCATTTGTTAATTGGCATTTACTCCTCTATTGATGGA
TAATGTGCAACCGTTGGTGCTTGCAGTTTCAAACATATATCTATATTTGT
TTGGTAAATTTTATAAATGTAAGATTCGTGTATAGTTTGATGTTCTTTTT
TATTGTTATTACTATTGTTATTATTATTATATTTTTCTAAAAGAATATTT
GCGCATTGATTTCTTTGCTGGGTTCAACAGAAGTGGAATAATTGTTCTAG
TTGTGTTTAATTTGTTTATCGAATTCATATTGTAAGATGTCACAAAATAT
TTTCTGATTTCATTATATCCATCATATAGCAGCAGTTGCGGTATCCGGTA
CAACGGTGTACCATCGATAAACATTTTATGTTATAAACAAGTTAAGCTTG
GCTCGTGTGTGTGTATGTAGATAGATGTTTTTGATTTTTTTTCCTTCGAG
TTATCATCAACAATCAGTGGTTAATCTTATTTATCCAGATAATACAATGC
AAATCGCAGATTATTTCTATTTAAGCTTGATGACATAATATATTTGGCTT
TGAAGAAATATATAGAGAAATAGAATTTGATGGTGAACATTATTTTGAAT
TTGAAAATGAATAATAACAACAATAACATTCGAGTGAAATTTGTATGTAA
TTCTGTTGTTACTATTATTGGCAGTTTTTATTTTTCTAATATTTTTGTAC
ATTTTCAGTTTTGATAAATAACTGTTTCTGTAGGTAGTTTGAAATTATTA
TTATTATTATTATGTTAATTGTATTGTTTTTTCTGGCCGCCAAACTACCG
TAAGAAAACGAGAAAAGTAAACCAGCTGTAATATGAGAGTCTAAATCACT
AGAGTACCAATTAATTTTTGTGTTCCTGTTACTTGTTAGAATATTTCTTG
CTGCTTAGCTCCAGGATCATTTATCGACTATTTTCAAAATGATAATTTAT
ATTATCCATGTTGCATTGCTGGTTCAAGTTTTGTAATTGATTTTTTAGCC
CTATTATTTGAATTATTGTTGTAGCAATTATTTTATTTAAATAAATGAGT
TTATCTTAAAAAAAA
back to top

protein sequence of SMED30033302-orf-1

>SMED30033302-orf-1 ID=SMED30033302-orf-1|Name=SMED30033302-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=802bp
MLSASFNQTPNQGLRFNLSDNSMNEFSSQIGYHENYIPKPEMYNQFYNQT
SHFMQSLNQDSKMYSISEVDSLHHHSNSNSISNDMSQLDHNKDFDYILSS
RLQAMNIKPNCNISRSNSAHNSPYDNRVTPRHFSQSTSNTPLPVSNRLGR
EMDMMRLNAPIMQLFPQNSPSSNPVNSYSMSRQSPVELIEYQSMASKMGF
LVGQDLDEVLNRSATMKNSNSSRISNFFKHKHGSSGSHLTQKQYLVLGVR
VPSKEHVSEIVGKEGKKIKTIRQTTGALIATPNEKEDHVFLIEAVPETAI
KVGQIIQQLADQITRNKLGNIAGLMGERPRSPPMLGNRTPLATATIGVPQ
RLVGKVIGTQGSIITTVQKETGTEIKSPPKDELRAPGDTADFEISVYENG
TVNSEETAWLQIHRAKQLIAHLVMRVWDQQPRNSTPSSDEGNCTPNTCSP
EWIWPEVSRMDDGDAKEIIDRILRSSKAKITPSTSSTEGTNIDGLVMPPP
TSTGMSPQFSMSSLHDSNKQQSSSGFHSLNSTPFKMMPEDSWNRNSISDC
YSSSTDAQVRNRLNVFKDTPVFYPPQYSNMQPSMSGGDSHHRATAGSNHY
YPSNDSAFYDSYYPSVYSPPSNRDSNQQLFLSDNNYILDHLSADSPPPNC
NNNNSNHHLVNGNNSDSWAASKPGFYSNGNPNNSSNGVGGCCNHQNYADD
TRFGNVKYLWKNCPSDSNHDSVASWASKLDNNNGGSNGGIDNHHHQQQQQ
VSSAPVATAAGVLLRQSHRTIAPPPESMFGTIGDGRKRNSAASNSDERED
L*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR001002Chitin-bd_1
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0008061chitin binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 251..319
e-value: 1.9E-5
score: 34.1
coord: 348..428
e-value: 1.7E-5
score: 34.3
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 257..301
e-value: 1.7E-5
score: 24.5
coord: 352..397
e-value: 1.1E-7
score: 31.6
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 345..434
e-value: 1.7E-9
score: 39.1
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 255..317
e-value: 4.7E-7
score: 31.6
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 257..324
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 339..396
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 516..538
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 774..809
NoneNo IPR availablePANTHERPTHR23285:SF17MEX-3 RNA BINDING FAMILY MEMBER Acoord: 256..390
NoneNo IPR availablePANTHERPTHR23285RING FINGER AND KH DOMAIN CONTAINING PROTEIN 1coord: 256..390
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 349..427
score: 11.783
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 262..314
score: 9.624
NoneNo IPR availableCDDcd00105KH-Icoord: 257..315
e-value: 6.72825E-6
score: 42.1619
NoneNo IPR availableCDDcd00105KH-Icoord: 351..427
e-value: 2.5637E-7
score: 46.3991