DUF3421 domain-containing protein

Overview
NameDUF3421 domain-containing protein
Smed IDSMED30033292
Length (bp)673
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF3421 domain-containing protein (SMED30033292) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30033292) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF3421 domain-containing protein (SMED30033292) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF3421 domain-containing protein (SMED30033292) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033292

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30033292SMESG000029913.1 dd_Smed_v4_30758_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0345371)

HSP 1 Score: 85.8853 bits (211), Expect = 9.393e-20
Identity = 51/144 (35.42%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  219 SWIDCQD-GNIPDKAVSAG-----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSI-VGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +WI     G++P  A+ AG     D  +V RA H  E +P K V G   AYV + G+EI+K ++++LV      G    W  + G  +P  +I VG T    PLY+ +    G +  GK  P   C + PYGG+EHR    E+L
Sbjct:    5 TWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVL 142          

HSP 2 Score: 63.1586 bits (152), Expect = 1.358e-11
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  219 SWIDCQDGNIPDKAVSAGDS-----CYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNE-RPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILC 632
            SWI    G++P  A+  G +      YV R        PGK    H   Y+ Y G+E     Y++LV           W  + G  I   ++VGG D +   +Y+ ++   G+++  K +P   C + PYGG E  K   E+L 
Sbjct:   77 SWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET-------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 60.8474 bits (146), Expect = 8.885e-11
Identity = 43/143 (30.07%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  219 SWIDCQD-GNIPDKAVSA----GDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEW-HYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +WI     G +P   V      GD  YV RA H  + +P K +     AYV Y G E+ K +Y++L       G    W H + GN      + G T +  PL+I ++  +G +  GK      C + P+ G+E R    E+L
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA------GYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          

HSP 4 Score: 48.9062 bits (115), Expect = 8.986e-7
Identity = 23/66 (34.85%), Postives = 34/66 (51.52%), Query Frame = 3
Query:  222 WIDCQDGNIPDKAV-----SAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILV 404
            W+    GN+P  AV     S G+  ++ RA H     PGK  Q H   Y+ +DG+E+    Y++LV
Sbjct:  219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG13321 (gene:FBgn0033787 transcript:FBtr0087792)

HSP 1 Score: 85.8853 bits (211), Expect = 9.393e-20
Identity = 51/144 (35.42%), Postives = 73/144 (50.69%), Query Frame = 3
Query:  219 SWIDCQD-GNIPDKAVSAG-----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSI-VGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +WI     G++P  A+ AG     D  +V RA H  E +P K V G   AYV + G+EI+K ++++LV      G    W  + G  +P  +I VG T    PLY+ +    G +  GK  P   C + PYGG+EHR    E+L
Sbjct:    5 TWISTNVYGSLPPGAILAGHDSDQDPIFVGRAYHNGEMLPAKVVPGKQQAYVPWGGQEISKHDFEVLV------GDHFSWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVL 142          

HSP 2 Score: 63.1586 bits (152), Expect = 1.358e-11
Identity = 41/144 (28.47%), Postives = 63/144 (43.75%), Query Frame = 3
Query:  219 SWIDCQDGNIPDKAVSAGDS-----CYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNE-RPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILC 632
            SWI    G++P  A+  G +      YV R        PGK    H   Y+ Y G+E     Y++LV           W  + G  I   ++VGG D +   +Y+ ++   G+++  K +P   C + PYGG E  K   E+L 
Sbjct:   77 SWIPSSGGSVPPHAIQVGQTGEGEPLYVGRGYFQGSLTPGKVHPSHQCLYIPYGGQEHRLEAYEVLVQPET-------WIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA 213          

HSP 3 Score: 60.8474 bits (146), Expect = 8.885e-11
Identity = 43/143 (30.07%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  219 SWIDCQD-GNIPDKAVSA----GDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEW-HYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +WI     G +P   V      GD  YV RA H  + +P K +     AYV Y G E+ K +Y++L       G    W H + GN      + G T +  PL+I ++  +G +  GK      C + P+ G+E R    E+L
Sbjct:  147 TWIASSGRGIVPGTVVGGHDADGDQIYVGRAYHEGDLLPAKVIPNKGCAYVPYGGGEVVKHDYELLA------GYGYGWVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVL 283          

HSP 4 Score: 48.9062 bits (115), Expect = 8.986e-7
Identity = 23/66 (34.85%), Postives = 34/66 (51.52%), Query Frame = 3
Query:  222 WIDCQDGNIPDKAV-----SAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILV 404
            W+    GN+P  AV     S G+  ++ RA H     PGK  Q H   Y+ +DG+E+    Y++LV
Sbjct:  219 WVHDSHGNVPGNAVLCGRTSDGEPLFIGRAHHHGSLTPGKIHQSHHCLYIPFDGEEVRIDHYEVLV 284          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG10527 (gene:FBgn0034583 transcript:FBtr0071541)

HSP 1 Score: 77.7962 bits (190), Expect = 8.489e-17
Identity = 45/140 (32.14%), Postives = 68/140 (48.57%), Query Frame = 3
Query:  222 WIDCQDGNIPDKAVSAG----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNE-RPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEI 626
            W+   +G +P  A+  G    +  Y+ARA+H  + IPGK    H   YV++ G E   +EY++L      GG   +W       IP  ++  G   E  PL+I ++  +G + VGK  P   C + PYGG+E      EI
Sbjct:  159 WVPAANGEVPPNALEGGFDSSEQLYIARARHEGDLIPGKLHPSHGVTYVAWGGGEHGHAEYEVLCAG---GG---QWLPVDAGNIPPNALPAGETAEGEPLFIGRATHDGTITVGKVQPSHGCCYIPYGGEELAYKEFEI 292          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339105)

HSP 1 Score: 68.5514 bits (166), Expect = 1.893e-13
Identity = 46/154 (29.87%), Postives = 69/154 (44.81%), Query Frame = 3
Query:  189 ENGRSVEISVSWIDCQD-GNIPDKAVSAG-----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNE-RPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            + G  V +  +W+       +P  AV  G        YV R+ H  E +P K V     AYV+Y G E  K+ Y++LV      G    W  +    +P  ++  GT     PLY+ +    G + VGK  P   C + P+GG+E R +  E+L
Sbjct:    5 QPGGVVTVDNTWVHSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLV------GQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 152          

HSP 2 Score: 58.9214 bits (141), Expect = 3.732e-10
Identity = 35/143 (24.48%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  219 SWIDCQDGNIPDKAVSAGDS-----CYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNER-PLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +W+    G +P  AV +G +      YV R  H      GK    H   Y+ + G+E+  + Y++L+           W     +  P  +++ G D++R P+Y  ++   GE++  K +P     +  +GG E +K   E+L
Sbjct:   87 AWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQ-----HDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 224          

HSP 3 Score: 58.9214 bits (141), Expect = 4.227e-10
Identity = 43/143 (30.07%), Postives = 58/143 (40.56%), Query Frame = 3
Query:  222 WIDCQDGNIPDKAVSAG-----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGG-TDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILC 632
            W+       P  AV AG        Y  RA H  E +P K V    +AYV + G E  K  Y++L     +      W    G+ IP  ++  G   N   LY  +    G +  G       C + PYGG+E R +  EILC
Sbjct:  160 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYGYV------W-MNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 295          
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Match: CG44250 (gene:FBgn0265185 transcript:FBtr0339104)

HSP 1 Score: 67.0106 bits (162), Expect = 6.394e-13
Identity = 39/117 (33.33%), Postives = 57/117 (48.72%), Query Frame = 3
Query:  282 YVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNE-RPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            YV R+ H  E +P K V     AYV+Y G E  K+ Y++LV      G    W  +    +P  ++  GT     PLY+ +    G + VGK  P   C + P+GG+E R +  E+L
Sbjct:   31 YVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVLV------GQGFAWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVL 141          

HSP 2 Score: 58.9214 bits (141), Expect = 3.520e-10
Identity = 35/143 (24.48%), Postives = 64/143 (44.76%), Query Frame = 3
Query:  219 SWIDCQDGNIPDKAVSAGDS-----CYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNER-PLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +W+    G +P  AV +G +      YV R  H      GK    H   Y+ + G+E+  + Y++L+           W     +  P  +++ G D++R P+Y  ++   GE++  K +P     +  +GG E +K   E+L
Sbjct:   76 AWVPSSSGGVPPNAVRSGTTRTGEPLYVGRGHHAGSLTVGKVHPSHGCLYIPFGGQEVRINTYEVLIKQQ-----HDVWVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVL 213          

HSP 3 Score: 58.9214 bits (141), Expect = 3.950e-10
Identity = 43/143 (30.07%), Postives = 58/143 (40.56%), Query Frame = 3
Query:  222 WIDCQDGNIPDKAVSAG-----DSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGG-TDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILC 632
            W+       P  AV AG        Y  RA H  E +P K V    +AYV + G E  K  Y++L     +      W    G+ IP  ++  G   N   LY  +    G +  G       C + PYGG+E R +  EILC
Sbjct:  149 WVPASPSYTPPGAVIAGHDSDRTPIYAGRAMHEGEMLPAKVVPSKGTAYVCFGGYEFQKPSYEVLTGYGYV------W-MNCGHSIPPNAVTTGRARNGELLYYGRGHYQGSLTPGLISASQRCLYIPYGGREIRINSYEILC 284          

HSP 4 Score: 46.595 bits (109), Expect = 6.253e-6
Identity = 22/64 (34.38%), Postives = 38/64 (59.38%), Query Frame = 3
Query:  441 HYTRGNQIPYRSIVGGTDNER-PLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            H +  + +P  +++GG D++R P+Y+ +S   GE +  K +P   C +  YGG EH K+  E+L
Sbjct:    7 HSSPYSPLPPYAVIGGHDSDRTPIYVGRSFHEGENLPAKVVPSKGCAYVAYGGAEHTKTHYEVL 70          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H8B2 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012514g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 3.517e-36
Identity = 65/147 (44.22%), Postives = 92/147 (62.59%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSI-LGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHR 608
            MS++   +   +E+ +SW    +G+IP  AV AG+ CYVARAKH  E++PGK   GHTSAYV Y  +E+  SEY++LV S I   G   +W   +GN +P  ++V G DN  PLY+A++   GEV  GK  P+  C +  +GGKEH+
Sbjct:    1 MSRVNHNDIEGIELCLSWHPASNGDIPAGAVKAGEDCYVARAKHEGEWVPGKLSAGHTSAYVPYGDEEVPYSEYEVLVSSEIGHFGCGYQWLPAKGNSVPKGALVSGYDNGAPLYVARATFEGEVCCGKAQPDLECAYISWGGKEHK 147          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8J9Y8 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 3.670e-35
Identity = 66/155 (42.58%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSI-LGGPSIEWHYTRGNQIPYRSIVGGTD-NERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            MSK+     + +EI VSW   +DG+IP  A+ A   C+V RAKH D +IP K  +GHT+AYV YDGKE +  EY++LV S I   G   +W       +P +++V G + N+ PLY+A+  ++GE+ VGK      C +FPYGG EH     E+L
Sbjct:    1 MSKVKHAGHKGIEICVSWQPAKDGHIPPNAIEAAPGCFVGRAKHEDCWIPAKVAEGHTNAYVPYDGKEHSIPEYEVLVCSEIGCYGKGYKWVRKDSGDVPKKALVAGREKNDEPLYVARGEVDGEMCVGKVHKNHHCAYFPYGGTEHSSEEYEVL 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8HE36 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001642g3 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.317e-35
Identity = 66/155 (42.58%), Postives = 93/155 (60.00%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSI-LGGPSIEWHYTRGNQIPYRSIVGGTD-NERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            MSK+     + +EI VSW   +DG+IP  A+ A   C+V RAKH D +IP K  +GHT+AYV YDGKE +  EY++LV S I   G   +W       +P +++V G + N+ PLY+A+  ++GE+ VGK      C +FPYGG EH     E+L
Sbjct:    1 MSKVKHAGHKGIEICVSWQPAKDGHIPPNAIEAAPGCFVGRAKHEDCWIPAKVAEGHTNAYVPYDGKEHSIPEYEVLVCSEIGCYGKGYKWVREDSGDVPKKALVAGREKNDEPLYVARGEVDGEMCVGKVHKNHHCAYFPYGGTEHSSEEYEVL 155          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8I9L7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig020479g1 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.676e-33
Identity = 64/163 (39.26%), Postives = 91/163 (55.83%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDS---SILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRK-SMIEILCCTTKQ 647
            MS   S  G+ V++ +SW++  +G IP  AVS G   +VAR     E +PGK   GH S Y  YDG+E     YQ+L ++    + GGP  EW    GN  P  +++ G+D  RPLY+AK+ I+GE   GKY+P++   +F  GG EH K    E+L   T+ 
Sbjct:    1 MSTFKSSGGKGVDLCLSWVNAANGEIPAGAVSIGGDVFVARCFSDGELLPGKVAAGHNSCYAPYDGEEKCCDTYQVLCETCNHGLTGGPGFEWVAWSGNTAPKHALISGSDQGRPLYVAKANIDGEWCAGKYIPDYGKAYFSCGGAEHEKEDDFEVLVMCTRS 163          
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Match: A0A1I8H2V3 (DUF3421 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.021e-33
Identity = 63/148 (42.57%), Postives = 92/148 (62.16%), Query Frame = 3
Query:  192 NGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSI-LGGPSIEWHYTRGNQIPYRSIVGGTDNER-PLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEIL 629
            +G + ++++SWI  + G IP+ A+  G   +VARA+H  E IPGK   GH +AYVSY G+E A S+Y+IL D+ +   G +  W    G  +P  +++GG   +R P YI +S INGE+V GK      C +FP+GG+EHR +  EIL
Sbjct:   15 SGGNPQVTLSWIPARGGQIPNGAIQVGHGVFVARAQHAGELIPGKASMGHQAAYVSYGGQEHAVSDYEILCDTHMQCFGCNYTWERCHGRSVPRGALIGGYSADRQPYYIGRSQINGEMVAGKVFEPHGCAYFPWGGQEHRSNEFEIL 162          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029913.1 (SMESG000029913.1)

HSP 1 Score: 327.791 bits (839), Expect = 7.290e-116
Identity = 158/160 (98.75%), Postives = 159/160 (99.38%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILCCTTKQL 650
            MSKIVSE GRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSM+EILCCTTKQL
Sbjct:    1 MSKIVSEYGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMVEILCCTTKQL 160          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074377.1 (SMESG000074377.1)

HSP 1 Score: 181.8 bits (460), Expect = 2.678e-58
Identity = 81/158 (51.27%), Postives = 108/158 (68.35%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILCCTTK 644
            MSK+ S+ G+ VEI VSW    +G IP + V AG  C+V RA+   +YIPGK  +GH   YVSY GKEI  + Y+ LV++++L     +W Y  GN +P  +IVGGTDN +PLYIA+S +NGE VVGKY P   C +FP+GG+EHRK+ +E+LCC  K
Sbjct:    1 MSKVSSQYGKGVEICVSWQKASNGEIPHRTVKAGGKCFVGRAQQNGQYIPGKLYEGHKGVYVSYGGKEICVNNYEALVETNVLHNDGFQWKYVDGNNVPSGAIVGGTDNGQPLYIARSEVNGEPVVGKYFPPHGCAYFPFGGEEHRKTGVEVLCCVAK 158          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000029910.1 (SMESG000029910.1)

HSP 1 Score: 181.415 bits (459), Expect = 3.674e-58
Identity = 87/160 (54.37%), Postives = 110/160 (68.75%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILCCTTKQL 650
            MSK++++ GR+VEISVSW +  DG+IP  AV A  SC+VARAKH  EYIPGK V GH+  +V YDGKEI KS YQ+LVD+SIL     EW ++   +IP  +I+GGTDN +PL+I KS + GE VVGK+ P+  C   PY G E  K+  EILC   K L
Sbjct:    1 MSKVITQYGRAVEISVSWQEAHDGSIPLHAVKADGSCFVARAKHNGEYIPGKLVTGHSHVFVCYDGKEITKSHYQVLVDTSILPTTGYEWKWSEDLEIPPNAIIGGTDNGQPLFIVKSIVEGETVVGKFHPDHGCAHVPYEGLEFEKNEFEILCSLKKHL 160          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074396.1 (SMESG000074396.1)

HSP 1 Score: 172.17 bits (435), Expect = 1.670e-54
Identity = 81/161 (50.31%), Postives = 113/161 (70.19%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGG-PSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILCCTTKQL 650
            MSK+ S+ G  VE+S+SW+   +G+IP KAV AG   +VARAKH  +YIPGKFV+G+   +VS+ G E AK+ Y+ILV+SS+LGG    EW +T G  +P  ++VGG ++  PLY+A+S I  ++VVGKY P+  C + PYGG+EHR    E+LC TTK +
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Match: SMESG000074378.1 (SMESG000074378.1)

HSP 1 Score: 172.17 bits (435), Expect = 1.670e-54
Identity = 81/161 (50.31%), Postives = 113/161 (70.19%), Query Frame = 3
Query:  171 MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIPGKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGG-PSIEWHYTRGNQIPYRSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMIEILCCTTKQL 650
            MSK+ S+ G  VE+S+SW+   +G+IP KAV AG   +VARAKH  +YIPGKFV+G+   +VS+ G E AK+ Y+ILV+SS+LGG    EW +T G  +P  ++VGG ++  PLY+A+S I  ++VVGKY P+  C + PYGG+EHR    E+LC TTK +
Sbjct:    1 MSKVSSQYGAGVELSLSWVKANNGSIPPKAVRAGGQTFVARAKHDGQYIPGKFVEGYNEVFVSFGGVEHAKNYYEILVESSMLGGHKGYEWKWTNGENVPKGALVGGLNDGAPLYVARSFIEDQMVVGKYYPQHGCAYMPYGGEEHRVENAEVLCFTTKHV 161          
The following BLAST results are available for this feature:
BLAST of DUF3421 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG133219.393e-2035.42gene:FBgn0033787 transcript:FBtr0345371[more]
CG133219.393e-2035.42gene:FBgn0033787 transcript:FBtr0087792[more]
CG105278.489e-1732.14gene:FBgn0034583 transcript:FBtr0071541[more]
CG442501.893e-1329.87gene:FBgn0265185 transcript:FBtr0339105[more]
CG442506.394e-1333.33gene:FBgn0265185 transcript:FBtr0339104[more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H8B23.517e-3644.22DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8J9Y83.670e-3542.58DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8HE364.317e-3542.58DUF3421 domain-containing protein OS=Macrostomum l... [more]
A0A1I8I9L71.676e-3339.26Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2V32.021e-3342.57DUF3421 domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF3421 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029913.17.290e-11698.75SMESG000029913.1[more]
SMESG000074377.12.678e-5851.27SMESG000074377.1[more]
SMESG000029910.13.674e-5854.38SMESG000029910.1[more]
SMESG000074396.11.670e-5450.31SMESG000074396.1[more]
SMESG000074378.11.670e-5450.31SMESG000074378.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033292 ID=SMED30033292|Name=DUF3421 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=673bp
ATTCTATAATAGCACCGTTATCAAGGCTCTGTGTGTTATCGCGGTATGGC
GTAAGATTTTAGCTTGACTTATGTCGTTGGCGTACGTTGTGCACGACGTA
TTGACATGACGGATTTCCATGCGTATAAATATTCACTGAATTTGGTAGAA
AAAAATGTATTGAAATTAAAATGAGCAAAATTGTTAGCGAAAACGGTCGA
TCAGTCGAGATTTCCGTTTCATGGATAGATTGTCAAGATGGCAATATTCC
TGACAAAGCTGTGAGTGCTGGAGATTCGTGTTATGTTGCTAGGGCTAAAC
ATCTGGATGAATACATTCCAGGAAAATTCGTGCAAGGTCACACATCTGCC
TATGTTTCTTACGATGGTAAAGAAATAGCTAAATCCGAATATCAAATTCT
CGTTGACTCTTCCATACTTGGCGGGCCCAGTATAGAGTGGCATTATACGC
GAGGCAACCAAATCCCTTATAGATCTATTGTTGGTGGCACTGACAACGAA
AGACCTCTTTATATTGCAAAGAGTGCTATAAATGGGGAAGTTGTCGTTGG
AAAATATCTTCCTGAATTTGCCTGTGGATTTTTTCCGTACGGTGGAAAGG
AGCACAGAAAAAGTATGATTGAAATTTTGTGCTGCACAACAAAACAACTT
TAATTTCAACATGTTTTTTTAAA
back to top

protein sequence of SMED30033292-orf-1

>SMED30033292-orf-1 ID=SMED30033292-orf-1|Name=SMED30033292-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MSKIVSENGRSVEISVSWIDCQDGNIPDKAVSAGDSCYVARAKHLDEYIP
GKFVQGHTSAYVSYDGKEIAKSEYQILVDSSILGGPSIEWHYTRGNQIPY
RSIVGGTDNERPLYIAKSAINGEVVVGKYLPEFACGFFPYGGKEHRKSMI
EILCCTTKQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
Vocabulary: INTERPRO
TermDefinition
IPR006616DM9_repeat
IPR024518DUF3421
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006616DM9 repeatSMARTSM00696dm9coord: 15..80
e-value: 3.0E-10
score: 50.0
coord: 87..156
e-value: 6.1E-6
score: 29.4
IPR024518Domain of unknown function DUF3421PFAMPF11901DUF3421coord: 112..155
e-value: 9.7E-8
score: 32.0
coord: 34..146
e-value: 9.5E-27
score: 93.3
NoneNo IPR availablePANTHERPTHR31649FAMILY NOT NAMEDcoord: 8..158