Cytohesin-1

Overview
NameCytohesin-1
Smed IDSMED30033298
Length (bp)1321
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytohesin-1 (SMED30033298) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytohesin-1 (SMED30033298) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytohesin-1 (SMED30033298) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytohesin-1 (SMED30033298) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033298

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30033298SMESG000056462.1 dd_Smed_v4_5974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30033298SMESG000056462.1 dd_Smed_v4_5974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30033298SMESG000056462.1 dd_Smed_v4_5974_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytohesin-1 vs. Ensembl Human
Match: CYTH1 (cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501])

HSP 1 Score: 192.2 bits (487), Expect = 4.359e-56
Identity = 123/372 (33.06%), Postives = 208/372 (55.91%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E++EW+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISR 377          
BLAST of Cytohesin-1 vs. Ensembl Human
Match: CYTH3 (cytohesin 3 [Source:HGNC Symbol;Acc:HGNC:9504])

HSP 1 Score: 189.889 bits (481), Expect = 3.110e-55
Identity = 127/361 (35.18%), Postives = 196/361 (54.29%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++ N   +++ K      K   + +  FN  PK+GI+FLI N +++ +PEDVA+FL + + LNK  IGDYLG+   EFN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++A+IMLNT+L+N N   +       E F+       E     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L   S    VI A KT  D    + N   +R +  S +E++EW+K+IK  +++
Sbjct:   27 IRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRN-KQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERD-EFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPT----AERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISR 381          
BLAST of Cytohesin-1 vs. Ensembl Human
Match: CYTH1 (cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501])

HSP 1 Score: 189.119 bits (479), Expect = 6.273e-55
Identity = 120/373 (32.17%), Postives = 209/373 (56.03%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E++EW+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISR 378          
BLAST of Cytohesin-1 vs. Ensembl Human
Match: CYTH1 (cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501])

HSP 1 Score: 189.119 bits (479), Expect = 6.273e-55
Identity = 120/373 (32.17%), Postives = 209/373 (56.03%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E++EW+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISR 378          
BLAST of Cytohesin-1 vs. Ensembl Human
Match: CYTH2 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 187.578 bits (475), Expect = 2.109e-54
Identity = 121/363 (33.33%), Postives = 197/363 (54.27%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            +LE IR  +++L+VEI+ L+E+L +   ++      +  K +    K   + +  FN  PK+GI+FL+ N++++ TPE++A+FL + + LNK +IGDYLG+   E N  VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN   +    G E          E     E+LLRN+Y +I+ +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L + +    +I A KT  D    + N   +R +  + +E+ EW+K+I+  ++
Sbjct:   18 ELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKM-AMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGE-REELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKP---GLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVS 375          
BLAST of Cytohesin-1 vs. Ensembl Celegans
Match: grp-1 (GTP exchange factor for ARFs 1 [Source:UniProtKB/Swiss-Prot;Acc:P34512])

HSP 1 Score: 133.265 bits (334), Expect = 1.467e-34
Identity = 103/378 (27.25%), Postives = 191/378 (50.53%), Query Frame = 2
Query:  116 LEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELK-YRNI---AKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPN-----AISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKT------DPLINFG-NIVNELYPTNKMNGELWYQSNN-----LRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCL 1183
            L  +R  + +L+ EIE+LK ++++V++++    +        P+ K Y  I    +  FN  P + +++L +  ++ + P+ +A +++  + L+K +IG+ LGD    F  + LD + + H       V  LR +L  F LPGESQKI+ I++ +++ Y   NP  + NAD+ + +AY+ IM+NT L+NPN     ++ + IE  ++      +LE    + ++  L  VY ++        D +   G   VN++    +  G L+ QS+N        WKKR FVL   CL       + + +  I L NV + +V E  +R F+  + S ++G I A KT +D    +     ++    + ++ + W+ AI + +
Sbjct:   19 LPKVRKRKAQLVDEIEALKNEVREVDEELDQVYYTH------PKSKEYHKIVVNGRKKFNQDPWKALDWLASRNVVAKDPQALALWMKAGEGLSKSAIGEILGD-NRPFALETLDRFTKEHKLHDVPIVPALRQYLFSFRLPGESQKINRILEKFAEVYANQNPS-YGNADQAHTVAYSCIMVNTLLHNPNVKDKPSLEKYIEMNEQ------LLEKGAITIEQ--LTEVYESVSVTQFKIPDEVSTSGKGTVNDILLHAEREGWLFKQSSNPLFSGALSWKKRWFVLSENCLYYFDQMTDKEPKGIITLANVGIRKV-EAPSRPFMFEIFSLSDGQIKACKTEQDGRLVEGRHSIYKICAVNDEDMRSWINAISRMM 379          
BLAST of Cytohesin-1 vs. Ensembl Celegans
Match: agef-1 (Arf-1 Guanine nucleotide Exchange Factor homolog [Source:UniProtKB/TrEMBL;Acc:G5EFH7])

HSP 1 Score: 110.923 bits (276), Expect = 1.214e-25
Identity = 56/133 (42.11%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPK--MFNNADEPYVLAYAVIMLNTTLNN 667
            F+ KPK+G++FL  +  +     +VA+F+ +E  LNK  +GD+LGD + EFN  V+ AY+   DF   + +  LR+FL  F LPGE+QKI  ++  ++  Y +CNP+  +F +AD  YVLA+++IML T L+N
Sbjct:  524 FSEKPKKGLKFLQEHGFVGTDAVEVAEFMMKEERLNKTQVGDFLGD-SDEFNNSVMHAYIDFLDFSSIDILAALRMFLEKFRLPGEAQKIDRLMLKFASRYLDCNPRQGIFASADAAYVLAFSIIMLTTDLHN 655          
BLAST of Cytohesin-1 vs. Ensembl Celegans
Match: gbf-1 (pep chromosome:WBcel235:III:11751320:11773681:-1 gene:WBGene00007703.1 transcript:C24H11.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:gbf-1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.055e-19
Identity = 60/199 (30.15%), Postives = 109/199 (54.77%), Query Frame = 2
Query:  230 KIVDPELKYRNIAKTH--FNNKPKRGIEFLITNQIIKETPEDVAKFLQ-EPDLNKRSIGDYLGDITVEFNRK---VLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTML-EYENYSFQEDLLRNVYHTIKTDPLI 805
            +I++ + + R IA+    FN  PK+GI FL    I+    + + ++L+  P L+K++I DY+       NRK   VL+A+V+   F +      LR+FL  F LPGES +I+ +++ +S+ ++  N + F + D  + L+YA+IMLN   +NP A          + F + +    ++  F  ++L ++Y  IKT+ ++
Sbjct:  624 QIIEQKKRKRLIAEGTELFNQSPKKGIAFLREKGILGHDEQSLVQWLRTNPQLDKKAIADYI------CNRKHAEVLNAFVKSFPFENTRLDVALRMFLETFRLPGESAEIALVMQHFSEEWFRANNEPFFHVDAAFTLSYAIIMLNVDQHNPQAKRSQPPM-TVDCFRRNLSGTNDSRDFDPEMLADMYQAIKTEEIV 815          
BLAST of Cytohesin-1 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 90.5077 bits (223), Expect = 3.400e-19
Identity = 68/205 (33.17%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  230 KIVDPELK--YRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNA----DEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQ---EDL----LRNVYHTIKTDPL 802
            ++ D E K  YR IA   FN KP+RG++ L     +K +P+ +A  L     L+K  IG+Y+G +   ++  VL  +  L D R  E    LR  +  F LP E++KI  II+A++  Y + NPK  ++     D  ++L++A+IMLNT L++PN + Q +    +  F+K +   +  S +   ED+    L  +Y  IK D L
Sbjct:  218 QMTDQERKRQYR-IALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPN-VKQRM---TQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDEL 417          
BLAST of Cytohesin-1 vs. Ensembl Celegans
Match: bris-1 (BRag/Iqsec/Schizo related Arf GEF family member [Source:UniProtKB/TrEMBL;Acc:U4PLL0])

HSP 1 Score: 90.1225 bits (222), Expect = 3.520e-19
Identity = 68/205 (33.17%), Postives = 109/205 (53.17%), Query Frame = 2
Query:  230 KIVDPELK--YRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNA----DEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQ---EDL----LRNVYHTIKTDPL 802
            ++ D E K  YR IA   FN KP+RG++ L     +K +P+ +A  L     L+K  IG+Y+G +   ++  VL  +  L D R  E    LR  +  F LP E++KI  II+A++  Y + NPK  ++     D  ++L++A+IMLNT L++PN + Q +    +  F+K +   +  S +   ED+    L  +Y  IK D L
Sbjct:   75 QMTDQERKRQYR-IALNFFNKKPERGVQLLTAWGFVKNSPDSLASLLFGRRGLSKSMIGEYIGTLHSPYHSLVLKYFTALIDIRGLEVDVALRKAMQFFILPKEAEKIDRIIQAFALHYSKSNPKRTSHYRGGWDTIHLLSFAIIMLNTDLHSPN-VKQRM---TQADFVKNLRGQDKISGEKNGEDIDRKTLEGIYDRIKKDEL 274          
BLAST of Cytohesin-1 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0085910)

HSP 1 Score: 183.341 bits (464), Expect = 5.379e-53
Identity = 113/359 (31.48%), Postives = 193/359 (53.76%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL---INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            +R  +++L++EI+ +K++L +V  +M      +D K  + + K  +I +  FN  PK+GIE+L+ N++++  P+DVA FL + + LNK +IGDYLG+   +FN  VL A+V LHDF +   V  LR FL  F LPGE+QKI  +++ ++  Y + NP +F N D  YVL++A+IMLNT+L+NP+   +       + F+       N       LL ++Y +I+T+P     + GN +   +      G LW Q    + WK+R F+L   CL       + + R  I L N+ V  + + +         +    +I A KT  +    +     +R +  + ++Q+EW+K + Q ++
Sbjct:   39 LRRKKQELLLEIQQIKDELCEVVSEMEALDVPEDCKHSNKD-KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKN-DFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPT----VDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSIS 391          
BLAST of Cytohesin-1 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0332471)

HSP 1 Score: 171.785 bits (434), Expect = 1.356e-46
Identity = 114/365 (31.23%), Postives = 189/365 (51.78%), Query Frame = 2
Query:  107 SKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL---INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            S  L I+R   K++       K++L +V  +M      +D K  + + K  +I +  FN  PK+GIE+L+ N++++  P+DVA FL + + LNK +IGDYLG+   +FN  VL A+V LHDF +   V  LR FL  F LPGE+QKI  +++ ++  Y + NP +F N D  YVL++A+IMLNT+L+NP+   +       + F+       N       LL ++Y +I+T+P     + GN +   +      G LW Q    + WK+R F+L   CL       + + R  I L N+ V  + + +         +    +I A KT  +    +     +R +  + ++Q+EW+K + Q ++
Sbjct:  357 SDNLVILRRPSKQI-------KDELCEVVSEMEALDVPEDCKHSNKD-KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKN-DFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPT----VDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSIS 708          
BLAST of Cytohesin-1 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0301616)

HSP 1 Score: 171.785 bits (434), Expect = 1.356e-46
Identity = 114/365 (31.23%), Postives = 189/365 (51.78%), Query Frame = 2
Query:  107 SKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL---INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            S  L I+R   K++       K++L +V  +M      +D K  + + K  +I +  FN  PK+GIE+L+ N++++  P+DVA FL + + LNK +IGDYLG+   +FN  VL A+V LHDF +   V  LR FL  F LPGE+QKI  +++ ++  Y + NP +F N D  YVL++A+IMLNT+L+NP+   +       + F+       N       LL ++Y +I+T+P     + GN +   +      G LW Q    + WK+R F+L   CL       + + R  I L N+ V  + + +         +    +I A KT  +    +     +R +  + ++Q+EW+K + Q ++
Sbjct:  357 SDNLVILRRPSKQI-------KDELCEVVSEMEALDVPEDCKHSNKD-KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKN-DFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPT----VDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSIS 708          
BLAST of Cytohesin-1 vs. Ensembl Fly
Match: step (gene:FBgn0086779 transcript:FBtr0301617)

HSP 1 Score: 171.785 bits (434), Expect = 1.356e-46
Identity = 114/365 (31.23%), Postives = 189/365 (51.78%), Query Frame = 2
Query:  107 SKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL---INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            S  L I+R   K++       K++L +V  +M      +D K  + + K  +I +  FN  PK+GIE+L+ N++++  P+DVA FL + + LNK +IGDYLG+   +FN  VL A+V LHDF +   V  LR FL  F LPGE+QKI  +++ ++  Y + NP +F N D  YVL++A+IMLNT+L+NP+   +       + F+       N       LL ++Y +I+T+P     + GN +   +      G LW Q    + WK+R F+L   CL       + + R  I L N+ V  + + +         +    +I A KT  +    +     +R +  + ++Q+EW+K + Q ++
Sbjct:  357 SDNLVILRRPSKQI-------KDELCEVVSEMEALDVPEDCKHSNKD-KQMSIGRKKFNMDPKKGIEYLVENRLLRHDPQDVAHFLYKGEGLNKTAIGDYLGEKN-DFNEDVLKAFVALHDFTNLILVQALRQFLWSFRLPGEAQKIDRMMETFAQRYCQLNPDIFTNTDTCYVLSFAIIMLNTSLHNPSVKDKPT----VDQFISMNRGINNGGDLPRGLLESLYESIRTEPFKIPQDDGNDLMHTFFNPDKEGWLWKQGGRYKSWKRRWFILNDNCLYYFEYTTDKEPRGIIPLENISVREIHDRSKPHCFELFATGGADIIKACKTDSEGKVVEGKHTVYRMSAATEEDQQEWIKRLTQSIS 708          
BLAST of Cytohesin-1 vs. Ensembl Fly
Match: Sec71 (gene:FBgn0028538 transcript:FBtr0080537)

HSP 1 Score: 118.242 bits (295), Expect = 4.853e-28
Identity = 58/134 (43.28%), Postives = 91/134 (67.91%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPK--MFNNADEPYVLAYAVIMLNTTLNNP 670
            FN KP++G++FL   Q++  T  D+A++L E + L+K  IG+Y+G+   + +++V+ AY+   DFR  E V  LR  L GF LPGE+QKI  +++ ++  Y ECNPK  +F +AD  YVLA+++IML T L++P
Sbjct:  593 FNRKPQKGVQFLQEKQLLGATCGDIARWLHEDERLDKTVIGNYIGE-NDDHSKEVMCAYIDAFDFRQMEVVAALRFLLEGFRLPGEAQKIDRLMEKFASRYCECNPKNQLFQSADTVYVLAFSIIMLTTDLHSP 725          
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Match: cyth1b (cytohesin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4311])

HSP 1 Score: 199.134 bits (505), Expect = 5.084e-59
Identity = 125/367 (34.06%), Postives = 207/367 (56.40%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ KV +++   G  Q+ +I     K   + +  FN  PK+GI+FLI N+++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +      E          +     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  +++E+++W+K+IK  +++
Sbjct:   18 EKQELENIRRRKQELLEDIQRLKDEITKVTNEIECLGSTQE-RINMQRSKQMAMGRKKFNMDPKKGIQFLIENELLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKP---SAERFICMNRGINDGGDLPEDLLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTTEEKEDWIKSIKSAISR 379          
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Match: cyth1b (cytohesin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4311])

HSP 1 Score: 199.134 bits (505), Expect = 5.295e-59
Identity = 125/367 (34.06%), Postives = 207/367 (56.40%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ KV +++   G  Q+ +I     K   + +  FN  PK+GI+FLI N+++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +      E          +     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  +++E+++W+K+IK  +++
Sbjct:   15 EKQELENIRRRKQELLEDIQRLKDEITKVTNEIECLGSTQE-RINMQRSKQMAMGRKKFNMDPKKGIQFLIENELLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKP---SAERFICMNRGINDGGDLPEDLLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTTEEKEDWIKSIKSAISR 376          
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Match: cyth1a (cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657])

HSP 1 Score: 196.052 bits (497), Expect = 7.323e-58
Identity = 122/371 (32.88%), Postives = 206/371 (55.53%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + K+LE IR  +++L+ +I+ LK+++ +V  ++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   +FN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +     F L +    + VI A KT  D    + N   +R +  +++E+ EW+ +IK  +++
Sbjct:   18 EQKELENIRRRKQELLDDIQRLKDEIAEVTSEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTSEDIARFLYKGEGLNKTAIGDYLGERD-DFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYILSFAIIMLNTSLHNPNV--------KDKPTVERFISMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTTEEKDEWMNSIKAAISR 378          
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Match: cyth1a (cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657])

HSP 1 Score: 191.045 bits (484), Expect = 6.693e-56
Identity = 124/361 (34.35%), Postives = 198/361 (54.85%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++     + + K      K   + +  FN  PK+GI+FL+ N ++++TPED+A+FL + + LNK  IGDYLG+   EFN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       +     E+LLRN+Y +IK++P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V E    + F L   +    VI A KT  D    + N   +R +  + +E++EW+K+IK  +++
Sbjct:   24 IRRRKKELLDDIERLKFEIAEVMTEIEQLTCVGESKTTQRN-KQIAMGRKKFNMDPKKGIQFLLENDLLQQTPEDIAQFLYKGEGLNKTVIGDYLGERD-EFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDK----PAVERFISMNRGINDGGDLPEELLRNLYESIKSEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTPEEKEEWIKSIKASISR 378          
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Match: cyth1a (cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657])

HSP 1 Score: 191.045 bits (484), Expect = 6.693e-56
Identity = 124/361 (34.35%), Postives = 198/361 (54.85%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++     + + K      K   + +  FN  PK+GI+FL+ N ++++TPED+A+FL + + LNK  IGDYLG+   EFN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       +     E+LLRN+Y +IK++P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V E    + F L   +    VI A KT  D    + N   +R +  + +E++EW+K+IK  +++
Sbjct:   24 IRRRKKELLDDIERLKFEIAEVMTEIEQLTCVGESKTTQRN-KQIAMGRKKFNMDPKKGIQFLLENDLLQQTPEDIAQFLYKGEGLNKTVIGDYLGERD-EFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDK----PAVERFISMNRGINDGGDLPEELLRNLYESIKSEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTPEEKEEWIKSIKASISR 378          
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Match: cyth2 (cytohesin 2 [Source:NCBI gene;Acc:448569])

HSP 1 Score: 193.356 bits (490), Expect = 9.648e-57
Identity = 122/368 (33.15%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L+ I+  +++L+ +I+ LKE++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T E++A+FL + + LNK +IGDYLG+   + N +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN   +       E F+       N     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  S +E+ EW+K I+  +++
Sbjct:   11 EQQELKNIQRRKQELLADIQRLKEEIAEVTNEIENLGSTEERKNLQKS-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCENIAQFLYKGEGLNKTAIGDYLGERD-DLNIRVLHAFVELHEFMDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFESTDTCYILSFAIIMLNTSLHNPNVKDK----PSVERFIAMNRGINNGGDLSEDLLRNLYDSIKHEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKMNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAASCEEKDEWMKCIRAAISR 372          
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Match: cyth2 (cytohesin 2 [Source:NCBI gene;Acc:448569])

HSP 1 Score: 192.971 bits (489), Expect = 1.348e-56
Identity = 122/368 (33.15%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L+ I+  +++L+ +I+ LKE++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T E++A+FL + + LNK +IGDYLG+   + N +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN   +       E F+       N     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  S +E+ EW+K I+  +++
Sbjct:   13 EQQELKNIQRRKQELLADIQRLKEEIAEVTNEIENLGSTEERKNLQKS-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCENIAQFLYKGEGLNKTAIGDYLGERD-DLNIRVLHAFVELHEFMDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFESTDTCYILSFAIIMLNTSLHNPNVKDK----PSVERFIAMNRGINNGGDLSEDLLRNLYDSIKHEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKMNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAASCEEKDEWMKCIRAAISR 374          
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Match: cyth2 (cytohesin 2 [Source:NCBI gene;Acc:448569])

HSP 1 Score: 192.971 bits (489), Expect = 1.426e-56
Identity = 122/368 (33.15%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L+ I+  +++L+ +I+ LKE++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T E++A+FL + + LNK +IGDYLG+   + N +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN   +       E F+       N     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  S +E+ EW+K I+  +++
Sbjct:   14 EQQELKNIQRRKQELLADIQRLKEEIAEVTNEIENLGSTEERKNLQKS-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCENIAQFLYKGEGLNKTAIGDYLGERD-DLNIRVLHAFVELHEFMDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFESTDTCYILSFAIIMLNTSLHNPNVKDK----PSVERFIAMNRGINNGGDLSEDLLRNLYDSIKHEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKMNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAASCEEKDEWMKCIRAAISR 375          
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Match: cyth2 (cytohesin 2 [Source:NCBI gene;Acc:448569])

HSP 1 Score: 193.356 bits (490), Expect = 1.493e-56
Identity = 122/368 (33.15%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L+ I+  +++L+ +I+ LKE++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T E++A+FL + + LNK +IGDYLG+   + N +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN   +       E F+       N     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  S +E+ EW+K I+  +++
Sbjct:   24 EQQELKNIQRRKQELLADIQRLKEEIAEVTNEIENLGSTEERKNLQKS-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCENIAQFLYKGEGLNKTAIGDYLGERD-DLNIRVLHAFVELHEFMDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFESTDTCYILSFAIIMLNTSLHNPNVKDK----PSVERFIAMNRGINNGGDLSEDLLRNLYDSIKHEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKMNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAASCEEKDEWMKCIRAAISR 385          
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Match: cyth2 (cytohesin 2 [Source:NCBI gene;Acc:448569])

HSP 1 Score: 192.971 bits (489), Expect = 1.547e-56
Identity = 122/368 (33.15%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L+ I+  +++L+ +I+ LKE++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T E++A+FL + + LNK +IGDYLG+   + N +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  Y+L++A+IMLNT+L+NPN   +       E F+       N     EDLLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  S +E+ EW+K I+  +++
Sbjct:   16 EQQELKNIQRRKQELLADIQRLKEEIAEVTNEIENLGSTEERKNLQKS-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCENIAQFLYKGEGLNKTAIGDYLGERD-DLNIRVLHAFVELHEFMDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFESTDTCYILSFAIIMLNTSLHNPNVKDK----PSVERFIAMNRGINNGGDLSEDLLRNLYDSIKHEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKMNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAASCEEKDEWMKCIRAAISR 377          
BLAST of Cytohesin-1 vs. Ensembl Mouse
Match: Cyth1 (cytohesin 1 [Source:MGI Symbol;Acc:MGI:1334257])

HSP 1 Score: 189.504 bits (480), Expect = 2.407e-55
Identity = 121/372 (32.53%), Postives = 208/372 (55.91%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LKE++ +V +++ + G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EF+ +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E+++W+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEDWIKCIKAAISR 377          
BLAST of Cytohesin-1 vs. Ensembl Mouse
Match: Cyth3 (cytohesin 3 [Source:MGI Symbol;Acc:MGI:1335107])

HSP 1 Score: 188.734 bits (478), Expect = 6.178e-55
Identity = 128/362 (35.36%), Postives = 198/362 (54.70%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY--ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++ N   +++ K      K   + +  FN  PK+GI+FLI N +++ +PEDVA+FL + + LNK  IGDYLG+   +FN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++A+IMLNT+L+N N   +       E F+ TM     E     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L   S    VI A KT  D    + N   +R +  S +E++EW+K+IK  +++
Sbjct:   27 IRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRN-KQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERD-DFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPT----AERFI-TMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISR 381          
BLAST of Cytohesin-1 vs. Ensembl Mouse
Match: Cyth2 (cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255])

HSP 1 Score: 187.963 bits (476), Expect = 6.772e-55
Identity = 121/363 (33.33%), Postives = 197/363 (54.27%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            +LE IR  +++L+VEI+ L+E+L +   ++      +  K +    K   + +  FN  PK+GI+FL+ +++++ TPE++A+FL + + LNK +IGDYLG+   E N  VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN   +    G E          E     EDLLRN+Y +I+ +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L + +    +I A KT  D    + N   +R +  + +E+ EW+K+I+  ++
Sbjct:    2 ELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKM-AMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGE-REELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKP---GLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVS 359          
BLAST of Cytohesin-1 vs. Ensembl Mouse
Match: Cyth2 (cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255])

HSP 1 Score: 187.963 bits (476), Expect = 9.607e-55
Identity = 121/363 (33.33%), Postives = 197/363 (54.27%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            +LE IR  +++L+VEI+ L+E+L +   ++      +  K +    K   + +  FN  PK+GI+FL+ +++++ TPE++A+FL + + LNK +IGDYLG+   E N  VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN   +    G E          E     EDLLRN+Y +I+ +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L + +    +I A KT  D    + N   +R +  + +E+ EW+K+I+  ++
Sbjct:   18 ELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKM-AMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGE-REELNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKP---GLERFVAMNRGINEGGDLPEDLLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVS 375          
BLAST of Cytohesin-1 vs. Ensembl Mouse
Match: Cyth1 (cytohesin 1 [Source:MGI Symbol;Acc:MGI:1334257])

HSP 1 Score: 186.422 bits (472), Expect = 3.639e-54
Identity = 118/373 (31.64%), Postives = 209/373 (56.03%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LKE++ +V +++ + G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EF+ +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E+++W+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEDWIKCIKAAISR 378          
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Match: sp|Q15438|CYH1_HUMAN (Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.012e-54
Identity = 120/373 (32.17%), Postives = 209/373 (56.03%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E++EW+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISR 378          
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Match: sp|Q76MZ1|CYH1_CHLAE (Cytohesin-1 OS=Chlorocebus aethiops OX=9534 GN=CYTH1 PE=2 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 3.012e-54
Identity = 120/373 (32.17%), Postives = 209/373 (56.03%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F + D  YVL++A+IMLNT+L+NPN         K++  ++  +       +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E++EW+K IK  +++
Sbjct:   16 ERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNV--------KDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISR 378          
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Match: sp|O08967|CYH3_MOUSE (Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 4.321e-54
Identity = 128/362 (35.36%), Postives = 198/362 (54.70%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY--ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++ N   +++ K      K   + +  FN  PK+GI+FLI N +++ +PEDVA+FL + + LNK  IGDYLG+   +FN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++A+IMLNT+L+N N   +       E F+ TM     E     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L   S    VI A KT  D    + N   +R +  S +E++EW+K+IK  +++
Sbjct:   27 IRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRN-KQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERD-DFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPT----AERFI-TMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISR 381          
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Match: sp|Q76MY7|CYH2_CHLAE (Cytohesin-2 OS=Chlorocebus aethiops OX=9534 GN=CYTH2 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.013e-53
Identity = 121/363 (33.33%), Postives = 197/363 (54.27%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLN 1186
            +LE IR  +++L+VEI+ L+E+L +   ++      +  K +    K   + +  FN  PK+GI+FL+ N++++ TPE++A+FL + + LNK +IGDYLG+   E N  VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN   +    G E          E     E+LLRN+Y +I+ +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L + +    +I A KT  D    + N   +R +  + +E+ EW+K+I+  ++
Sbjct:   18 ELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKM-AMGRKKFNMDPKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGE-REELNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKP---GLERFVAMNRGINEGGDLPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAVS 375          
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Match: sp|O43739|CYH3_HUMAN (Cytohesin-3 OS=Homo sapiens OX=9606 GN=CYTH3 PE=1 SV=2)

HSP 1 Score: 186.808 bits (473), Expect = 1.810e-53
Identity = 124/362 (34.25%), Postives = 197/362 (54.42%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++ N   +++ K      K   + +  FN  PK+GI+FLI N +++ +PEDVA+FL + + LNK  IGDYLG+   EFN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++A+IMLNT+L+N N   +       E F+       E     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L   S    VI A KT  D    + N   +R +  S +E++EW+K+IK  +++
Sbjct:   27 IRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRN-KQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERD-EFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPT----AERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISR 382          
BLAST of Cytohesin-1 vs. TrEMBL
Match: A0A4Z2DPZ7 (Cytohesin-1 OS=Schistosoma japonicum OX=6182 GN=EWB00_010173 PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 9.100e-69
Identity = 134/376 (35.64%), Postives = 221/376 (58.78%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL--QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNK---MNGELWYQSNNLRVWKKRTFVLLPECLL-ILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINENLET 1210
            + ++L+ IR  + ++M  IESLK +L  + + + N GF  DG+  D  ++   +    FNN PK+G+E+L    II  +P++VAKF   Q  +L+K +IG Y+G++  EFN +VLDA+ +LH+F+ +EF+  LR FL  F LPGESQKI  I+ ++S+ Y E NP +FN+  E YVL+YAVI+LNTTL+N NA S ++   +E+ F++TM+E+ E  +  EDL+R +YH IK +PL    + ++    T       G LW     ++ WK+R F+L  + LL  LT D + Q +  I L  + + R+     +++   L+   N ++ + K  RD       +  +R A  +  E+ EW++ +++  +++ E   T
Sbjct:   10 EKERLQFIRQQKTQVMKNIESLKLELSDITNQIENLGFSVDGE--DSSVRRLALGCKKFNNNPKQGLEYLFDQNIIGRSPDEVAKFFIDQNDNLSKHAIGTYIGEVRKEFNMQVLDAFAKLHNFKDEEFLPALRQFLFSFQLPGESQKIDRILTSFSERYVEQNPTVFNSPHEAYVLSYAVILLNTTLHNSNAKSHSLGLAEEKTFVRTMVEFDEETNLSEDLIRKIYHAIKNEPLRAVSDDLSVCGSTQNNAVHKGWLWKLGGRVKSWKRRWFILTEDSLLYYLTPDRSRQTKGTIHLEGINI-RLIHDKTKEYCFELYCPRNQLVKSCKIERDFSAGHHTV--YRMAAPTLIERDEWIRMLERVTHRLAERRGT 380          
BLAST of Cytohesin-1 vs. TrEMBL
Match: A0A0V0JC29 (Cytohesin-3 OS=Schistocephalus solidus OX=70667 GN=CYH3 PE=4 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.359e-68
Identity = 132/359 (36.77%), Postives = 211/359 (58.77%), Query Frame = 2
Query:  107 SKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL--QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYE-NYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIK 1174
            +K+LE IR  R++ +  I  LK +L  V   + + G   D +I+D  L   ++ +  FNN PK G+EF+  N+I++ +P  VA+F   ++  L+K +IG YLG+I+ +FN +VLD +++LHDF   EF+  LR FL  F LPGESQKI  I+ ++   Y   NP +F  + E YV+AYA I+LNTTL+N NA +Q      E+ F++TMLE++ + +  ED+++ V+H IK+ PL     +V E    + ++G LW    +++ W++R FVL  + LL  T     Q +  IAL NV V R  + + RD+   L SR +  I   K+ R+ V        +R A  S++E ++W+ +++
Sbjct:   11 TKQLECIRREREETVKRINLLKAELWDVTKQLEDAGVCPDSEILDMRL---SLGRKKFNNNPKTGLEFMFENEILERSPFAVAQFFHNEKLGLSKAAIGAYLGEISKDFNMQVLDEFLKLHDFDGLEFLPALRQFLLSFQLPGESQKIDRILASFGQQYVLQNPTVFRTSHEAYVMAYAAILLNTTLHNCNAKNQTNALADEKTFVRTMLEFDKDTNLSEDIIKKVFHGIKSKPL----QVVEEAPELSILSGWLWKLGGHMKSWQRRWFVLTEDKLLYYTAPERTQRKGIIALENVSVRRTSDRS-RDYCFELFSRRDSGIDTRKSDREGVVSVGYHTTYRMAAGSAEEYEQWVSSLQ 361          
BLAST of Cytohesin-1 vs. TrEMBL
Match: A0A158QH86 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS1722 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 4.813e-68
Identity = 139/387 (35.92%), Postives = 215/387 (55.56%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL--QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYE-NYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLIL-TNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSR---TNGVISAT-------------------KTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKIN 1195
            +LE IRN R + +  I+ LK + ++V   +   G   +G++       RN+ K  F++ PK G+EFL  NQII+  P  VA+F   ++ +L+K +IG YLG+I+ EFN +VLD Y++LH+F  ++F+  LR FL  F LPGESQKI +I+++++  Y E NP  F+ + E YVLAYA I+LNTTL+N NA SQN     E+ F++TML+Y+ +    E+++R+VYH IK+ P+     +  E    + M G LW     ++ WK+R FVL  E L      D   Q +  +AL NV V RV    +R+F   L+ R   TNG  +A                    K  R+ +        +R A  +S+E ++W+ +++   N+  
Sbjct:   13 RLETIRNQRLETIKNIQRLKSEYEQVTRLLEEAGVSPEGELD----ARRNLGKRKFSSNPKMGLEFLFENQIIERNPVSVARFFVDEKKNLSKAAIGTYLGEISKEFNMQVLDEYLKLHNFGGQDFLPALRTFLFNFQLPGESQKIDKILQSFAHEYVEQNPSAFHTSQEAYVLAYAAILLNTTLHNTNAKSQNFRLADEKTFVETMLDYDKDTHLSEEIIRSVYHGIKSKPI----QLAEECTEASNMRGWLWKLGGRVKTWKRRWFVLTDEFLFYYNAPDRITQRKGIVALENVCVRRVTNDRSREFCFELYPRFSLTNGTANANGVNGSAGGNGGIGGTINTRKADREGIISTDYHTTYRMAAANSEEYEKWMTSLQLITNRFG 391          
BLAST of Cytohesin-1 vs. TrEMBL
Match: A0A4E0RBH9 (Cytohesin-2 OS=Fasciola hepatica OX=6192 GN=D915_005803 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.110e-67
Identity = 137/383 (35.77%), Postives = 222/383 (57.96%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKF-LQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL-------INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLL-ILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNV------EEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINEN 1201
            + ++L+ I   + ++M  IESLK +L  + + + N GF  D +  DP+++ R I    FN   K+G+++L  N++++ TPE VA+F ++E D L+K ++G +LG++  EFN +VLDA+  LH+FR ++F+  LR FL  F LPGESQKI  I+ ++++ Y   NP +F +  E YVLAYAVI+LNTTL+N NA  QN     E+ F++TML+Y++ +   EDL+R VYH IK +P+       +N  N  N +     M G L      ++ WK+R FVL  + L+  LT D +   +  I L  + + R+ +   +D    L+S  N +I A+K  R+         E  +   +R A  SS E+  W++ ++   ++I E+
Sbjct:   10 EKERLKYITQQKLQVMKHIESLKIELHDITNQIENLGFPLDCE--DPQMRRRIIGCKEFNADTKQGLDYLFENKVVERTPEAVARFFIEEKDRLSKFAVGTFLGEVRKEFNMQVLDAFTNLHNFRDQDFLQALRRFLLSFQLPGESQKIDRILTSFAERYVSHNPAIFKSPHEAYVLAYAVILLNTTLHNANAKGQNFGLADEKTFVRTMLDYDDQTELSEDLVRRVYHEIKAEPIRPASDDGLNGSNQSNAI-----MRGWLMKLGGRVKSWKRRWFVLTEDSLIYYLTPDRSRHCKGVIPLEGLNI-RITQDRTKDHTFELYSSRNELIKASKADREGTTTPVPHREPGHHTVYRLAAPSSAERDNWIRMLESITHRIAEH 384          
BLAST of Cytohesin-1 vs. TrEMBL
Match: A0A504Z1H1 (Cytohesin-2 OS=Fasciola gigantica OX=46835 GN=FGIG_06597 PE=4 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 2.413e-67
Identity = 137/383 (35.77%), Postives = 221/383 (57.70%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKF-LQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS-FQEDLLRNVYHTIKTDPL-------INFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLL-ILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNV------EEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINEN 1201
            + ++L+ I   + ++M  IESLK +L  + + + N GF  D +  DP+++ R I    FN   K+G+++L  N++++ TPE VA+F ++E D L+K ++G +LG++  EFN +VLDA+  LH+FR ++F+  LR FL  F LPGESQKI  I+ ++++ Y   NP +F +  E YVLAYAVI+LNTTL+N NA  QN     E+ F++TML+Y++ +   EDL+R VYH IK +P+        N  N  N +     M G L      ++ WK+R FVL  + L+  LT D +   +  I L  + + R+ +   +D    L+S  N +I A+K  R+         E  +   +R A  SS E+  W++ ++   ++I E+
Sbjct:   10 EKERLKYITQQKLQVMKHIESLKIELHDITNQIENLGFPLDCE--DPQMRRRIIGCKEFNADTKQGLDYLFENKVVERTPEAVARFFIEEKDRLSKFAVGTFLGEVRKEFNMQVLDAFTNLHNFRDQDFLQALRRFLLSFQLPGESQKIDRILTSFAERYVSHNPAIFKSPHEAYVLAYAVILLNTTLHNANAKGQNFGLADEKTFVRTMLDYDDQTELSEDLVRRVYHEIKAEPIRPASDDGFNGSNQSNAI-----MRGWLMKLGGRVKSWKRRWFVLTEDSLIYYLTPDRSRHCKGVIPLEGLNI-RITQDRTKDHTFELYSSRNELIKASKADREGTTTPVPHREPGHHTVYRLAAPSSAERDNWIRMLESITHRIAEH 384          
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Match: cyth1b (cytohesin-1 [Source:NCBI gene;Acc:103022618])

HSP 1 Score: 190.66 bits (483), Expect = 7.862e-56
Identity = 124/368 (33.70%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       +     EDLL N+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E+ EW+ +IK  +++
Sbjct:   15 EKQELENIRRRKQELLEDIKRLKDEIAEVTNEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTWEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIEVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDK----PSAERFIAMNRGINDGGDLPEDLLLNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTVEEKDEWINSIKAAISR 376          
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Match: cyth1b (cytohesin-1 [Source:NCBI gene;Acc:103022618])

HSP 1 Score: 190.66 bits (483), Expect = 9.301e-56
Identity = 124/368 (33.70%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       +     EDLL N+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E+ EW+ +IK  +++
Sbjct:   18 EKQELENIRRRKQELLEDIKRLKDEIAEVTNEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTWEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIEVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDK----PSAERFIAMNRGINDGGDLPEDLLLNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTVEEKDEWINSIKAAISR 379          
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 189.889 bits (481), Expect = 1.070e-55
Identity = 121/363 (33.33%), Postives = 197/363 (54.27%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIK 1174
            +  +LE IR  +  L++EI+ L+E+L++   ++       +G     + ++  + +  FN  PK+GI FL+ N++++ TPED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       E     E+LLRN+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L + +    +I A KT  D    + N   +R +  + +E+ EW+ +IK
Sbjct:   31 ERSELEEIRRRKGALLLEIQRLREELREAIIEVEGLESSTEGSKTLQKSRHVAMGRKKFNMDPKKGIVFLVENELLRHTPEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIRVLQAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDKPT----VERFISMNRGINEGGDLPEELLRNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYIPNNRGQLIKACKTEADGRVVEGNHMVYRISAPTPEEKDEWIHSIK 388          
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Match: cyth1b (cytohesin-1 [Source:NCBI gene;Acc:103022618])

HSP 1 Score: 190.274 bits (482), Expect = 1.522e-55
Identity = 124/368 (33.70%), Postives = 205/368 (55.71%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++ +V +++ N G  ++ K +    K   + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   EFN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       +     EDLL N+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L +    + VI A KT  D    + N   +R +  + +E+ EW+ +IK  +++
Sbjct:   35 EKQELENIRRRKQELLEDIKRLKDEIAEVTNEIENLGSTEERKNMQRN-KQVAMGRKKFNMDPKKGIQFLIENDLLKNTWEDIAQFLYKGEGLNKTAIGDYLGERD-EFNIEVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDK----PSAERFIAMNRGINDGGDLPEDLLLNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPDNKDQVIKACKTEADGRVVEGNHTFYRISAPTVEEKDEWINSIKAAISR 396          
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Match: cyth3a (cytohesin 3 [Source:NCBI gene;Acc:103025488])

HSP 1 Score: 186.037 bits (471), Expect = 3.828e-54
Identity = 121/361 (33.52%), Postives = 197/361 (54.57%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            IR  +K+L+ +IE LK ++ +V  ++     + + K      K   I +  FN  PK+GI+FL+ N +++ TP+D+A+FL + + LNK  IGDYLG+   +FN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F ++D  Y+L++++IMLNT+L+NPN   +       + F+       E     E+LL+N+Y +IK +P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V E    + F L   S    VI A KT  D    + N   +R +  + +E++EW+K+IK  +++
Sbjct:   22 IRRRKKELLDDIERLKFEIAEVMTEIEQLTCMGECKTSQRN-KQVAIGRKKFNMDPKKGIQFLLDNDLLQHTPDDIAQFLYKGEGLNKTVIGDYLGERD-DFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQSSDTCYILSFSIIMLNTSLHNPNVRDK----PSADRFISMNRGINEGGDLPEELLKNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEEPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPTPEEKEEWIKSIKASISR 376          
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Match: si:dkey-283b15.4 (cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502])

HSP 1 Score: 186.808 bits (473), Expect = 6.300e-55
Identity = 126/374 (33.69%), Postives = 208/374 (55.61%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNN-----ADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDN-VEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++L  IR  +++L+V+I+ LK+++  V  ++ +    ++ KIV    K  ++ +  FN  PK+GI FL  N+++K TPED+A+FL + + LNK +IG+YLG+   +FN +VL A+V LH+F +   V  LR FL  F LPGE+QKI  +++A++  Y +CN  +F +      D  YVL++A+IMLNT+L+NPN   +      E   L      +     E+LLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V +    + F L L +   GVI A KT  D  V E K+M  +R +  S +E+ EW+K IK  ++K
Sbjct:   18 EQEELASIRRRKQELVVDIQRLKDEISDVMTEIASLDNAEESKIVQRN-KQMSMGRKKFNMDPKKGIRFLTENELLKNTPEDIAQFLYKGEGLNKTAIGEYLGERD-DFNIQVLHAFVELHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCQCNAGVFQSTGGVATDTCYVLSFAIIMLNTSLHNPNVRDKPT---TERFILMNRGINDGGDLPEELLRNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLVGGKVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDDPKKPNSFELFLPNNKGGVIKACKTDTDGRVVEGKHMV-YRISAPSPEEKDEWIKCIKASISK 385          
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004124.1 (pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004124.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 6.753e-28
Identity = 61/133 (45.86%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFLQ-EPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECN--PKMFNNADEPYVLAYAVIMLNTTLNN 667
            FN KPKRGI+FL    ++  T EDVA+FL  E  L+   +GDYLG+   + N++ +  YV   DF  K+FV  LR+FL GF LPGE+QKI  +++ ++  + ECN    +F +AD  YVLAY++IML T L++
Sbjct:  154 FNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGE-NDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHS 285          
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004144.1 (pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 7.608e-28
Identity = 61/133 (45.86%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFLQ-EPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECN--PKMFNNADEPYVLAYAVIMLNTTLNN 667
            FN KPKRGI+FL    ++  T EDVA+FL  E  L+   +GDYLG+   + N++ +  YV   DF  K+FV  LR+FL GF LPGE+QKI  +++ ++  + ECN    +F +AD  YVLAY++IML T L++
Sbjct:  501 FNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGE-NDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHS 632          
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004134.1 (pep scaffold:Pmarinus_7.0:GL477097:5536:63408:-1 gene:ENSPMAG00000003754.1 transcript:ENSPMAT00000004134.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.546 bits (288), Expect = 9.995e-28
Identity = 61/133 (45.86%), Postives = 87/133 (65.41%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFLQ-EPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECN--PKMFNNADEPYVLAYAVIMLNTTLNN 667
            FN KPKRGI+FL    ++  T EDVA+FL  E  L+   +GDYLG+   + N++ +  YV   DF  K+FV  LR+FL GF LPGE+QKI  +++ ++  + ECN    +F +AD  YVLAY++IML T L++
Sbjct:  548 FNKKPKRGIQFLQEQNMLGTTTEDVAQFLHSENRLDSTQVGDYLGE-NDKLNKETMYTYVDQMDFSGKDFVSALRLFLEGFRLPGEAQKIDRLMEKFAARFCECNQGQTVFASADTAYVLAYSIIMLTTDLHS 679          
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Match: gbf1 (golgi brefeldin A resistant guanine nucleotide exchange factor 1 [Source:ZFIN;Acc:ZDB-GENE-081107-54])

HSP 1 Score: 106.686 bits (265), Expect = 8.542e-25
Identity = 67/182 (36.81%), Postives = 108/182 (59.34%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPED---VAKFLQE-PDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYS--FQEDLLRNVYHTIKTDPLI 805
            FN KPK GIEFL  N+++  TP D   VA++L++ P L+K+ IG+++ D     ++++L A+V+   F      + LR++L  F L GE+  I  +++A++D ++  N   F N D  + LAYAVIMLNT  +N N   QN+    EE   K  L+  N S  F++D+L  +Y+ I+ D ++
Sbjct:  659 FNVKPKTGIEFLQENKLLA-TPMDCTEVARWLRDNPRLDKKMIGEFVSD---RKHKELLSAFVKTFTFETLRIDESLRLYLEAFRLSGEAPVIHRLLEAFTDQWHVMNGSPFVNNDACFALAYAVIMLNTDQHNHNVRKQNVPMTLEE--FKKNLKGVNGSKDFEQDMLEEIYNAIRNDEIV 834          
BLAST of Cytohesin-1 vs. Ensembl Yeast
Match: SEC7 (Guanine nucleotide exchange factor (GEF) for ADP ribosylation factors; involved in proliferation of the Golgi, intra-Golgi transport and ER-to-Golgi transport; found in the cytoplasm and on Golgi-associated coated vesicles [Source:SGD;Acc:S000002577])

HSP 1 Score: 100.523 bits (249), Expect = 4.855e-23
Identity = 59/146 (40.41%), Postives = 88/146 (60.27%), Query Frame = 2
Query:  248 LKYRNIAKTH----FNNKPKRGIEFLITNQIIKE-TPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNN 667
            LK R  A +     FNNKPK+ I  LI    +K+ +P  +AK+L E + L+  ++GDYLG+   + N  ++ A+V   DF     VD LR FL  F LPGE QKI   +  +++ + + NP +F+ AD  YVL+Y++IMLNT L++
Sbjct:  824 LKLRKTALSECIAIFNNKPKKAIPVLIKKGFLKDDSPISIAKWLLETEGLDMAAVGDYLGE-GDDKNIAIMHAFVDEFDFTGMSIVDALRSFLQSFRLPGEGQKIDRFMLKFAERFVDQNPGVFSKADTAYVLSYSLIMLNTDLHS 968          
BLAST of Cytohesin-1 vs. Ensembl Yeast
Match: GEA2 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA2 has a paralog, GEA1, that arose from the whole genome duplication [Source:SGD;Acc:S000000748])

HSP 1 Score: 85.1149 bits (209), Expect = 5.082e-18
Identity = 67/222 (30.18%), Postives = 110/222 (49.55%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQII-KETPEDVAKFL--QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYE---CNPKMFN------------NADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQS--NNL 883
            FN KPK+GI  LI    I  ++ +D+A+FL      +NK++IG  L          +L+ Y+RL DF      + +R+ L+ F LPGESQ+I  II+A+S  Y E    +P   +            +AD  ++L+Y++IMLNT L+NP  + +++ F      LK    ++++ F    L  +Y +I+   ++          P      E W++   NNL
Sbjct:  570 FNEKPKKGIPMLIEKGFIASDSDKDIAEFLFNNNNRMNKKTIGLLLCHPD---KVSLLNEYIRLFDFSGLRVDEAIRILLTKFRLPGESQQIERIIEAFSSAYCENQDYDPSKISDNAEDDISTVQPDADSVFILSYSIIMLNTDLHNPQ-VKEHMSFEDYSGNLKGCCNHKDFPFW--YLDRIYCSIRDKEIV---------MPEEHHGNEKWFEDAWNNL 776          
BLAST of Cytohesin-1 vs. Ensembl Yeast
Match: GEA1 (Guanine nucleotide exchange factor for ADP ribosylation factors (ARFs); involved in vesicular transport between the Golgi and ER, Golgi organization, and actin cytoskeleton organization; GEA1 has a paralog, GEA2, that arose from the whole genome duplication [Source:SGD;Acc:S000003792])

HSP 1 Score: 70.0922 bits (170), Expect = 2.898e-13
Identity = 66/232 (28.45%), Postives = 103/232 (44.40%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQII-KETPEDVAKFL--QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYY--ECNPK-----------------------MFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQS--NNL 883
            FN K K+GI+ LI    I  ++  D+A FL      LNK++IG  L D        +L  ++ L DF+     + +R+ L+ F LPGESQ+I  I++A+S  Y   + N K                       +  +AD  +VL+Y++IMLNT  +NP  +  ++ F      L+    Y    F    L  +Y +IK   ++          P      E W++   NNL
Sbjct:  552 FNEKAKKGIQMLIEKGFIDSDSNRDIASFLFLNNGRLNKKTIGLLLCDPK---KTSLLKEFIDLFDFKGLRVDEAIRILLTKFRLPGESQQIERIVEAFSSKYSADQSNDKVELEDKKAGKNGSESMTEDDIIHVQPDADSVFVLSYSIIMLNTDSHNPQ-VKDHMTFDDYSNNLRGC--YNGKDFPRWYLHKIYTSIKVKEIV---------MPEEHHGNERWFEDAWNNL 768          
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Match: EDO38004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA8])

HSP 1 Score: 172.94 bits (437), Expect = 1.351e-49
Identity = 116/368 (31.52%), Postives = 199/368 (54.08%), Query Frame = 2
Query:  125 IRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRN----VYHTIKTD----PLINFGNIVNELYPTNKMNGELWYQSNNL---RVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTN--GVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCL 1183
            IR  +  L+ EI+ LK ++ +V  ++ +    QD    DP++K + I K  F+  P++GI++L+ + ++  TPED+A FL +E  LNK  IG+YLG+   EFN  V   +V LH F+    V  LR FL  F LPGE+QKI  +++A++  Y   NP +F + D  YVL++A+I+LNT+L+NPN         K++  ++  ++     +  EDL R+    +Y +IK++    P  +  +I +  +  ++  G+L  +  +    + W+KR F+L   CL    N  + + R  I L N+QV R      R +   ++S  N  G+I A KT  +    + +   +R   +S +E++ W++ IK  +
Sbjct:   18 IRQKKSNLLQEIQQLKAEISEVTSELESLDH-QDVTGEDPKMKQKQIGKKKFSMDPQKGIDYLVMHGLLNNTPEDLADFLLKEEGLNKTQIGNYLGE-NKEFNLDVFAKFVDLHKFKDMILVQALRQFLWSFRLPGEAQKIDRMMEAFAQKYCADNPGLFTSTDTCYVLSFAIILLNTSLHNPNV--------KDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSIKSEEFKIPEDDGSDITHTFFNPDR-EGQLIKEGTSCGLHKSWRKRYFILKDNCLYYFKNAGDREPRGIIPLENLQV-REANDAKRKYCFEIYSSENSTGLIKACKTDSEGKVVEGHHDVYRICASSEEERQTWIQCIKASM 373          
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Match: EDO31538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXN1])

HSP 1 Score: 125.176 bits (313), Expect = 1.159e-30
Identity = 65/140 (46.43%), Postives = 93/140 (66.43%), Query Frame = 2
Query:  275 HFNNKPKRGIEFLITNQIIKE--TPEDVAKFLQE-PDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQ 685
            HFNNKPK+GIEFL  + ++     PE++A+ L+E P L+K++IG+Y+G    + N KVLDA+VR  +F      +GLR FL  F LPGES  I  I++ +S+ ++ECNP+++ N D  + LAYAVIMLN   +N N   Q
Sbjct:  686 HFNNKPKKGIEFLQEHGLLHTPLDPEEMARLLRENPRLDKKTIGEYIGK---KDNSKVLDAFVRSFEFHDLRVDEGLRQFLESFRLPGESPVIEHIMEFFSEVFFECNPEVYANKDAVFTLAYAVIMLNVDQHNANIKQQ 822          
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Match: EDO34882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN35])

HSP 1 Score: 114.775 bits (286), Expect = 9.122e-28
Identity = 57/139 (41.01%), Postives = 90/139 (64.75%), Query Frame = 2
Query:  263 IAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNA-DEPYVLAYAVIMLNTTLNNPN 673
            I    FN KP++G+ +LI +Q+I + PE VAKFL  E  ++K+ +G+YLG++  +FN  VL  +    DF   E    LR FL+ F +PGE+QKI  +++ +++ Y  CNP    +A D+  +LA+A++MLNT L++PN
Sbjct:   38 IGINQFNRKPEKGVTYLIAHQVIDDNPEAVAKFLLSEHGVSKQRLGEYLGNLQNDFNMAVLKCFAESFDFTGMEIDVALRTFLAQFRIPGEAQKIERLMEVFAEQYISCNPTDDTSAQDKVLILAFAIVMLNTDLHSPN 176          
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Match: EDO41902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S350])

HSP 1 Score: 109.768 bits (273), Expect = 1.504e-25
Identity = 61/144 (42.36%), Postives = 94/144 (65.28%), Query Frame = 2
Query:  248 LKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNP--KMFNNADEPYVLAYAVIMLNTTLNNP 670
            L  + IAK  FN  PK+G++FL  N ++  +  +VA+FL   + L+K  IG+ +GD   +F+++V+  YV   DF   EFV  LR+FL+ F LPGE+QKI  +++ ++  Y++ NP   +F +AD  YVLAY++IML T L+NP
Sbjct:  683 LMEQGIAK--FNKNPKKGMKFLQENGLLGMSAGEVAEFLHGDERLDKMQIGELIGD-NDDFSKQVMYEYVDKLDFTDMEFVSSLRLFLTNFRLPGEAQKIDRLMEKFASRYFDTNPNNSVFASADAAYVLAYSIIMLTTDLHNP 823          
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Match: EDO29369 (pep supercontig:ASM20922v1:NEMVEscaffold_1160:24851:31523:-1 gene:NEMVEDRAFT_v1g144802 transcript:EDO29369 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 5.955e-23
Identity = 69/241 (28.63%), Postives = 125/241 (51.87%), Query Frame = 2
Query:  503 FLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRN----VYHTIKTD----PLINFGNIVNELYPTNKMNGELWYQSNNL---RVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTN--GVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCL 1183
            FL  F LPGE+QKI  +++A++  Y   NP +F + D  YVL++A+I+LNT+L+NPN         K++  ++  ++     +  EDL R+    +Y +IK++    P  +  +I +  +  ++  G+L  +  +    + W+KR F+L   CL    N  + + R  I L N+QV R      R +   ++S  N  G+I A KT  +    + +   +R   +S +E++ W++ IK  +
Sbjct:    3 FLWSFRLPGEAQKIDRMMEAFAQKYCADNPGLFTSTDTCYVLSFAIILLNTSLHNPNV--------KDKPTVEKFIQMNRGINCGEDLDRDFLVALYDSIKSEEFKIPEDDGSDITHTFFNPDR-EGQLIKEGTSCGLHKSWRKRYFILKDNCLYYFKNAGDREPRGIIPLENLQV-REANDAKRKYCFEIYSSENSTGLIKACKTDSEGKVVEGHHDVYRICASSEEERQTWIQCIKASM 233          
BLAST of Cytohesin-1 vs. Ensembl Medaka
Match: cyth1b (cytohesin-1 [Source:NCBI gene;Acc:101171613])

HSP 1 Score: 193.741 bits (491), Expect = 6.323e-57
Identity = 121/368 (32.88%), Postives = 208/368 (56.52%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++++V  ++ N G  ++ K +    K   + +  FN    +GI FLI + ++K T ED+AKFL + + LNK +IGDYLG+   +FN KVL A++ LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN +       +  A  + +   +     EDLLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L + +  + VI A KT  D    + N   +R +  +++E++EW+K+IK  ++K
Sbjct:   18 EQQELESIRRRKQELLQDIQRLKDEIEEVTSEIENLGVTEERKSMQ-RSKQMAMGRKKFNMDHTKGIRFLIDSSLLKNTSEDIAKFLYKGEGLNKTAIGDYLGERD-DFNIKVLHAFLELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVFQSTDTCYVLSFAVIMLNTSLHNPN-VKDKPSVQRFTAMNRGI--NDGGDLPEDLLRNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRMKTWKRRWFILTDSCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPNHKDQVIKACKTEADGRVVEGNHTFYRISAPTAEEKEEWIKSIKAAISK 380          
BLAST of Cytohesin-1 vs. Ensembl Medaka
Match: cyth1b (cytohesin-1 [Source:NCBI gene;Acc:101171613])

HSP 1 Score: 193.356 bits (490), Expect = 1.082e-56
Identity = 121/368 (32.88%), Postives = 208/368 (56.52%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+ +I+ LK+++++V  ++ N G  ++ K +    K   + +  FN    +GI FLI + ++K T ED+AKFL + + LNK +IGDYLG+   +FN KVL A++ LH+F     V  LR FL  F LPGE+QKI  +++A++  Y  CNP +F + D  YVL++AVIMLNT+L+NPN +       +  A  + +   +     EDLLRN+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V ++   + F L + +  + VI A KT  D    + N   +R +  +++E++EW+K+IK  ++K
Sbjct:   38 EQQELESIRRRKQELLQDIQRLKDEIEEVTSEIENLGVTEERKSMQ-RSKQMAMGRKKFNMDHTKGIRFLIDSSLLKNTSEDIAKFLYKGEGLNKTAIGDYLGERD-DFNIKVLHAFLELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCHCNPGVFQSTDTCYVLSFAVIMLNTSLHNPN-VKDKPSVQRFTAMNRGI--NDGGDLPEDLLRNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRMKTWKRRWFILTDSCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELFIPNHKDQVIKACKTEADGRVVEGNHTFYRISAPTAEEKEEWIKSIKAAISK 400          
BLAST of Cytohesin-1 vs. Ensembl Medaka
Match: CYTH3 (cytohesin-3 [Source:NCBI gene;Acc:101158948])

HSP 1 Score: 191.43 bits (485), Expect = 3.412e-56
Identity = 126/365 (34.52%), Postives = 200/365 (54.79%), Query Frame = 2
Query:  113 KLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLI---NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRD-FILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            +L  IR  +K+L+ +IE LK ++ +V  ++     + + K      K   + +  FN  PK+GI+FL+ N +++ TPED+A+FL + + LNK  IGDYLG+   +FN KVL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CNP +F + D  YVL++A+IMLNT+L+NPN   +       E F+       E     EDLLRN+Y +IK++P     + GN +   +      G L      ++ WK+R F+L   CL       + + R  I L N+ +  V E    + F L   +    VI A KT  D    + N   +R +  +++E++EW+K+IK  +++
Sbjct:   18 ELSNIRRRKKELLDDIERLKFEIAEVMTEIEQLTCVGESKTTQRN-KQIAMGRKKFNMDPKKGIQFLLENDLLQNTPEDIAQFLYKGEGLNKTVIGDYLGERD-DFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCQCNPGVFQSTDTCYVLSFAIIMLNTSLHNPNVRDK----PPVERFISMNRGINEGGDLPEDLLRNLYDSIKSEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVDEPRKPNCFELYNPNHKGQVIKACKTEADGRVVEGNHVVYRISAPTAEEKEEWIKSIKASISR 376          
BLAST of Cytohesin-1 vs. Ensembl Medaka
Match: cyth1a (cytohesin-1 [Source:NCBI gene;Acc:101170762])

HSP 1 Score: 187.963 bits (476), Expect = 8.687e-55
Identity = 117/372 (31.45%), Postives = 207/372 (55.65%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+++I+ LK+++ +VN ++ N    ++ K +    K+  + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   +FN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN K+F + D  Y+L++A+IMLNT+L+NPN         K++  ++  +       +     EDLL N+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V +     F L +    + VI A KT  D    + N   +R +  +  E+++W+ +IK  +++
Sbjct:   18 EQQELENIRRRKQELLLDIQRLKDEIAEVNSEIENLDSTEERKNMQRN-KHVAMGRKKFNMDPKKGIQFLIENDLLKNTSEDIARFLYKGEGLNKTAIGDYLGERD-DFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYVQCNSKVFQSTDTCYILSFAIIMLNTSLHNPNV--------KDKPSVERFISMNRGINDGGDLPEDLLTNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSIREVEDKKPNCFELFIPENKDQVIKACKTEADGRVVEGNHTFYRISAPTPLEKEQWMNSIKAAISR 379          
BLAST of Cytohesin-1 vs. Ensembl Medaka
Match: cyth1a (cytohesin-1 [Source:NCBI gene;Acc:101170762])

HSP 1 Score: 187.963 bits (476), Expect = 9.262e-55
Identity = 117/372 (31.45%), Postives = 207/372 (55.65%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-----ENYSFQEDLLRNVYHTIKTDPLI----NFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNK 1189
            + ++LE IR  +++L+++I+ LK+++ +VN ++ N    ++ K +    K+  + +  FN  PK+GI+FLI N ++K T ED+A+FL + + LNK +IGDYLG+   +FN +VL A+V LH+F     V  LR FL  F LPGE+QKI  +++A++  Y +CN K+F + D  Y+L++A+IMLNT+L+NPN         K++  ++  +       +     EDLL N+Y +IK +P      +  ++ +  +  ++    L      ++ WK+R F+L   CL       + + R  I L N+ +  V +     F L +    + VI A KT  D    + N   +R +  +  E+++W+ +IK  +++
Sbjct:   15 EQQELENIRRRKQELLLDIQRLKDEIAEVNSEIENLDSTEERKNMQRN-KHVAMGRKKFNMDPKKGIQFLIENDLLKNTSEDIARFLYKGEGLNKTAIGDYLGERD-DFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYVQCNSKVFQSTDTCYILSFAIIMLNTSLHNPNV--------KDKPSVERFISMNRGINDGGDLPEDLLTNLYDSIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEFTTDKEPRGIIPLENLSIREVEDKKPNCFELFIPENKDQVIKACKTEADGRVVEGNHTFYRISAPTPLEKEQWMNSIKAAISR 376          
BLAST of Cytohesin-1 vs. Planmine SMEST
Match: SMESG000056462.1 (SMESG000056462.1)

HSP 1 Score: 777.704 bits (2007), Expect = 0.000e+0
Identity = 379/379 (100.00%), Postives = 379/379 (100.00%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINENLETSDSEIITKST 1240
            DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINENLETSDSEIITKST
Sbjct:    4 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINENLETSDSEIITKST 382          
BLAST of Cytohesin-1 vs. Planmine SMEST
Match: SMESG000053199.1 (SMESG000053199.1)

HSP 1 Score: 240.736 bits (613), Expect = 2.473e-75
Identity = 132/375 (35.20%), Postives = 214/375 (57.07%), Query Frame = 2
Query:  104 DSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDPELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEY-ENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTNKMN---------GELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQVDRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSDEQKEWLKAIKQCLNKINE 1198
            D  KL  I   +K+L  +I+ L+E+   +   M+  G I DG+I D   +   I    FN+ P+ GIE+L++ + I+ETP+ +A FL +  LNKR++GDYLG+I+  FN  VL  Y+ L DF   EF+D +R FLSGF LPGESQKI +II  W+ +Y+E NP +F N +E Y++ YAVIMLNT L+NP A  +N  FG+EE F+K M  +  +  F+   ++ ++  IK++PL+     +++  P NK N         G LW Q   ++  KKR FVL    L    + N+  ++  I L N+ +    + +++     ++S  N +I   K+ +     + +  +++  C S +E + W+ AI++ ++ I +
Sbjct:   10 DLVKLNRIYKRQKQLKSDIKDLEEEFYDITTRMKTLGCIIDGRIEDSHTRNLRIGTKKFNHNPEEGIEYLVSKKAIQETPKAIATFLTDKSLNKRAVGDYLGNISKPFNCDVLQEYISLFDFSEMEFIDSIRFFLSGFHLPGESQKIDKIISLWAKYYHEQNPSIFKNENETYIMTYAVIMLNTCLHNPTAKKENGGFGREEDFIKIMGNFNSDTQFELSFVKRIFKNIKSNPLL----CLHKHLPDNKYNSDISNIEKAGWLWKQGGRIKNMKKRWFVLSEYSLFYFIHPNSQSLKGMIPLENLLIRMSCDRSSKP-CFEIYSNENEIIKGCKSKKSGQIIKGHHYSYKIYCFSQEEMESWMDAIQRSIDLITQ 379          
BLAST of Cytohesin-1 vs. Planmine SMEST
Match: SMESG000041501.1 (SMESG000041501.1)

HSP 1 Score: 117.087 bits (292), Expect = 1.192e-27
Identity = 63/140 (45.00%), Postives = 93/140 (66.43%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFLQEPD-LNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECNP--KMFNNADEPYVLAYAVIMLNTTLNNPNAISQN 688
            FN KP +G+ +L    ++  + EDVA+FL + D L+K +IGD+LG+   ++N +V+ A+V   +F  KEFV  LR FLSGF LPGE+QKI  +++ ++  Y ECNP    F +AD  YVLAY++IML T L++    S+N
Sbjct:  616 FNKKPLKGLNYLQNQTLLGTSVEDVAEFLHKDDRLDKTAIGDFLGE-NEKYNIEVMYAFVDQFEFTEKEFVASLRDFLSGFRLPGEAQKIDRLMEKFAARYCECNPTNSQFKSADTAYVLAYSIIMLTTDLHSSQIKSRN 754          
BLAST of Cytohesin-1 vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 100.138 bits (248), Expect = 2.779e-22
Identity = 65/191 (34.03%), Postives = 106/191 (55.50%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECN----PKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYEN-YSFQEDLLRNVYHTIKTDPLINFGNIVNEL 832
            FN    +G+ +LI  + ++ +P  +AKFL     +++ SIGDYLG    +   + L  +VR+ D R+KE    LR  LS F +PGESQKI  I++ + + Y E N    P++  N D   +LAYA+IML+T + NPN I +  +  KEE F+  +   ++      ++L  +Y  IKT  +  F +  +++
Sbjct:  384 FNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPN-IRKQHKMSKEE-FIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSDHTDQV 572          
BLAST of Cytohesin-1 vs. Planmine SMEST
Match: SMESG000057299.1 (SMESG000057299.1)

HSP 1 Score: 100.138 bits (248), Expect = 2.841e-22
Identity = 65/191 (34.03%), Postives = 106/191 (55.50%), Query Frame = 2
Query:  278 FNNKPKRGIEFLITNQIIKETPEDVAKFL-QEPDLNKRSIGDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKISEIIKAWSDFYYECN----PKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIEFGKEEAFLKTMLEYEN-YSFQEDLLRNVYHTIKTDPLINFGNIVNEL 832
            FN    +G+ +LI  + ++ +P  +AKFL     +++ SIGDYLG    +   + L  +VR+ D R+KE    LR  LS F +PGESQKI  I++ + + Y E N    P++  N D   +LAYA+IML+T + NPN I +  +  KEE F+  +   ++      ++L  +Y  IKT  +  F +  +++
Sbjct:  366 FNKNSLKGVSYLIRFKFVEPSPNILAKFLMSRKGISRFSIGDYLGHTKDDLATETLKFFVRMVDMRNKEIDIALRHLLSFFQIPGESQKIKSIMEEFQESYMEQNQQFWPQICKNPDTIMILAYAIIMLHTDMYNPN-IRKQHKMSKEE-FIHNLRNVDDGQDINPNILTAIYDRIKTAEMKTFSDHTDQV 554          
The following BLAST results are available for this feature:
BLAST of Cytohesin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CYTH14.359e-5633.06cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501][more]
CYTH33.110e-5535.18cytohesin 3 [Source:HGNC Symbol;Acc:HGNC:9504][more]
CYTH16.273e-5532.17cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501][more]
CYTH16.273e-5532.17cytohesin 1 [Source:HGNC Symbol;Acc:HGNC:9501][more]
CYTH22.109e-5433.33cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grp-11.467e-3427.25GTP exchange factor for ARFs 1 [Source:UniProtKB/... [more]
agef-11.214e-2542.11Arf-1 Guanine nucleotide Exchange Factor homolog ... [more]
gbf-11.055e-1930.15pep chromosome:WBcel235:III:11751320:11773681:-1 g... [more]
bris-13.400e-1933.17BRag/Iqsec/Schizo related Arf GEF family member [... [more]
bris-13.520e-1933.17BRag/Iqsec/Schizo related Arf GEF family member [... [more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
step5.379e-5331.48gene:FBgn0086779 transcript:FBtr0085910[more]
step1.356e-4631.23gene:FBgn0086779 transcript:FBtr0332471[more]
step1.356e-4631.23gene:FBgn0086779 transcript:FBtr0301616[more]
step1.356e-4631.23gene:FBgn0086779 transcript:FBtr0301617[more]
Sec714.853e-2843.28gene:FBgn0028538 transcript:FBtr0080537[more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyth1b5.084e-5934.06cytohesin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4311... [more]
cyth1b5.295e-5934.06cytohesin 1b [Source:ZFIN;Acc:ZDB-GENE-030131-4311... [more]
cyth1a7.323e-5832.88cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657][more]
cyth1a6.693e-5634.35cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657][more]
cyth1a6.693e-5634.35cytohesin 1a [Source:ZFIN;Acc:ZDB-GENE-030131-657][more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyth29.648e-5733.15cytohesin 2 [Source:NCBI gene;Acc:448569][more]
cyth21.348e-5633.15cytohesin 2 [Source:NCBI gene;Acc:448569][more]
cyth21.426e-5633.15cytohesin 2 [Source:NCBI gene;Acc:448569][more]
cyth21.493e-5633.15cytohesin 2 [Source:NCBI gene;Acc:448569][more]
cyth21.547e-5633.15cytohesin 2 [Source:NCBI gene;Acc:448569][more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cyth12.407e-5532.53cytohesin 1 [Source:MGI Symbol;Acc:MGI:1334257][more]
Cyth36.178e-5535.36cytohesin 3 [Source:MGI Symbol;Acc:MGI:1335107][more]
Cyth26.772e-5533.33cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255][more]
Cyth29.607e-5533.33cytohesin 2 [Source:MGI Symbol;Acc:MGI:1334255][more]
Cyth13.639e-5431.64cytohesin 1 [Source:MGI Symbol;Acc:MGI:1334257][more]
back to top
BLAST of Cytohesin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15438|CYH1_HUMAN3.012e-5432.17Cytohesin-1 OS=Homo sapiens OX=9606 GN=CYTH1 PE=1 ... [more]
sp|Q76MZ1|CYH1_CHLAE3.012e-5432.17Cytohesin-1 OS=Chlorocebus aethiops OX=9534 GN=CYT... [more]
sp|O08967|CYH3_MOUSE4.321e-5435.36Cytohesin-3 OS=Mus musculus OX=10090 GN=Cyth3 PE=1... [more]
sp|Q76MY7|CYH2_CHLAE1.013e-5333.33Cytohesin-2 OS=Chlorocebus aethiops OX=9534 GN=CYT... [more]
sp|O43739|CYH3_HUMAN1.810e-5334.25Cytohesin-3 OS=Homo sapiens OX=9606 GN=CYTH3 PE=1 ... [more]
back to top
BLAST of Cytohesin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2DPZ79.100e-6935.64Cytohesin-1 OS=Schistosoma japonicum OX=6182 GN=EW... [more]
A0A0V0JC291.359e-6836.77Cytohesin-3 OS=Schistocephalus solidus OX=70667 GN... [more]
A0A158QH864.813e-6835.92Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4E0RBH91.110e-6735.77Cytohesin-2 OS=Fasciola hepatica OX=6192 GN=D915_0... [more]
A0A504Z1H12.413e-6735.77Cytohesin-2 OS=Fasciola gigantica OX=46835 GN=FGIG... [more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyth1b7.862e-5633.70cytohesin-1 [Source:NCBI gene;Acc:103022618][more]
cyth1b9.301e-5633.70cytohesin-1 [Source:NCBI gene;Acc:103022618][more]
si:dkey-283b15.41.070e-5533.33cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
cyth1b1.522e-5533.70cytohesin-1 [Source:NCBI gene;Acc:103022618][more]
cyth3a3.828e-5433.52cytohesin 3 [Source:NCBI gene;Acc:103025488][more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-283b15.46.300e-5533.69cytohesin 2 [Source:HGNC Symbol;Acc:HGNC:9502][more]
ENSPMAT00000004124.16.753e-2845.86pep scaffold:Pmarinus_7.0:GL477097:5491:41441:-1 g... [more]
ENSPMAT00000004144.17.608e-2845.86pep scaffold:Pmarinus_7.0:GL477097:6043:63444:-1 g... [more]
ENSPMAT00000004134.19.995e-2845.86pep scaffold:Pmarinus_7.0:GL477097:5536:63408:-1 g... [more]
gbf18.542e-2536.81golgi brefeldin A resistant guanine nucleotide exc... [more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SEC74.855e-2340.41Guanine nucleotide exchange factor (GEF) for ADP r... [more]
GEA25.082e-1830.18Guanine nucleotide exchange factor for ADP ribosyl... [more]
GEA12.898e-1328.45Guanine nucleotide exchange factor for ADP ribosyl... [more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380041.351e-4931.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO315381.159e-3046.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348829.122e-2841.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419021.504e-2542.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293695.955e-2328.63pep supercontig:ASM20922v1:NEMVEscaffold_1160:2485... [more]
back to top
BLAST of Cytohesin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyth1b6.323e-5732.88cytohesin-1 [Source:NCBI gene;Acc:101171613][more]
cyth1b1.082e-5632.88cytohesin-1 [Source:NCBI gene;Acc:101171613][more]
CYTH33.412e-5634.52cytohesin-3 [Source:NCBI gene;Acc:101158948][more]
cyth1a8.687e-5531.45cytohesin-1 [Source:NCBI gene;Acc:101170762][more]
cyth1a9.262e-5531.45cytohesin-1 [Source:NCBI gene;Acc:101170762][more]
back to top
BLAST of Cytohesin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056462.10.000e+0100.00SMESG000056462.1[more]
SMESG000053199.12.473e-7535.20SMESG000053199.1[more]
SMESG000041501.11.192e-2745.00SMESG000041501.1[more]
SMESG000057299.12.779e-2234.03SMESG000057299.1[more]
SMESG000057299.12.841e-2234.03SMESG000057299.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033298 ID=SMED30033298|Name=Cytohesin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1321bp
CTTTTCATTTAAAATTTAGTGAATAATTTCAAACCTCTATTTAGTGTTTA
GAATTTCACATATTATTTCCTAAATAATTTTAAGTTATCTCATTATGCAT
AGTGATTCTAAGAAACTTGAAATTATCAGAAATGCTAGAAAAAAGTTAAT
GGTCGAAATTGAATCTCTTAAAGAACAGCTTAAAAAAGTAAATGATGATA
TGAGAAATAATGGTTTTATTCAAGATGGAAAAATAGTTGATCCTGAACTC
AAATACCGAAATATTGCTAAAACACATTTTAATAATAAACCCAAAAGAGG
TATTGAATTTTTAATAACAAATCAAATTATCAAAGAAACTCCAGAAGATG
TTGCTAAATTTTTACAAGAACCCGATTTAAATAAACGTTCTATTGGAGAT
TATTTGGGTGATATAACTGTTGAATTTAACAGAAAAGTGTTGGATGCCTA
CGTTAGACTTCATGATTTTCGTCACAAAGAATTTGTTGATGGTCTTAGGG
TTTTTCTCAGTGGGTTTTTTCTGCCGGGTGAAAGTCAAAAGATATCTGAA
ATAATTAAAGCTTGGTCGGATTTCTATTATGAATGCAATCCTAAAATGTT
TAACAATGCCGACGAACCATATGTCTTAGCTTACGCTGTTATCATGCTCA
ATACGACTCTCAATAATCCAAATGCTATCAGTCAAAATATTGAATTTGGT
AAAGAAGAGGCTTTCCTCAAAACCATGCTGGAATATGAAAATTATTCTTT
TCAGGAAGACTTGTTAAGGAATGTGTATCATACAATAAAAACTGATCCGC
TAATAAATTTCGGTAACATTGTCAACGAGCTCTATCCAACAAATAAAATG
AATGGGGAATTGTGGTATCAATCTAACAATTTGCGGGTGTGGAAAAAGCG
CACATTTGTGTTGCTACCGGAATGTCTTCTTATTCTAACCAATGATAATA
ATCCACAAGTCAGATATAAAATAGCTCTTACTAATGTCCAAGTTGATCGA
GTTTTTGAGACGACTAATCGAGATTTTATATTAAATTTACACAGTCGGAC
AAATGGAGTTATTAGTGCCACTAAAACTGGCAGAGACAATGTGGAAGAAC
AGAAAAATATGAGAAATTTCAGATTTGCTTGCAATTCAAGCGATGAACAG
AAAGAATGGCTCAAAGCAATCAAACAATGTCTTAATAAAATAAATGAGAA
TTTGGAAACTAGTGATTCAGAAATTATAACAAAATCCACTTAAAACCTTT
GATCTGAGATTTGTAATGAATTGTTTTTTGAATGGCCGAAAAATATTCAT
TTACTTATCTTTTTAAAAAAA
back to top

protein sequence of SMED30033298-orf-1

>SMED30033298-orf-1 ID=SMED30033298-orf-1|Name=SMED30033298-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=383bp
MHSDSKKLEIIRNARKKLMVEIESLKEQLKKVNDDMRNNGFIQDGKIVDP
ELKYRNIAKTHFNNKPKRGIEFLITNQIIKETPEDVAKFLQEPDLNKRSI
GDYLGDITVEFNRKVLDAYVRLHDFRHKEFVDGLRVFLSGFFLPGESQKI
SEIIKAWSDFYYECNPKMFNNADEPYVLAYAVIMLNTTLNNPNAISQNIE
FGKEEAFLKTMLEYENYSFQEDLLRNVYHTIKTDPLINFGNIVNELYPTN
KMNGELWYQSNNLRVWKKRTFVLLPECLLILTNDNNPQVRYKIALTNVQV
DRVFETTNRDFILNLHSRTNGVISATKTGRDNVEEQKNMRNFRFACNSSD
EQKEWLKAIKQCLNKINENLETSDSEIITKST*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035999Sec7_dom_sf
IPR001849PH_domain
IPR000904Sec7_dom
IPR011993PH-like_dom_sf
IPR023394Sec7_C_sf
Vocabulary: biological process
TermDefinition
GO:0032012regulation of ARF protein signal transduction
GO:0043547positive regulation of GTPase activity
Vocabulary: molecular function
TermDefinition
GO:0005086ARF guanyl-nucleotide exchange factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..39
NoneNo IPR availableGENE3DG3DSA:1.10.220.20coord: 51..124
e-value: 2.4E-22
score: 80.5
NoneNo IPR availablePANTHERPTHR10663:SF320CYTOHESIN-3coord: 6..364
NoneNo IPR availablePANTHERPTHR10663GUANYL-NUCLEOTIDE EXCHANGE FACTORcoord: 6..364
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 252..365
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 250..366
e-value: 4.1E-8
score: 43.0
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 251..363
e-value: 6.0E-13
score: 49.2
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 249..364
score: 12.552
IPR000904Sec7 domainSMARTSM00222sec7_5coord: 48..236
e-value: 2.1E-47
score: 173.5
IPR000904Sec7 domainPFAMPF01369Sec7coord: 58..235
e-value: 5.6E-51
score: 172.8
IPR000904Sec7 domainPROSITEPS50190SEC7coord: 59..234
score: 30.554
IPR000904Sec7 domainCDDcd00171Sec7coord: 61..236
e-value: 1.70512E-48
score: 160.466
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 248..367
e-value: 1.1E-17
score: 66.4
IPR023394Sec7, C-terminal domain superfamilyGENE3DG3DSA:1.10.1000.11coord: 125..245
e-value: 2.3E-28
score: 100.4
IPR035999Sec7 domain superfamilySUPERFAMILYSSF48425Sec7 domaincoord: 56..237