slc39a-4

Overview
Nameslc39a-4 (AKN21669.1)
Smed IDSMED30033279
Length (bp)2680
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc39a-4 (SMED30033279) t-SNE clustered cells

Violin plots show distribution of expression levels for slc39a-4 (SMED30033279) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc39a-4 (SMED30033279) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc39a-4 (SMED30033279) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033279

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30033279SMESG000026205.1 dd_Smed_v4_6113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30033279SMESG000026205.1 dd_Smed_v4_6113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033279SMESG000026205.1 dd_Smed_v4_6113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30033279SMESG000026205.1 dd_Smed_v4_6113_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc39a-4 vs. Ensembl Human
Match: SLC39A10 (solute carrier family 39 member 10 [Source:HGNC Symbol;Acc:HGNC:20861])

HSP 1 Score: 182.185 bits (461), Expect = 6.643e-47
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + +  IA+ VI GDG+HNF DG+AIGAAF+  + GG+ST+IAV CHELPHELGDF VLL AGM+++ AI YNL+S++   IGM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+        +    P   F+ QN+G + G AIMLVIALYE+
Sbjct:  664 TGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYED 823          

HSP 2 Score: 72.4034 bits (176), Expect = 2.504e-12
Identity = 65/209 (31.10%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  388 KCHSPIQMLSWF-NKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKP--MKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHS-------------HNGHNKM------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKK 948
            +C +  Q+L ++ +   S +S + F  LCP+LL Q+ SR+C  +  + +     K  N       N   + W+C   ++ VISL+ LL V L+PI+ +  +  +   L+ALAVG+++GDALLHL+PH+     + GH               +  NK       V K LVAL GI+L F+ E    ++++ + +R  K++ F+K  T++
Sbjct:  336 ECLNVTQLLKYYGHGANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHS-----QGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR-GKQKWFMKQNTEE 538          
BLAST of slc39a-4 vs. Ensembl Human
Match: SLC39A10 (solute carrier family 39 member 10 [Source:HGNC Symbol;Acc:HGNC:20861])

HSP 1 Score: 182.185 bits (461), Expect = 6.643e-47
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + +  IA+ VI GDG+HNF DG+AIGAAF+  + GG+ST+IAV CHELPHELGDF VLL AGM+++ AI YNL+S++   IGM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+        +    P   F+ QN+G + G AIMLVIALYE+
Sbjct:  664 TGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYED 823          

HSP 2 Score: 72.4034 bits (176), Expect = 2.504e-12
Identity = 65/209 (31.10%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  388 KCHSPIQMLSWF-NKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKP--MKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHS-------------HNGHNKM------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKK 948
            +C +  Q+L ++ +   S +S + F  LCP+LL Q+ SR+C  +  + +     K  N       N   + W+C   ++ VISL+ LL V L+PI+ +  +  +   L+ALAVG+++GDALLHL+PH+     + GH               +  NK       V K LVAL GI+L F+ E    ++++ + +R  K++ F+K  T++
Sbjct:  336 ECLNVTQLLKYYGHGANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHS-----QGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR-GKQKWFMKQNTEE 538          
BLAST of slc39a-4 vs. Ensembl Human
Match: SLC39A6 (solute carrier family 39 member 6 [Source:HGNC Symbol;Acc:HGNC:18607])

HSP 1 Score: 164.851 bits (416), Expect = 2.190e-41
Identity = 80/161 (49.69%), Postives = 111/161 (68.94%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI--LFLWQNIGFVIGSAIMLVIALYE 2106
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM+++ A+ YN +S++   +GM  G+ +G    ++S WIF LTAG+F+Y+ALVDM+PE+    L  +   H  S    F  QN G ++G  IML+I+++E
Sbjct:  590 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEM----LHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFE 746          

HSP 2 Score: 55.4546 bits (132), Expect = 4.405e-7
Identity = 50/169 (29.59%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---------------MDDG-------EKGHSHNGHNKMVWKSLVALIGIHLFFLTERITIL 882
            L+  +F  LCP+++ Q+ +R C  + ++    + P   T S  I      W+  F A+ +IS + LL V L+P+M + ++  +   L+ALAVG+L+GDA LHL+PH+                M  G        +    + +    WK L AL G++  FL E +  L
Sbjct:  282 LNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPP--KTYSLQI-----AWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTL 443          
BLAST of slc39a-4 vs. Ensembl Human
Match: SLC39A6 (solute carrier family 39 member 6 [Source:HGNC Symbol;Acc:HGNC:18607])

HSP 1 Score: 164.851 bits (416), Expect = 2.190e-41
Identity = 80/161 (49.69%), Postives = 111/161 (68.94%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI--LFLWQNIGFVIGSAIMLVIALYE 2106
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM+++ A+ YN +S++   +GM  G+ +G    ++S WIF LTAG+F+Y+ALVDM+PE+    L  +   H  S    F  QN G ++G  IML+I+++E
Sbjct:  590 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEM----LHNDASDHGCSRWGYFFLQNAGMLLGFGIMLLISIFE 746          

HSP 2 Score: 55.4546 bits (132), Expect = 4.405e-7
Identity = 50/169 (29.59%), Postives = 82/169 (48.52%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---------------MDDG-------EKGHSHNGHNKMVWKSLVALIGIHLFFLTERITIL 882
            L+  +F  LCP+++ Q+ +R C  + ++    + P   T S  I      W+  F A+ +IS + LL V L+P+M + ++  +   L+ALAVG+L+GDA LHL+PH+                M  G        +    + +    WK L AL G++  FL E +  L
Sbjct:  282 LNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPP--KTYSLQI-----AWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDSTWKGLTALGGLYFMFLVEHVLTL 443          
BLAST of slc39a-4 vs. Ensembl Human
Match: SLC39A12 (solute carrier family 39 member 12 [Source:HGNC Symbol;Acc:HGNC:20860])

HSP 1 Score: 154.066 bits (388), Expect = 9.872e-39
Identity = 71/158 (44.94%), Postives = 113/158 (71.52%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            ++  +A  ++ GD LHNF DG+AIGAAF++    G++T IA+LCHE+PHE+GDF VLL +G+S++TAI  N +SS+   +G+ IG+ +   P +  WIF +TAGMFLY++LV+M+PE++  + +      RP ++FL QN G ++G   +L++A+YE+
Sbjct:  402 AISLLAIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMKTAILMNFISSLTAFMGLYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQ------RPWMMFLLQNFGLILGWLSLLLLAIYEQ 553          

HSP 2 Score: 70.0922 bits (170), Expect = 1.139e-11
Identity = 59/172 (34.30%), Postives = 84/172 (48.84%), Query Frame = 1
Query:  391 CHSPIQMLSWF-NKTKSGLSKEDFITLCPSLLVQMVSRVCR-PNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL----MDDGEKGHSHN--GHNKMVWKSLVALIGIHLFFLTERITIL 882
            C S  Q++  F  K  S +SKEDF  + P ++ Q++S  C  P   Q   P   +       +    A+ L + G+++  +LV            +  Y  I QL + LAVG+L+GDALLHLIP  L     +  E GH H   GH   +WK +  + GIH FFL E+  IL
Sbjct:  176 CFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCHLPKDQQAKLPPTTLEKYGYSTV----AVTLLTLGSMLGTALVLFHSC-------EENYRLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAPEFGHFHESKGH---IWKLMGLIGGIHGFFLIEKCFIL 333          
BLAST of slc39a-4 vs. Ensembl Celegans
Match: zipt-15 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:U4PS08])

HSP 1 Score: 148.288 bits (373), Expect = 2.363e-39
Identity = 74/161 (45.96%), Postives = 107/161 (66.46%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-PSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLW-QNIGFVIGSAIMLVIALYEE 2109
            S++ A+A+ ++ GDGLHNF DGI+IGAAFA  +  GLS ++AVLC E PHELGD  +L+ +GM+L+ A+ YNL+S++ C +G  IGV +G+L P  S + F L  GMFLYI+L  MMPE+     +   +  R  I  L+ Q++G   G  +M ++A Y E
Sbjct:  132 SAIAAVAWMIVFGDGLHNFIDGISIGAAFAESLHSGLSISLAVLCEEFPHELGDVAILVASGMTLKQALIYNLLSAITCYVGFFIGVGIGELGPDTSKYAFGLAGGMFLYISLACMMPEMKKAMEEALNVSLRHGIYVLFLQSVGLFSGLTLMYIMARYGE 292          
BLAST of slc39a-4 vs. Ensembl Celegans
Match: zipt-15 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:U4PS08])

HSP 1 Score: 149.058 bits (375), Expect = 1.584e-38
Identity = 74/161 (45.96%), Postives = 107/161 (66.46%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-PSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLW-QNIGFVIGSAIMLVIALYEE 2109
            S++ A+A+ ++ GDGLHNF DGI+IGAAFA  +  GLS ++AVLC E PHELGD  +L+ +GM+L+ A+ YNL+S++ C +G  IGV +G+L P  S + F L  GMFLYI+L  MMPE+     +   +  R  I  L+ Q++G   G  +M ++A Y E
Sbjct:  249 SAIAAVAWMIVFGDGLHNFIDGISIGAAFAESLHSGLSISLAVLCEEFPHELGDVAILVASGMTLKQALIYNLLSAITCYVGFFIGVGIGELGPDTSKYAFGLAGGMFLYISLACMMPEMKKAMEEALNVSLRHGIYVLFLQSVGLFSGLTLMYIMARYGE 409          
BLAST of slc39a-4 vs. Ensembl Celegans
Match: zipt-17 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q9XVR4])

HSP 1 Score: 117.087 bits (292), Expect = 6.786e-28
Identity = 63/160 (39.38%), Postives = 98/160 (61.25%), Query Frame = 1
Query: 1627 DLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++  +K  A  ++ GDG+HN  DG+A+GA+F   +  G  T IAV+CHELPHE+GD  VL+ +G+S+ TA+  NL+S++    G+ I + LG+   I + +  +TAGMFLY+A VDM+  L    L  +  +   SIL   Q  GF +G A++  +  +E
Sbjct:  226 EICGLKPRALIILFGDGVHNLVDGLAMGASFMISVKLGFITTIAVICHELPHEIGDLAVLIDSGLSMCTALILNLLSALTAYAGLFIAIVLGRDEEIETILLAITAGMFLYVAWVDMLSHLKHDSLMADH-WMVTSIL---QLSGFTLGFALIFGLGWFE 381          
BLAST of slc39a-4 vs. Ensembl Celegans
Match: zipt-16 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q8I4G0])

HSP 1 Score: 96.6709 bits (239), Expect = 1.551e-20
Identity = 53/157 (33.76%), Postives = 92/157 (58.60%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-PSISSWIFMLTAGMFLYIALVDMMPEL--STRRLKGNKIFHRPSILF-LWQNIGFVIGSAIMLVIA 2097
            V ++AY +I G   +NF DG+++GAAF++++  GLS  IAV+  + P ELG   +L+ +G+ L+  + +N++  V   +G  IGV L  +  S   +IF +++GM++YI L  ++PE+  ST  L    +    SIL  + Q  G + G+  M  ++
Sbjct:  344 VASVAYMIIFGSSANNFVDGMSMGAAFSDNLLRGLSIGIAVISQQFPQELGTLAILVKSGLGLKKTLLFNMVPIVLSFLGFSIGVMLDSVDDSYDEYIFAISSGMYMYIFLGTLIPEIRESTNELIKENL--AESILVSILQACGILFGTTFMYFMS 498          
BLAST of slc39a-4 vs. Ensembl Celegans
Match: zipt-16 (Zrt (ZRT), Irt-(IRT-) like Protein Transporter [Source:UniProtKB/TrEMBL;Acc:Q8I4G0])

HSP 1 Score: 96.6709 bits (239), Expect = 1.551e-20
Identity = 53/157 (33.76%), Postives = 92/157 (58.60%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-PSISSWIFMLTAGMFLYIALVDMMPEL--STRRLKGNKIFHRPSILF-LWQNIGFVIGSAIMLVIA 2097
            V ++AY +I G   +NF DG+++GAAF++++  GLS  IAV+  + P ELG   +L+ +G+ L+  + +N++  V   +G  IGV L  +  S   +IF +++GM++YI L  ++PE+  ST  L    +    SIL  + Q  G + G+  M  ++
Sbjct:  344 VASVAYMIIFGSSANNFVDGMSMGAAFSDNLLRGLSIGIAVISQQFPQELGTLAILVKSGLGLKKTLLFNMVPIVLSFLGFSIGVMLDSVDDSYDEYIFAISSGMYMYIFLGTLIPEIRESTNELIKENL--AESILVSILQACGILFGTTFMYFMS 498          
BLAST of slc39a-4 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0331418)

HSP 1 Score: 181.415 bits (459), Expect = 1.864e-47
Identity = 82/157 (52.23%), Postives = 114/157 (72.61%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++ A+A+ +I GDGLHNF DG+AIGAAFA +I GG ST++AV CHELPHELGDF +L+ AGMS+++A++YNL++ V   IGM+ G+  G+   ++ W+F + AG+F+YIALVDMMPE+S          H+    FL Q +G + G  IML+IALYE
Sbjct:  539 TLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISAS--------HKSLGQFLLQILGMLSGVGIMLLIALYE 687          

HSP 2 Score: 73.1738 bits (178), Expect = 6.688e-13
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSR---VCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLR---SKRKSKKQHFLKLLTKKLSLENFYSEASAGDKF 996
            LS +D + LCP LL ++ ++      P +   +   + +         +   +W+ +F +V    ++GL+ V +IP M   YY  I Q L+ALAVG++ GDALLHL+PH+L    E+G        M+ K L  L GI  F++ E    +    R    K+++KK    K++    S  N    + AGDK 
Sbjct:  210 LSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKD--KDIFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQDERG--------MIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVN---NSVAGDKI 387          
BLAST of slc39a-4 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0345601)

HSP 1 Score: 181.415 bits (459), Expect = 1.864e-47
Identity = 82/157 (52.23%), Postives = 114/157 (72.61%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++ A+A+ +I GDGLHNF DG+AIGAAFA +I GG ST++AV CHELPHELGDF +L+ AGMS+++A++YNL++ V   IGM+ G+  G+   ++ W+F + AG+F+YIALVDMMPE+S          H+    FL Q +G + G  IML+IALYE
Sbjct:  539 TLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISAS--------HKSLGQFLLQILGMLSGVGIMLLIALYE 687          

HSP 2 Score: 73.1738 bits (178), Expect = 6.688e-13
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSR---VCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLR---SKRKSKKQHFLKLLTKKLSLENFYSEASAGDKF 996
            LS +D + LCP LL ++ ++      P +   +   + +         +   +W+ +F +V    ++GL+ V +IP M   YY  I Q L+ALAVG++ GDALLHL+PH+L    E+G        M+ K L  L GI  F++ E    +    R    K+++KK    K++    S  N    + AGDK 
Sbjct:  210 LSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKD--KDIFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQDERG--------MIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVN---NSVAGDKI 387          
BLAST of slc39a-4 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0331417)

HSP 1 Score: 181.415 bits (459), Expect = 1.864e-47
Identity = 82/157 (52.23%), Postives = 114/157 (72.61%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++ A+A+ +I GDGLHNF DG+AIGAAFA +I GG ST++AV CHELPHELGDF +L+ AGMS+++A++YNL++ V   IGM+ G+  G+   ++ W+F + AG+F+YIALVDMMPE+S          H+    FL Q +G + G  IML+IALYE
Sbjct:  539 TLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISAS--------HKSLGQFLLQILGMLSGVGIMLLIALYE 687          

HSP 2 Score: 73.1738 bits (178), Expect = 6.688e-13
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSR---VCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLR---SKRKSKKQHFLKLLTKKLSLENFYSEASAGDKF 996
            LS +D + LCP LL ++ ++      P +   +   + +         +   +W+ +F +V    ++GL+ V +IP M   YY  I Q L+ALAVG++ GDALLHL+PH+L    E+G        M+ K L  L GI  F++ E    +    R    K+++KK    K++    S  N    + AGDK 
Sbjct:  210 LSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKD--KDIFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQDERG--------MIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVN---NSVAGDKI 387          
BLAST of slc39a-4 vs. Ensembl Fly
Match: foi (gene:FBgn0024236 transcript:FBtr0076624)

HSP 1 Score: 181.415 bits (459), Expect = 1.864e-47
Identity = 82/157 (52.23%), Postives = 114/157 (72.61%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++ A+A+ +I GDGLHNF DG+AIGAAFA +I GG ST++AV CHELPHELGDF +L+ AGMS+++A++YNL++ V   IGM+ G+  G+   ++ W+F + AG+F+YIALVDMMPE+S          H+    FL Q +G + G  IML+IALYE
Sbjct:  539 TLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISAS--------HKSLGQFLLQILGMLSGVGIMLLIALYE 687          

HSP 2 Score: 73.1738 bits (178), Expect = 6.688e-13
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSR---VCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLR---SKRKSKKQHFLKLLTKKLSLENFYSEASAGDKF 996
            LS +D + LCP LL ++ ++      P +   +   + +         +   +W+ +F +V    ++GL+ V +IP M   YY  I Q L+ALAVG++ GDALLHL+PH+L    E+G        M+ K L  L GI  F++ E    +    R    K+++KK    K++    S  N    + AGDK 
Sbjct:  210 LSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKD--KDIFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQDERG--------MIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVN---NSVAGDKI 387          
BLAST of slc39a-4 vs. Ensembl Fly
Match: Zip71B (gene:FBgn0036461 transcript:FBtr0113171)

HSP 1 Score: 142.895 bits (359), Expect = 2.512e-35
Identity = 74/159 (46.54%), Postives = 101/159 (63.52%), Query Frame = 1
Query: 1648 IAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-PSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL-----FLWQNIGFVIGSAIMLVIALYE 2106
            +A+ VI GDGLHN  DG+AIGAAFA+D   G +TA AVLCHELPHELGDF +LL  G+S+R A++ N++SSV   +GM +G+ +  +   ++ WI+  TAG FLYIA  D++P +S        + H P         + Q  G ++G  IML IAL E
Sbjct:  412 VAFMVIIGDGLHNLTDGLAIGAAFASDPVTGFATAFAVLCHELPHELGDFALLLQTGVSMRRAVYMNIVSSVLSFVGMSVGLFIAGIGDGMTQWIYAATAGSFLYIAFADLVPTMS--------VAHNPEKAKDPKGIIIQIFGILLGGLIMLAIALNE 562          

HSP 2 Score: 58.9214 bits (141), Expect = 1.804e-8
Identity = 56/192 (29.17%), Postives = 102/192 (53.12%), Query Frame = 1
Query:  268 KNSSDNMSAFLSSEGFSSLILK-------LGLRK---RNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM 813
            + SS+ ++A LS +   SLI+        +  RK   +N++S T + V    +S  +   + N  +  ++   F+ LCP+LL Q+ + VC+    QP      +N+ +  +       W+ +   ++++S  GLL + L+P+M  + Y  I + L+++AVG+LAGDAL+HL+PHAL  + +      G N +
Sbjct:  139 RESSEPVAACLSPKSLLSLIVNHNDLHKNIAYRKLLIKNDVSST-DGVH---NSEEEYNEFINSVR--ITPRAFMKLCPALLAQIDNGVCK----QPAVRSVNLNDKNQKI----WYAWIYASITMLILSACGLLGILLVPLMKSAAYQEILKFLVSIAVGTLAGDALMHLLPHALFKEEKHEEEVTGINPL 316          
BLAST of slc39a-4 vs. Ensembl Zebrafish
Match: slc39a10 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:393644])

HSP 1 Score: 185.652 bits (470), Expect = 4.066e-48
Identity = 88/163 (53.99%), Postives = 122/163 (74.85%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEEH 2112
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++    GMVIG  +G+   +++SWIF +TAGMFLY+ALVDM+PE+    L G+   H+   +  F+ QN G + G  IML+IA++E+H
Sbjct:  682 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYAGMVIGTAVGQYTHNVTSWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRCEMGHFVLQNFGMLTGFGIMLLIAIFEDH 840          

HSP 2 Score: 73.9442 bits (180), Expect = 5.871e-13
Identity = 60/188 (31.91%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM--------------VWKSLVALIGIHLFFLTERITILYQNLRSKR 906
            +C +  Q+L  +   + S +S   F  LCP+LL Q+  R C  +                 V  ++  +W+  F ++ +ISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+  D     H HN   +M              VWK L AL GI+L F+ E    ++++   +R
Sbjct:  382 ECLNLTQLLHQYGLSSDSLISPVQFTYLCPALLYQIDRRFCILHYHHV--------EAEEQVAPSSGWVWMWGFVSITIISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHSQGD-----HDHNHGEQMEEEPEVDFLIKFDGVWKGLTALAGIYLLFIIEHCIGMFKHYSDQR 556          
BLAST of slc39a-4 vs. Ensembl Zebrafish
Match: slc39a10 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:393644])

HSP 1 Score: 184.882 bits (468), Expect = 7.557e-48
Identity = 88/163 (53.99%), Postives = 122/163 (74.85%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEEH 2112
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++    GMVIG  +G+   +++SWIF +TAGMFLY+ALVDM+PE+    L G+   H+   +  F+ QN G + G  IML+IA++E+H
Sbjct:  726 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYAGMVIGTAVGQYTHNVTSWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRCEMGHFVLQNFGMLTGFGIMLLIAIFEDH 884          

HSP 2 Score: 73.9442 bits (180), Expect = 5.683e-13
Identity = 60/188 (31.91%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM--------------VWKSLVALIGIHLFFLTERITILYQNLRSKR 906
            +C +  Q+L  +   + S +S   F  LCP+LL Q+  R C  +                 V  ++  +W+  F ++ +ISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+  D     H HN   +M              VWK L AL GI+L F+ E    ++++   +R
Sbjct:  426 ECLNLTQLLHQYGLSSDSLISPVQFTYLCPALLYQIDRRFCILHYHHV--------EAEEQVAPSSGWVWMWGFVSITIISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHSQGD-----HDHNHGEQMEEEPEVDFLIKFDGVWKGLTALAGIYLLFIIEHCIGMFKHYSDQR 600          
BLAST of slc39a-4 vs. Ensembl Zebrafish
Match: slc39a6 (solute carrier family 39 member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-3023])

HSP 1 Score: 175.252 bits (443), Expect = 3.985e-45
Identity = 83/160 (51.88%), Postives = 114/160 (71.25%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGMS+R A+ YNL+S++   +GM+IG+ +G    ++++WIF LTAG+F+Y+ALVDM+PE+           H     FL QN G ++G  IML+IA++E+
Sbjct:  577 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMSVRQAMLYNLLSALMGYLGMIIGILIGHYAENVATWIFALTAGLFMYVALVDMVPEMLHNDASEAGFSHYG--FFLLQNAGILLGFGIMLIIAVFED 734          

HSP 2 Score: 62.003 bits (149), Expect = 2.641e-9
Identity = 67/218 (30.73%), Postives = 102/218 (46.79%), Query Frame = 1
Query:  427 KTKSGLSKEDFITLCPSLLVQMVSRVC------------------RPNVTQPMKPMKPMNNTSSPVINNN--LAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN----KMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSE 1008
            + ++ LS +DF  LCP+LL+Q+ S+ C                    +         P N+T+     N      WL  F ++ +ISL+ L+ V LIP+M +  +N +   L+ALAVG+L+GDALLHLIPH+           +       + VW  L AL G+++ FL E    L +  + K + K Q  + L T+ L  E   S      K E +E
Sbjct:  278 RKEASLSVKDFSFLCPALLMQIDSKSCIVHEDEDEHSDHSHHHKHHHHHHDHQHLQHPHNHTNGRGQRNTPVYIAWLGGFLSITLISLLALVGVVLIPLMNRVCFNFLLSFLVALAVGTLSGDALLHLIPHSQGHHHHGHSEEHAEEEDSLRPVWTGLTALSGVYIMFLIEHFLTLGKMYKDKNQ-KVQKRVDLTTEVLESEKLPSLEENDVKIEAAE 494          
BLAST of slc39a-4 vs. Ensembl Zebrafish
Match: BX119991.1 (solute carrier family 39 member 5 [Source:NCBI gene;Acc:561758])

HSP 1 Score: 152.91 bits (385), Expect = 2.201e-38
Identity = 78/161 (48.45%), Postives = 106/161 (65.84%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLG-KLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            + ++++A+ V+ GDG+HN  DG+AIG AF+  + GG STAIAV CHELPHELGD  VLL AG  +R  + ++ +S++   +G++ G  LG    S S WI  LTAG+FLY+AL DMMPE+    L G      P   FL Q +G + G AIML IAL+E+H
Sbjct:  414 TGIRSMAWMVVMGDGIHNLTDGLAIGVAFSQSLTGGFSTAIAVFCHELPHELGDLAVLLSAGWPVRRLLVFSGLSALLGFVGVLAGSALGNHWASHSPWILTLTAGVFLYVALADMMPEM----LHGACGSVSPLKRFLLQALGLLTGGAIMLCIALFEDH 570          

HSP 2 Score: 60.4622 bits (145), Expect = 7.799e-9
Identity = 67/228 (29.39%), Postives = 106/228 (46.49%), Query Frame = 1
Query:  265 LKNSSDNMSAFLSSE---GFSSLILKLGLRKRNNIS-------KTFNNVSIKCHSPIQMLSWFNKTK-SGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSK 915
            L+ S D  SA   S    G S   L   LR +   S        T  ++   C +  Q+L  F   + S ++   F  LCP+LL Q+ S VC       ++  +  + TS       +A+   S  A++VISL  L+ + + P++  S        +  +AVG+L GDALLHL+PHA+         H  H   V+K L  L G++L F+ E +  L Q+ ++ ++ K
Sbjct:  163 LRESLDAKSALSGSPAELGRSDYFLHPALRNKQEESVSLLSDHPTEKHLHGNCLNVTQLLWNFGLGQASHITPAHFTFLCPALLYQIESGVC-------LRHTEDHSQTSKTSEGFLIALGWASL-ALLVISLPSLVALGMAPLLQPSVLQVFLCPMAGMAVGTLCGDALLHLMPHAIFSQ------HTDHQNAVFKGLSVLGGLYLLFIFESLLGLKQHFKNLKRRK 376          
BLAST of slc39a-4 vs. Ensembl Zebrafish
Match: slc39a5 (solute carrier family 39 member 5 [Source:ZFIN;Acc:ZDB-GENE-060608-1])

HSP 1 Score: 152.14 bits (383), Expect = 2.755e-38
Identity = 78/161 (48.45%), Postives = 106/161 (65.84%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLG-KLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            + ++++A+ V+ GDG+HN  DG+AIG AF+  + GG STAIAV CHELPHELGD  VLL AG  +R  + ++ +S++   +G++ G  LG    S S WI  LTAG+FLY+AL DMMPE+    L G      P   FL Q +G + G AIML IAL+E+H
Sbjct:  386 TGIRSMAWMVVMGDGIHNLTDGLAIGVAFSQSLTGGFSTAIAVFCHELPHELGDLAVLLSAGWPVRRLLVFSGLSALLGFVGVLAGSALGNHWASHSPWILTLTAGVFLYVALADMMPEM----LHGACGSVSPLKRFLLQALGLLTGGAIMLCIALFEDH 542          

HSP 2 Score: 60.8474 bits (146), Expect = 5.614e-9
Identity = 62/228 (27.19%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  265 LKNSSDNMSAFLSSE---GFSSLILKLGLRKRNNIS-------KTFNNVSIKCHSPIQMLSWFNKTK-SGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSK 915
            L+ S D  SA   S    G S   L   LR +   S        T  ++   C +  Q+L  F   + S ++   F  LCP+LL Q+ S VC  +     +  K        +   +LA+ + S           L+ + + P++  S        +  +AVG+L GDALLHL+PHA+         H  H   V+K L  L G++L F+ E +  L Q+ ++ ++ K
Sbjct:  135 LRESLDAKSALSGSPAELGRSDYFLHPALRNKQEESVSLLSDHPTEKHLHGNCLNVTQLLWNFGLGQASHITPAHFTFLCPALLYQIESGVCLRHTEDHSQASKTSEGFLIALGWASLALLVISL--------PSLVALGMAPLLQPSVLQVFLCPMAGMAVGTLCGDALLHLMPHAIFSQ------HTDHQNAVFKGLSVLGGLYLLFIFESLLGLKQHFKNLKRRK 348          
BLAST of slc39a-4 vs. Ensembl Xenopus
Match: ENSXETT00000051316.1 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:100493171])

HSP 1 Score: 181.415 bits (459), Expect = 1.235e-46
Identity = 84/160 (52.50%), Postives = 119/160 (74.38%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + + +IA+ VI GDG+HNF DG+AIGAAF+  I GG+ST++AV CHELPHELGDF VLL AGM+++ AI YNL+S++   +GM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+     +  +  H     F+ +N+G ++G  IML+IALYE+
Sbjct:  667 TGIASIAWMVIMGDGMHNFSDGLAIGAAFSAGITGGISTSVAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYVGMLIGTAVGQYANNITLWIFAITAGMFLYVALVDMLPEMLHGDGEHEENGHCAVGQFILKNLGLLLGFTIMLLIALYED 826          

HSP 2 Score: 74.7146 bits (182), Expect = 5.644e-13
Identity = 72/224 (32.14%), Postives = 113/224 (50.45%), Query Frame = 1
Query:  391 CHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL--MDDGEKG--HSHNGHNKM---------------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFED 1002
            C +  Q+L ++     S +S + F  +CP+L+ Q+ SR+C       +K    +   +        + W+C   ++ VISL+ LL V LIPI+ +  +  +   L+ALAVG+L+GDALLHL+PH+    D G +   HSH  HN                 V K LVAL GI+L F+ E    ++++ + +R  K+    K L +K  L+    EA+ G K  D
Sbjct:  347 CLNITQLLHYYGLNANSPISPDQFAYICPALVYQIDSRLC-------IKHFSDLQVENVEKSKAGASAWICGLISITVISLLSLLGVILIPIINQGCFKYLLNFLVALAVGTLSGDALLHLLPHSQGGHDHGTEAPNHSHE-HNHESLHSEDQSFLSEYDGVMKGLVALGGIYLLFIVENCLWMFKHYK-ERMGKR----KWLKRKQKLD----EAAVGRKLSD 553          
BLAST of slc39a-4 vs. Ensembl Xenopus
Match: ENSXETT00000051324.1 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:100493171])

HSP 1 Score: 181.03 bits (458), Expect = 1.351e-46
Identity = 84/160 (52.50%), Postives = 119/160 (74.38%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + + +IA+ VI GDG+HNF DG+AIGAAF+  I GG+ST++AV CHELPHELGDF VLL AGM+++ AI YNL+S++   +GM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+     +  +  H     F+ +N+G ++G  IML+IALYE+
Sbjct:  649 TGIASIAWMVIMGDGMHNFSDGLAIGAAFSAGITGGISTSVAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYVGMLIGTAVGQYANNITLWIFAITAGMFLYVALVDMLPEMLHGDGEHEENGHCAVGQFILKNLGLLLGFTIMLLIALYED 808          

HSP 2 Score: 74.7146 bits (182), Expect = 5.339e-13
Identity = 72/224 (32.14%), Postives = 113/224 (50.45%), Query Frame = 1
Query:  391 CHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL--MDDGEKG--HSHNGHNKM---------------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFED 1002
            C +  Q+L ++     S +S + F  +CP+L+ Q+ SR+C       +K    +   +        + W+C   ++ VISL+ LL V LIPI+ +  +  +   L+ALAVG+L+GDALLHL+PH+    D G +   HSH  HN                 V K LVAL GI+L F+ E    ++++ + +R  K+    K L +K  L+    EA+ G K  D
Sbjct:  329 CLNITQLLHYYGLNANSPISPDQFAYICPALVYQIDSRLC-------IKHFSDLQVENVEKSKAGASAWICGLISITVISLLSLLGVILIPIINQGCFKYLLNFLVALAVGTLSGDALLHLLPHSQGGHDHGTEAPNHSHE-HNHESLHSEDQSFLSEYDGVMKGLVALGGIYLLFIVENCLWMFKHYK-ERMGKR----KWLKRKQKLD----EAAVGRKLSD 535          
BLAST of slc39a-4 vs. Ensembl Xenopus
Match: rabl6 (RAB, member RAS oncogene family like 6 [Source:Xenbase;Acc:XB-GENE-1014126])

HSP 1 Score: 152.91 bits (385), Expect = 2.333e-42
Identity = 69/151 (45.70%), Postives = 101/151 (66.89%), Query Frame = 1
Query: 1660 VIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            +  GD +HNF DG+AIGAAF+     GL+T++AVLCHELPHELGDF  LLHAG+ +R A+  N  S++   IG+ I + +    ++  WIF +  G+FLY+AL DM+P +   +L      HRP ILF   N+G ++G  I+L+++LYE++
Sbjct:    2 ITIGDAIHNFADGLAIGAAFSTSWKTGLATSLAVLCHELPHELGDFAALLHAGLRVRWALLLNFSSALTAFIGLYISLSISADEAVQQWIFTVATGLFLYVALADMLPAMMNVKL------HRPWILFFLHNLGILLGWVILLILSLYEDN 146          
BLAST of slc39a-4 vs. Ensembl Xenopus
Match: tmem135 (transmembrane protein 135 [Source:Xenbase;Acc:XB-GENE-954105])

HSP 1 Score: 154.451 bits (389), Expect = 8.592e-39
Identity = 74/158 (46.84%), Postives = 107/158 (67.72%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIG-VQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            +  I + V+ GDG+HNF DG+AIGAAF++   GGLST +AV CHELPHELGDF VLL +G+ +R  +F++L+S+     GM+IG V       I+ WIF  TAG+FLY+ALVDM+P++  R    +    +  ++    ++GF++G AIM  IALY++
Sbjct:  417 ITEIVWMVLLGDGIHNFTDGLAIGAAFSSGFSGGLSTTVAVFCHELPHELGDFAVLLQSGVPVRKVLFFSLVSAFLSFFGMIIGAVASQNSAQITPWIFAATAGIFLYVALVDMLPQMLHRE-TADPCQGKDCVI---HSLGFLLGCAIMFCIALYQD 570          

HSP 2 Score: 70.8626 bits (172), Expect = 5.698e-12
Identity = 62/174 (35.63%), Postives = 89/174 (51.15%), Query Frame = 1
Query:  412 LSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN---KMVWKSLVALIGIHLFFLTERIT-ILYQNLRSKRKSKKQ 921
            LSW     S ++ + F  LCP+LL Q+ SRVC       +     + N+        L +      AV VIS   LL V  +P++ +  +  + + L+ALAVG+L GDALLHL+PHA  D    G+ H G     + V K L  L G++L FL E +  +L Q  + KR SK +
Sbjct:  189 LSWV----SAITPQQFSLLCPALLYQIDSRVC-------IHHSDELTNSKPDSKQALLQVLGWGALAVTVISAPSLLAVAFVPLLRRPLFRYLLRFLVALAVGTLCGDALLHLMPHAQED--HTGNQHGGKTHAIEPVLKGLSVLGGLYLLFLIENLMGLLKQRQQLKRLSKPE 349          
BLAST of slc39a-4 vs. Ensembl Xenopus
Match: tmem135 (transmembrane protein 135 [Source:Xenbase;Acc:XB-GENE-954105])

HSP 1 Score: 154.451 bits (389), Expect = 1.229e-38
Identity = 74/158 (46.84%), Postives = 107/158 (67.72%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIG-VQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            +  I + V+ GDG+HNF DG+AIGAAF++   GGLST +AV CHELPHELGDF VLL +G+ +R  +F++L+S+     GM+IG V       I+ WIF  TAG+FLY+ALVDM+P++  R    +    +  ++    ++GF++G AIM  IALY++
Sbjct:  458 ITEIVWMVLLGDGIHNFTDGLAIGAAFSSGFSGGLSTTVAVFCHELPHELGDFAVLLQSGVPVRKVLFFSLVSAFLSFFGMIIGAVASQNSAQITPWIFAATAGIFLYVALVDMLPQMLHRE-TADPCQGKDCVI---HSLGFLLGCAIMFCIALYQD 611          

HSP 2 Score: 70.4774 bits (171), Expect = 7.870e-12
Identity = 62/174 (35.63%), Postives = 89/174 (51.15%), Query Frame = 1
Query:  412 LSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN---KMVWKSLVALIGIHLFFLTERIT-ILYQNLRSKRKSKKQ 921
            LSW     S ++ + F  LCP+LL Q+ SRVC       +     + N+        L +      AV VIS   LL V  +P++ +  +  + + L+ALAVG+L GDALLHL+PHA  D    G+ H G     + V K L  L G++L FL E +  +L Q  + KR SK +
Sbjct:  230 LSWV----SAITPQQFSLLCPALLYQIDSRVC-------IHHSDELTNSKPDSKQALLQVLGWGALAVTVISAPSLLAVAFVPLLRRPLFRYLLRFLVALAVGTLCGDALLHLMPHAQED--HTGNQHGGKTHAIEPVLKGLSVLGGLYLLFLIENLMGLLKQRQQLKRLSKPE 390          
BLAST of slc39a-4 vs. Ensembl Mouse
Match: Slc39a10 (solute carrier family 39 (zinc transporter), member 10 [Source:MGI Symbol;Acc:MGI:1914515])

HSP 1 Score: 182.185 bits (461), Expect = 4.416e-47
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + +  IA+ VI GDG+HNF DG+AIGAAF+  + GG+ST+IAV CHELPHELGDF VLL AGM+++ AI YNL+S++   IGM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+        +    P   F+ QN+G + G AIMLVIALYE+
Sbjct:  666 TGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAITAGMFLYVALVDMLPEMLHGDGDHEEHGFCPVGQFILQNLGLLFGFAIMLVIALYED 825          

HSP 2 Score: 72.7886 bits (177), Expect = 1.594e-12
Identity = 65/214 (30.37%), Postives = 107/214 (50.00%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNL--AIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN------------------------KMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKK 948
            +C +  Q+L  F     S +S + F  LCP+LL Q+ SR+C  +  + +      + T  P    N+  + W+C   ++ VISL+ LL V L+PI+ +  +  +   L+ALAVG+++GDALLHL+P          HS  GH+                          V K LVAL GI+L F+ E    ++++ + +R  K++ F+K  T++
Sbjct:  338 ECLNVTQLLKHFGLGPNSPISPDLFTYLCPALLYQIDSRLCIEHFDKLLVEDLNKDKTLVPEDKTNIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLP----------HSQGGHDHSHQHTHGHGHSHGHESKEFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR-GKQKWFMKQSTEE 540          
BLAST of slc39a-4 vs. Ensembl Mouse
Match: Slc39a6 (solute carrier family 39 (metal ion transporter), member 6 [Source:MGI Symbol;Acc:MGI:2147279])

HSP 1 Score: 164.466 bits (415), Expect = 1.978e-41
Identity = 79/161 (49.07%), Postives = 111/161 (68.94%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI--LFLWQNIGFVIGSAIMLVIALYE 2106
            + +  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM+++ A+ YN +S++   +GM  G+ +G    ++S WIF LTAG+F+Y+ALVDM+PE+    L  +   H  S    F  QN G ++G  IML+I+++E
Sbjct:  600 AGIATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEM----LHNDASDHGCSRWGYFFLQNAGILLGFGIMLLISIFE 756          

HSP 2 Score: 61.2326 bits (147), Expect = 5.538e-9
Identity = 56/199 (28.14%), Postives = 90/199 (45.23%), Query Frame = 1
Query:  352 NNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---------------MDDG-------EKGHSHNGHNKMVWKSLVALIGIHLFFLTERITIL 882
            +NI + FN   +     + + +  N T       +F  LCP+++ Q+ +R C  +     K   P    S  +       WL  F A+ +IS + LL V L+P+M + ++  +   L+ALAVG+L+GDALLHL+PH+                M  G        +    + +    WK L AL G++  FL E +  L
Sbjct:  268 DNIQECFNTTKLLTSHGMSIQALLNAT-------EFNYLCPAIINQIDARACLIHTASEKKAEIPPKTYSLQIA------WLGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDALLHLLPHSHASHQHSHSHEEPAMEMKRGPLFSHLSAQNIEESSYFDSTWKGLTALGGLYFMFLVEHVLTL 453          
BLAST of slc39a-4 vs. Ensembl Mouse
Match: Slc39a12 (solute carrier family 39 (zinc transporter), member 12 [Source:MGI Symbol;Acc:MGI:2139274])

HSP 1 Score: 157.532 bits (397), Expect = 1.283e-39
Identity = 69/158 (43.67%), Postives = 109/158 (68.99%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            ++  +A  ++ GD LHNF DG+ IG AF++ +  G++T IA+LCHE+PHE+GDF VLL +G+S+RTAI  N +S++    G+ IG+ +   P +  WI  +TAGMFLY++LV M+PE++  + +      RP + FL QN+G V+G   +L++A+YE+
Sbjct:  498 TISLLAIMILVGDSLHNFADGLVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLLSSGLSVRTAILMNFLSALTAFAGLYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPEMTHVQTQ------RPWMTFLLQNVGLVLGWFSLLLLAVYEQ 649          

HSP 2 Score: 72.4034 bits (176), Expect = 1.762e-12
Identity = 63/177 (35.59%), Postives = 91/177 (51.41%), Query Frame = 1
Query:  391 CHSPIQMLSWFNKTKSGLS--KEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---MDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKR 906
            C S  Q++  F +  S LS  KEDF  L P ++ Q++S  C+    Q  KP  P   T      + +A+ L + G+++  +LV            +  Y+ I QL + LAVG+L+GDALLHLIP  L     + E GH H   +  +WK L  L GIH FFL E+  IL  +  +K+
Sbjct:  309 CFSARQLVEIFLQNHSSLSISKEDFKQLSPGIIQQLLSCSCQMPKDQQAKP-PP--TTLEKYGYSTVAVTLLTLGSMLGTALVLFHSC-------EENYSLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAEFGHFHESQSP-IWKLLGLLGGIHGFFLIEKCFILLVSPNTKK 474          
BLAST of slc39a-4 vs. Ensembl Mouse
Match: Slc39a12 (solute carrier family 39 (zinc transporter), member 12 [Source:MGI Symbol;Acc:MGI:2139274])

HSP 1 Score: 157.532 bits (397), Expect = 1.782e-39
Identity = 69/158 (43.67%), Postives = 109/158 (68.99%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            ++  +A  ++ GD LHNF DG+ IG AF++ +  G++T IA+LCHE+PHE+GDF VLL +G+S+RTAI  N +S++    G+ IG+ +   P +  WI  +TAGMFLY++LV M+PE++  + +      RP + FL QN+G V+G   +L++A+YE+
Sbjct:  534 TISLLAIMILVGDSLHNFADGLVIGTAFSSSLESGVTTTIAILCHEIPHEMGDFAVLLSSGLSVRTAILMNFLSALTAFAGLYIGLSVSADPRVQDWILTVTAGMFLYLSLVGMLPEMTHVQTQ------RPWMTFLLQNVGLVLGWFSLLLLAVYEQ 685          

HSP 2 Score: 72.0182 bits (175), Expect = 2.400e-12
Identity = 62/169 (36.69%), Postives = 87/169 (51.48%), Query Frame = 1
Query:  391 CHSPIQMLSWFNKTKSGLS--KEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---MDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITIL 882
            C S  Q++  F +  S LS  KEDF  L P ++ Q++S  C+    Q  KP  P   T      + +A+ L + G+++  +LV            +  Y+ I QL + LAVG+L+GDALLHLIP  L     + E GH H   +  +WK L  L GIH FFL E+  IL
Sbjct:  309 CFSARQLVEIFLQNHSSLSISKEDFKQLSPGIIQQLLSCSCQMPKDQQAKP-PP--TTLEKYGYSTVAVTLLTLGSMLGTALVLFHSC-------EENYSLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAEFGHFHESQSP-IWKLLGLLGGIHGFFLIEKCFIL 466          
BLAST of slc39a-4 vs. Ensembl Mouse
Match: Slc39a14 (solute carrier family 39 (zinc transporter), member 14 [Source:MGI Symbol;Acc:MGI:2384851])

HSP 1 Score: 153.295 bits (386), Expect = 5.164e-39
Identity = 74/159 (46.54%), Postives = 108/159 (67.92%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELS--TRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALY 2103
            S +  +A+ +   DGLHNF DG+AIGA+F   +  G+ST++A+LC E PHELGDFV+LL+AGMS++ A+F+N +S+  C +G+  G+  G   S ++WIF L  GMFLYIAL DM PE++   +  + N  F  P   F+ QN+G + G +IMLV+ +Y
Sbjct:  328 SDIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAGSHFS-ANWIFALAGGMFLYIALADMFPEMNEVCQEDEKNDSFLVP---FVIQNLGLLTGFSIMLVLTMY 482          

HSP 2 Score: 56.225 bits (134), Expect = 1.393e-7
Identity = 44/165 (26.67%), Postives = 77/165 (46.67%), Query Frame = 1
Query:  433 KSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHF 927
            +S +   +F   CP++L Q+ S+ C     +  +  +      S +      +W   F +V +I+L  LL V ++P   K++++ +    IAL++G+L  +AL  LIP A           N  +  V KS V   G +LFF TE+I  +    +++      HF
Sbjct:  104 RSQIGASEFQEFCPTILQQLDSQACTSENQKSEENEQTEEGKPSAI-----EVWGFGFLSVSLINLASLLGVLVLPCTEKAFFSRVLTYFIALSIGTLLSNALFQLIPEAF--------GFNPQDNYVSKSAVVFGGFYLFFFTEKILKMLLKQKNEHHHGHNHF 255          
BLAST of slc39a-4 vs. UniProt/SwissProt
Match: sp|Q6PEH9|S39AA_DANRE (Zinc transporter ZIP10 OS=Danio rerio OX=7955 GN=slc39a10 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 2.986e-47
Identity = 88/163 (53.99%), Postives = 122/163 (74.85%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEEH 2112
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++    GMVIG  +G+   +++SWIF +TAGMFLY+ALVDM+PE+    L G+   H+   +  F+ QN G + G  IML+IA++E+H
Sbjct:  682 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYAGMVIGTAVGQYTHNVTSWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRCEMGHFVLQNFGMLTGFGIMLLIAIFEDH 840          

HSP 2 Score: 73.9442 bits (180), Expect = 4.357e-12
Identity = 60/188 (31.91%), Postives = 95/188 (50.53%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM--------------VWKSLVALIGIHLFFLTERITILYQNLRSKR 906
            +C +  Q+L  +   + S +S   F  LCP+LL Q+  R C  +                 V  ++  +W+  F ++ +ISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+  D     H HN   +M              VWK L AL GI+L F+ E    ++++   +R
Sbjct:  382 ECLNLTQLLHQYGLSSDSLISPVQFTYLCPALLYQIDRRFCILHYHHV--------EAEEQVAPSSGWVWMWGFVSITIISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHSQGD-----HDHNHGEQMEEEPEVDFLIKFDGVWKGLTALAGIYLLFIIEHCIGMFKHYSDQR 556          
BLAST of slc39a-4 vs. UniProt/SwissProt
Match: sp|Q9VSL7|FOI_DROME (Zinc transporter foi OS=Drosophila melanogaster OX=7227 GN=foi PE=1 SV=3)

HSP 1 Score: 181.415 bits (459), Expect = 1.869e-46
Identity = 82/157 (52.23%), Postives = 114/157 (72.61%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            ++ A+A+ +I GDGLHNF DG+AIGAAFA +I GG ST++AV CHELPHELGDF +L+ AGMS+++A++YNL++ V   IGM+ G+  G+   ++ W+F + AG+F+YIALVDMMPE+S          H+    FL Q +G + G  IML+IALYE
Sbjct:  539 TLSAVAWMIIMGDGLHNFTDGMAIGAAFAENIAGGFSTSLAVFCHELPHELGDFAILIKAGMSVKSAVYYNLLTGVLSFIGMIFGIAFGQSQDVAQWMFAVAAGLFIYIALVDMMPEISAS--------HKSLGQFLLQILGMLSGVGIMLLIALYE 687          

HSP 2 Score: 73.1738 bits (178), Expect = 6.705e-12
Identity = 59/191 (30.89%), Postives = 94/191 (49.21%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSR---VCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLR---SKRKSKKQHFLKLLTKKLSLENFYSEASAGDKF 996
            LS +D + LCP LL ++ ++      P +   +   + +         +   +W+ +F +V    ++GL+ V +IP M   YY  I Q L+ALAVG++ GDALLHL+PH+L    E+G        M+ K L  L GI  F++ E    +    R    K+++KK    K++    S  N    + AGDK 
Sbjct:  210 LSDKDLLHLCPILLYELKAQSGGCIEPAILSDIDTTEELLEAEKD--KDIFYVWIYAFISVFACGILGLVGVAIIPFMGSRYYKYIIQYLVALAVGTMTGDALLHLLPHSLAGQDERG--------MIMKGLGCLGGIIFFYVMEHALTMISEWRKSVEKKETKKPSRAKVMRDPDSSVN---NSVAGDKI 387          
BLAST of slc39a-4 vs. UniProt/SwissProt
Match: sp|Q6P5F6|S39AA_MOUSE (Zinc transporter ZIP10 OS=Mus musculus OX=10090 GN=Slc39a10 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 3.089e-46
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + +  IA+ VI GDG+HNF DG+AIGAAF+  + GG+ST+IAV CHELPHELGDF VLL AGM+++ AI YNL+S++   IGM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+        +    P   F+ QN+G + G AIMLVIALYE+
Sbjct:  666 TGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAITAGMFLYVALVDMLPEMLHGDGDHEEHGFCPVGQFILQNLGLLFGFAIMLVIALYED 825          

HSP 2 Score: 72.7886 bits (177), Expect = 1.115e-11
Identity = 65/214 (30.37%), Postives = 107/214 (50.00%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNL--AIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN------------------------KMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKK 948
            +C +  Q+L  F     S +S + F  LCP+LL Q+ SR+C  +  + +      + T  P    N+  + W+C   ++ VISL+ LL V L+PI+ +  +  +   L+ALAVG+++GDALLHL+P          HS  GH+                          V K LVAL GI+L F+ E    ++++ + +R  K++ F+K  T++
Sbjct:  338 ECLNVTQLLKHFGLGPNSPISPDLFTYLCPALLYQIDSRLCIEHFDKLLVEDLNKDKTLVPEDKTNIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLP----------HSQGGHDHSHQHTHGHGHSHGHESKEFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR-GKQKWFMKQSTEE 540          
BLAST of slc39a-4 vs. UniProt/SwissProt
Match: sp|Q9ULF5|S39AA_HUMAN (Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=SLC39A10 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 3.190e-46
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            + +  IA+ VI GDG+HNF DG+AIGAAF+  + GG+ST+IAV CHELPHELGDF VLL AGM+++ AI YNL+S++   IGM+IG  +G+   +I+ WIF +TAGMFLY+ALVDM+PE+        +    P   F+ QN+G + G AIMLVIALYE+
Sbjct:  664 TGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAVLLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDMLPEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYED 823          

HSP 2 Score: 72.4034 bits (176), Expect = 1.203e-11
Identity = 65/209 (31.10%), Postives = 110/209 (52.63%), Query Frame = 1
Query:  388 KCHSPIQMLSWF-NKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKP--MKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHS-------------HNGHNKM------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKK 948
            +C +  Q+L ++ +   S +S + F  LCP+LL Q+ SR+C  +  + +     K  N       N   + W+C   ++ VISL+ LL V L+PI+ +  +  +   L+ALAVG+++GDALLHL+PH+     + GH               +  NK       V K LVAL GI+L F+ E    ++++ + +R  K++ F+K  T++
Sbjct:  336 ECLNVTQLLKYYGHGANSPISTDLFTYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLLSLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHS-----QGGHDHSHQHAHGHGHSHGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQR-GKQKWFMKQNTEE 538          
BLAST of slc39a-4 vs. UniProt/SwissProt
Match: sp|Q4V887|S39A6_RAT (Zinc transporter ZIP6 OS=Rattus norvegicus OX=10116 GN=Slc39a6 PE=1 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 7.330e-41
Identity = 79/161 (49.07%), Postives = 111/161 (68.94%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI--LFLWQNIGFVIGSAIMLVIALYE 2106
            + +  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM+++ A+ YN +S++   +GM  G+ +G    ++S WIF LTAG+F+Y+ALVDM+PE+    L  +   H  S    F  QN G ++G  IML+I+++E
Sbjct:  576 AGIATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLYNALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEM----LHNDASDHGCSRWGYFFLQNAGILLGFGIMLLISIFE 732          

HSP 2 Score: 60.8474 bits (146), Expect = 4.264e-8
Identity = 58/203 (28.57%), Postives = 97/203 (47.78%), Query Frame = 1
Query:  343 RKRNNISKTFNNVSIKCHSPIQMLSWFNKT-KSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL---------------MDDG-------EKGHSHNGHNKMVWKSLVALIGIHLFFLTERITIL 882
            RK    S+T N+   +C +  ++L+    + ++ L+  +F  LCP+++ Q+ +R C  +     K   P    S  +       WL  F A+ +IS + LL V L+P+M + ++  +   L+ALAVG+L+GDALLHL+PH+                M  G        +    + +    WK L AL G++  FL E +  L
Sbjct:  233 RKSFMYSRTSNDNIQECFNATKLLTSHGMSVQALLNATEFNYLCPAIINQIDARSCLIHTASEKKAEIPPKTYSLQIA------WLGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSFLVALAVGTLSGDALLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSAQNLEESSYFDSTWKGLTALGGLYFMFLVEHVLTL 429          
BLAST of slc39a-4 vs. TrEMBL
Match: A0A0H3YJK3 (Slc39a-4 OS=Schmidtea mediterranea OX=79327 GN=slc39a-4 PE=2 SV=1)

HSP 1 Score: 1291.95 bits (3342), Expect = 0.000e+0
Identity = 682/682 (100.00%), Postives = 682/682 (100.00%), Query Frame = 1
Query:   67 MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAVIVISLVGLLVVWLIPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSPQIPPENNPNNVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPHGHHHGHSHDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH
Sbjct:   15 MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAVIVISLVGLLVVWLIPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSPQIPPENNPNNVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPHGHHHGHSHDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 696          
BLAST of slc39a-4 vs. TrEMBL
Match: A0A504YEB0 (Zinc transporter ZIP10 OS=Fasciola gigantica OX=46835 GN=FGIG_04175 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 1.731e-115
Identity = 263/661 (39.79%), Postives = 370/661 (55.98%), Query Frame = 1
Query:  250 VYLNSLKNS---SDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSH---------------NGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKAL---STGKLHWASKSRKYSGSSKELVHASSHIGIDGE----------------VNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNY-LLTDRQLTNISSAQNETSNWSNKEDHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGGA---TVKSSLAHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            +Y N  K++     N+S FL     S    K G    +N S+       +C++  QM+ +F    + L+K  F++L P+++ ++ +  C P+          MN+   P  + +    +    AVIV+   GL+VV L+P+M +S+YN ++Q LIAL+VGSL GDA LHLIPHAL   GE  H H               N H  MV KSLVAL+GI+ FFLTER+TIL QN  S++K K+              + + E   GDK    ++   ++          T K    S+S    G ++E   + + + I                    ++   LCNRP  +P  N+ C D   Y  C T +P      ++G    +S     T   +K V     S P++ LLT   +    +A+ E    +N ED   +   +       +++  TV        ++L+  +        +    HP ++KPHGHHHGHSHDLSSVKAIAYT+IAGDGLHNFCDGIAIGAAFAND+ GGLST+IAVLCHELPHELGDF VLLHAGMS++TA+FYNL+SSV CA G  IG+ LG++ S+ +W+FMLTAGMF+YIALVDMMPEL+T RLKG++  H+P++LFLWQN+G  +G  +ML+I+L+E+
Sbjct:   49 LYANLTKDAFLYPQNLSKFLDHLNISPN--KRGGHLDHNHSQQSEIQEPECYTAEQMVGFF-APAAHLNKSQFVSLLPTIVYELHTHACHPD---------HMNSKIVPANSRDWKAIVACVVAVIVLGSSGLIVVALVPLMSRSFYNVVTQFLIALSVGSLTGDAFLHLIPHAL--SGEHSHGHKSDQMHGHHNEKAEENSHRNMVMKSLVALLGIYAFFLTERLTILCQNRTSRKKMKRL---------AQAAHVFDEDMPGDKTLGYQRVIAQTPYRNGYLHPETSKSAEQSRSDALVGGAQETSKSKNSLQIHARQLSVPEGLSTAHPEPLSHVDNQLCNRPPERPMDNTRCVD---YLKC-TFSP------ADGFTRAHSGTLGPTGSNVKHV---SGSTPHFWLLTSTAIVGTPTARAEG---ANNED-PTMKKTVTSTGIAPSIDNNTVTGDVVTWQKQLQTNSPTVFLNDTEQQPTHPHRDKPHGHHHGHSHDLSSVKAIAYTIIAGDGLHNFCDGIAIGAAFANDLRGGLSTSIAVLCHELPHELGDFAVLLHAGMSVKTALFYNLLSSVLCAAGTAIGLLLGQMESVDAWLFMLTAGMFVYIALVDMMPELTTNRLKGHRYCHQPTVLFLWQNLGIFLGYVVMLLISLFED 669          
BLAST of slc39a-4 vs. TrEMBL
Match: A0A3R7CP08 (Zinc transporter ZIP10 OS=Clonorchis sinensis OX=79923 GN=slc39a10 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 1.511e-114
Identity = 246/609 (40.39%), Postives = 353/609 (57.96%), Query Frame = 1
Query:  388 KCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGH---------SHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHF---LKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYS-----------GSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTD------RQLTNISSAQNETSNWSNKE----DHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGGATVKSS---LAHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            +C+S  QM+ +F  +++ LSK+ F  L P+++ ++ +  C     +     + ++  +  ++ + +++ + S   +IV++L+        P+MP+ ++N ISQ LIAL+VGSL GDA LHLIPHAL  D +  H         +HN H++M+ K+LVAL+GI+ FFLTER+TIL QN  S+RK K+Q       +  K L+          G    ++EK   + S N     G      +SR++            G+   +V+  +   ++ E      LC RP  +P  N+ C D ++ ++   +N  S+ P         +  + Q +G +    P     P   LT        +L   ++A  +TS ++ ++     H +L                   +K   +T   E       + S+     HP ++KPHGHHHGHSHDLSSV+AIAYTVI GDGLHNFCDGIAIGAAF+ +I GGLSTAIAVLCHELPHELGDF VLLHAGMS++ AIFYNL+SS+ CA G VIG+ LG++ SI +WIFMLTAGMF+YIALVDMMPEL+T RLKG++  HRPSILF+WQN+G ++G  IML+IA YE
Sbjct:   38 QCYSAEQMIDFFPNSQT-LSKQQFGELLPTVVYELHTHACHHEHPEHSH-SRALDWKA--IVGSTVSVLVISISGLIVVALI--------PLMPRRFFNVISQFLIALSVGSLTGDAFLHLIPHALAPDHDHTHEEQTTTNVEAHN-HHEMISKALVALLGIYAFFLTERLTILCQNNTSRRKMKRQRASTNEAVGEKDLTYPPLSGAEQNGSLPTETEK---QESTNVMQPVGL-----RSREHGTPNTKPSVDNVGNPTLVVNGVTTSHMENE------LCGRPPDRPLDNARCADHLSGDVFVRVNSASLIP-------GGTHHKDQQDGAVHFCWPSSVYIPPTELTSSERSTATELPTQNAALADTSEFARRQRLEASHDVLDVDNRNGQM----------SKWKQNTTFAESNLAKTYLDSAHEQPTHPHRDKPHGHHHGHSHDLSSVRAIAYTVIVGDGLHNFCDGIAIGAAFSTNINGGLSTAIAVLCHELPHELGDFAVLLHAGMSVKAAIFYNLLSSILCAAGTVIGLLLGRIASIDTWIFMLTAGMFVYIALVDMMPELATNRLKGHRRCHRPSILFIWQNVGILLGYGIMLLIAFYE 602          
BLAST of slc39a-4 vs. TrEMBL
Match: A0A1S8WKI7 (Metal cation transporter, ZIP family OS=Opisthorchis viverrini OX=6198 GN=X801_09260 PE=4 SV=1)

HSP 1 Score: 372.089 bits (954), Expect = 4.098e-112
Identity = 263/684 (38.45%), Postives = 384/684 (56.14%), Query Frame = 1
Query:  232 KTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNI--SKTFNNVSIK--CHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHS---------HNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKA---PV-----KSSENKALSTGKLHWASKS-RKYSGS--------------------SKELVHASSHIGIDGEVN-------IGAH----LCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGG------ATVKSSLAHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            KT IA+ +L +L  S  N +  +  +     +  L L   ++    +  +N +I+  C+S  QM+ +F  +++ L+K+ F  L P+++ ++ +  C    ++     + ++  +  ++ + +++ + S   +IV++L+        P+MP+ ++N ISQ LIAL+VGSL GDA LHLIPHAL  + + GH          HN H++M+ K+LVAL+GI+ FFLTER+TIL QN  S++K K+Q  +      + L   +    +G     SE A   PV     K+S N+A+    L +   S  + +GS                    S+E    ++   +D   N       + +H    LC RP  +P  N+ C D ++ ++   +N  S+ P   G +  N     Q +G +    P     P   LT  +     S   E    +   D   L+ +  PE + + V++     + S   +               T +    HP ++KPHGHHHGHSHDLSSV+AIAYTVI GDGLHNFCDGIAIGAAF+ ++ GGLSTAIAVLCHELPHELGDF VLLHAGMS++ AIFYNL+SS+ CA G VIG+ LG++ SI +WIFMLTAGMF+YIALVDMMPEL+T RLKG +  HRPSILF+WQN+G ++G  IML+IA YE
Sbjct:  134 KTDIAEHHLTALFTSITNGTT-VDQQQLEKFLNGLHLSSPDHAHDEEHVHNETIETHCYSAEQMIEFFPNSQT-LTKQQFGELLPTVVYELHTHACHHEHSEHGH-SRALDWKA--IVGSTVSVLVISISGLIVVALI--------PLMPRRFFNVISQFLIALSVGSLTGDAFLHLIPHALAPEHDHGHEDQTTANVEPHN-HHEMIGKALVALLGIYAFFLTERLTILCQNNTSRQKMKRQRVVSSYHVSVWL---FVHIGSGHGSPTSEPALTFPVAFIFHKASNNEAVGEKDLTYPPISGAEQNGSLPMETEKQESTNVMQPVGLRSREHGTPNTKPSVDSAGNLTLAVNGVTSHMENELCGRPPDRPLDNARCADHLSGDVFVRVNSASLIP--GGAHHKN-----QQDGAVHFCWPSSVYIPPTELTSSE----RSTATELPTQNAVADASELTRRQRPEASYDMVDVDNRNGQISKWKQNATFAESNLAKTYLDTAEEQPTHPHRDKPHGHHHGHSHDLSSVRAIAYTVIVGDGLHNFCDGIAIGAAFSTNVNGGLSTAIAVLCHELPHELGDFAVLLHAGMSVKAAIFYNLLSSILCAAGTVIGLLLGRIASIDTWIFMLTAGMFVYIALVDMMPELATNRLKGQRCCHRPSILFIWQNVGILLGYGIMLLIAFYE 789          
BLAST of slc39a-4 vs. TrEMBL
Match: A0A5J4NNK5 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012597 PE=4 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 4.991e-110
Identity = 256/660 (38.79%), Postives = 359/660 (54.39%), Query Frame = 1
Query:  307 EGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALM----DDGEKGHSH-----------NGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVK------------------------------SSENKALSTGKLHWASKSRKYS-----GSSKELVHASSHIGIDGEVNIG-AHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGGATVKSSL---------AHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            E   + +  + L   N+  +   +    C+S  +ML++F   K  L K  F  L P+++  + +  C P   +P+K  K      + ++ + +++ + S   +IV++L+        P+M + +YN +SQ LIAL+VGSL GDA +HLIPHAL      D E  H H           + H +M+ KSLV L+GI+ FFLTER+TIL QN  S++K K+Q    +L    S +   ++    DK    +  P +                              ++E++ + T K    + +R+ S       S +L  + SHI     ++ G +HLCNRP  +P  N+ C D +   L   I      P     N + S+           V P   S      T   LT ++      S  ++    + LS  +   N        TV TKH  +T   +  A  AT ++ +          H  ++KPHGHHHGHSHDLSSV+AIAYTVIAGDGLHNFCDGIAIGAAFAN++ GGLSTAIAVLCHELPHELGDF VLLHAGMS++ A+FYNL+SSV CA G  IG+ LG + SI +W+FMLTAGMF+YIALV+MMPEL+T RLKG++I H+PS+LF WQN+G + G  +ML+IA YE
Sbjct:   60 EELQAFLASIHLTPSNHSHEDHESNETHCYSAKEMLNFFPGAKY-LDKRQFGQLLPTMVYSIRTDACHPE-HEPVKTSKTTVGWQA-IVGSLISVIVISVSGLIVVALL--------PMMSRRFYNVVSQFLIALSVGSLTGDAFVHLIPHALTPNHEHDIETEHDHAHTHVAEAQAAHDHREMITKSLVVLVGIYAFFLTERLTILCQNSTSRKKMKRQRLFSILLLNCSQKFINADGHPTDKDVTYQPIPTQGQLTTDGHFCSEVDKEEHLNTSVTAQATGATNEDRGIPTQKSANNANARRLSVPENVSPSVDLFVSLSHILRLQPLSCGESHLCNRPPERPMDNARCVDHLRDNLYARIVMTDATP-----NRDLSDGPSHFWPSAIFVTPDVGSILVDETTSTGLTKVNGII--ASTLASATSQESLSHALDLPNG------NTVKTKHHTNTVT-DYAAVKATPQAMMYLDVSDQQPTHLHRDKPHGHHHGHSHDLSSVRAIAYTVIAGDGLHNFCDGIAIGAAFANNVRGGLSTAIAVLCHELPHELGDFAVLLHAGMSVKAALFYNLLSSVLCAAGTAIGLFLGHIQSIDTWLFMLTAGMFVYIALVNMMPELTTNRLKGHRICHQPSVLFFWQNVGILFGYGVMLLIAFYE 694          
BLAST of slc39a-4 vs. Ensembl Cavefish
Match: slc39a10 (solute carrier family 39 member 10 [Source:NCBI gene;Acc:103023420])

HSP 1 Score: 187.578 bits (475), Expect = 9.397e-49
Identity = 89/163 (54.60%), Postives = 123/163 (75.46%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEEH 2112
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++    GMVIG  +G+   +++SWIF +TAGMFLY+ALVDM+PE+    L G+   H+   L  F+ QN+G + G  IML+IA++E+H
Sbjct:  710 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYFGMVIGTAVGQYTHNVTSWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRCHLGHFVLQNLGMLTGFGIMLLIAIFEDH 868          

HSP 2 Score: 82.4185 bits (202), Expect = 1.149e-15
Identity = 67/194 (34.54%), Postives = 103/194 (53.09%), Query Frame = 1
Query:  388 KCHSPIQMLSWFNKTKSGL-SKEDFITLCPSLLVQMVSRVCRPNVTQ-PMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM----------VWKSLVALIGIHLFFLTERITILYQNLRSK-----RKSKK 918
            +C +  Q+L  +  +   L S   F  LCP+LL Q+ SRVC  +  Q  M+  +P          +++ IW+  F ++ VISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+    G   HSH   N            VWK L AL GI+L F+ E    + ++ + +     R+ K+
Sbjct:  425 ECLNLTQLLQHYGLSPDSLISPAQFTYLCPALLYQIDSRVCIRHYHQVAMEETQP----------HSVWIWVWGFVSITVISLLSLLGVVLVPILNQSCFKYLLTFLVALAVGTLSGDALLHLLPHS---QGGHDHSHGEENAEEMDLLTEFDGVWKGLTALAGIYLLFIIEHCISMVKHYKDQGGSFCRRKKR 605          
BLAST of slc39a-4 vs. Ensembl Cavefish
Match: ENSAMXT00000020125.2 (zinc transporter ZIP6-like [Source:NCBI gene;Acc:103026967])

HSP 1 Score: 171.014 bits (432), Expect = 9.523e-44
Identity = 82/159 (51.57%), Postives = 111/159 (69.81%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++   +GM+ G+ +G    +++ WIF LTAG+F+Y+ALVDM+PE+           H     F+ QN G ++G  IML+IAL+E
Sbjct:  575 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMSVKQAILYNLLSAMMGYLGMITGILIGHYAENVAMWIFALTAGLFMYVALVDMVPEMLHNNASEAGFSH--CGFFVLQNAGILLGFGIMLLIALFE 731          

HSP 2 Score: 77.411 bits (189), Expect = 3.834e-14
Identity = 70/225 (31.11%), Postives = 105/225 (46.67%), Query Frame = 1
Query:  442 LSKEDFITLCPSLLVQMVSRVC----------------RPNVTQPMKPMKPMNNTSSPVINNNLAI-WLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEK-------GHSHNGHN----KMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSE 1032
            LS  DF  LCP+LL+Q+ S+ C                  +            NT +   ++ + I W+  F A+ +ISL+ L+ V LIP+M +  +N +   L+ALAVG+L+GDA LHLIPH+  +            HSH+G      K VW  L AL G+++ FL E    L +  + K+K         + K+  L N   E+      ED +  P+  SE
Sbjct:  273 LSVRDFSFLCPALLLQIDSKSCFMHADNLSDYKNQHHHHSHNHHHHDHHDHHENTDTTQKSSPIQIAWIGGFLAITIISLLALVGVVLIPLMDRVCFNFLLSFLVALAVGTLSGDAFLHLIPHSQGNHKHNHPVNESLEHSHHGEEEDPLKPVWTGLTALGGVYVMFLIEHFLTLAKMYKDKKK---------VQKRADLSNEILESEKVPALEDVDVKPLDDSE 488          
BLAST of slc39a-4 vs. Ensembl Cavefish
Match: slc39a5 (zinc transporter ZIP5-like [Source:NCBI gene;Acc:103022330])

HSP 1 Score: 152.91 bits (385), Expect = 1.309e-38
Identity = 77/160 (48.12%), Postives = 106/160 (66.25%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLG-KLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            S + ++A+ V+ GDG+HN  DG+AIG AF+  + GGLST IAV CHELPHELGD  VLL AG  +R    ++L+S++   +G++ G  +G +    S WI  +TAG+FLY+AL DMMPE+    L G++        FL Q +G +IG AIML IAL+EE
Sbjct:  387 SGLGSVAWMVVMGDGIHNLTDGLAIGVAFSQSLTGGLSTTIAVFCHELPHELGDLAVLLAAGWPVRRLAVFSLLSALLGYVGVLGGTAMGHQWAQHSPWILTVTAGVFLYVALADMMPEM----LHGDRGPLGAVKCFLLQCVGLLIGGAIMLCIALFEE 542          

HSP 2 Score: 53.9138 bits (128), Expect = 7.151e-7
Identity = 56/191 (29.32%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  352 NNISKTFNNVSIKCHSPIQMLSWFNKTK-SGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQ 921
            N+++K   ++   C +  Q+L  F   + S ++   F  LCP+LL Q+ S VC  +     +  K        +   +LA+++ S           LL + L P++  S   +    + A+AVG+L GDALLHL+PHA          H  H  +V K L  L G+ L F+ E I ++ Q  +  RK ++Q
Sbjct:  175 NHLTK--KHIHENCLNVTQLLWNFGLGQASHITPAHFTFLCPALLYQIDSGVCLRHTESSTEEAKNGVTFLKALGWASLALFVISL--------PSLLALGLAPLISPSSLRTFLCPMAAMAVGTLCGDALLHLLPHA------SSGPHTDHRDVVLKGLSVLGGLFLLFVLESIIVIRQQYKKSRKKRQQ 349          
BLAST of slc39a-4 vs. Ensembl Cavefish
Match: ENSAMXT00000003334.2 (zinc transporter ZIP8-like [Source:NCBI gene;Acc:103022239])

HSP 1 Score: 148.673 bits (374), Expect = 5.954e-38
Identity = 74/160 (46.25%), Postives = 108/160 (67.50%), Query Frame = 1
Query: 1630 LSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL--PSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALY 2103
            L+SV+ +A+ +   D LHNF DG+AIGA+F   I  G ST+IA++C E PHELGDFV+LL+AGM++  AIF+NL+S++ C IG+V+G+ LG    P+I   IF +  GMFLYIAL DM PE++    + +       + F+ QN G + G AI+ +I ++
Sbjct:  276 LASVRTVAWMITLSDALHNFIDGLAIGASFTVSILTGFSTSIAIVCEEFPHELGDFVILLNAGMTVPQAIFFNLLSAMSCYIGLVLGILLGSTFAPNI---IFAIAGGMFLYIALADMFPEMNAIAKEASTRTRTQLVFFIIQNAGLLSGFAIIFLITMF 432          

HSP 2 Score: 51.6026 bits (122), Expect = 2.660e-6
Identity = 57/213 (26.76%), Postives = 101/213 (47.42%), Query Frame = 1
Query:  292 AFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTK-SGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHF 927
              L   G +SL+  +   K+    +T   V  +C S   +L+ +  +  + L++++  T+CP+LL Q +   C P   QP             ++ ++  +W   F AV +I+L  LL + LIP+  K Y+  +    I LA+G+L  +A L LIP AL  D +        +  + K++    G +L F TE+  +L   L+++ +    HF
Sbjct:   35 GLLDHSGVNSLLETITQEKQAEQQQT---VQAQCISGEDILTLYGLSNLTHLNQDNLRTICPALLNQALLPTCTPLAAQPQA-----------LVQDH--VWGYGFLAVTIINLFSLLGLLLIPLTKKPYFPKVLTYFIGLAIGTLFSNAALQLIPEALGFDPKA-------DNYILKAVGIFGGFYLLFFTEK--VLKMVLKTEHEHGHSHF 222          
BLAST of slc39a-4 vs. Ensembl Cavefish
Match: slc39a5 (zinc transporter ZIP5-like [Source:NCBI gene;Acc:103022330])

HSP 1 Score: 149.828 bits (377), Expect = 7.588e-38
Identity = 77/160 (48.12%), Postives = 106/160 (66.25%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLG-KLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            S + ++A+ V+ GDG+HN  DG+AIG AF+  + GGLST IAV CHELPHELGD  VLL AG  +R    ++L+S++   +G++ G  +G +    S WI  +TAG+FLY+AL DMMPE+    L G++        FL Q +G +IG AIML IAL+EE
Sbjct:  347 SGLGSVAWMVVMGDGIHNLTDGLAIGVAFSQSLTGGLSTTIAVFCHELPHELGDLAVLLAAGWPVRRLAVFSLLSALLGYVGVLGGTAMGHQWAQHSPWILTVTAGVFLYVALADMMPEM----LHGDRGPLGAVKCFLLQCVGLLIGGAIMLCIALFEE 502          
BLAST of slc39a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000371.1 (pep scaffold:Pmarinus_7.0:GL476519:142118:151022:-1 gene:ENSPMAG00000000332.1 transcript:ENSPMAT00000000371.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 180.259 bits (456), Expect = 4.574e-47
Identity = 89/161 (55.28%), Postives = 119/161 (73.91%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            + V +IA+ VI GDG+HNF DG+AIGAAF++    GLST+IAV CHELPHELGDF VLL AGMS++ AI YNL+S++   +G+VIG  +G+   S+++WIF  TAG+FLY+ALVDM+PE+    +  +  + R    FL QN+G ++G  IMLVIA YEEH
Sbjct:  734 AGVSSIAWMVILGDGVHNFSDGLAIGAAFSDSTSVGLSTSIAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALLGYLGLVIGTAVGQYTHSVTTWIFAATAGIFLYVALVDMLPEMLHCEVDSHS-YGRLGC-FLLQNLGLLMGFGIMLVIARYEEH 892          

HSP 2 Score: 84.3445 bits (207), Expect = 6.515e-17
Identity = 60/192 (31.25%), Postives = 101/192 (52.60%), Query Frame = 1
Query:  355 NISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPV-INNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM------------VWKSLVALIGIHLFFLTERITILYQN 891
            N S+ F N  +   S +            ++ E F  LCP++L Q+ S+ C       +K  +P N    P+  ++N+  W   F ++ +IS++ LL V ++P+M + ++  +   L+ALAVG+L+GDALLHL+PH+     +  HSHNGH+              +WK L  L GI+L F+ E +  L+++
Sbjct:  425 NASQLFQNFGLDVDSAV------------INTELFSYLCPAILYQIDSQAC-------LKHPEPPNKIDLPLSTDSNMPAWGWGFLSITIISMLSLLGVAIVPMMNQVFFKYLLTFLVALAVGTLSGDALLHLLPHS-----QNSHSHNGHDDHDHILDSDEHLDGIWKGLTGLGGIYLMFIVEHLLALFKH 592          
BLAST of slc39a-4 vs. Ensembl Sea Lamprey
Match: slc39a14 (solute carrier family 39 member 14 [Source:NCBI gene;Acc:799782])

HSP 1 Score: 141.354 bits (355), Expect = 7.240e-37
Identity = 71/158 (44.94%), Postives = 106/158 (67.09%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELS-TRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALY 2103
            S +  +A+ +   DGLHNF DG+AIGA+F   +  G+ST+IA+LC E PHELGDFV+LL+AGMS++ A+F+N +S+  C +G+V G+  G   +  +WIF L  GMFLYI+L DM PE++   +  G +      + F  QN+G + G +IML++ +Y
Sbjct:  190 SRIGTLAWMITLSDGLHNFIDGLAIGASFTVSVFQGISTSIAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACSCYLGLVCGIVAGSHFA-HNWIFALAGGMFLYISLADMFPEMNEVSKEDGEE--KNNLVTFGIQNLGLLTGFSIMLLLTIY 344          

HSP 2 Score: 51.9878 bits (123), Expect = 3.173e-7
Identity = 29/87 (33.33%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  658 PIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKK 918
            P M K +Y  +    IALA+G+L  +AL  LIP A   D  K       +  V+KS V   G +LFF  E+I  +    + +R   +
Sbjct:   39 PFMRKKFYRRLLMYFIALAIGTLYSNALFQLIPEAFGLDPVK-------DGYVYKSAVVFAGFYLFFFAEKILKMVLKQKDERPPNR 118          
BLAST of slc39a-4 vs. Ensembl Sea Lamprey
Match: SLC39A12 (solute carrier family 39 member 12 [Source:HGNC Symbol;Acc:HGNC:20860])

HSP 1 Score: 127.872 bits (320), Expect = 5.147e-32
Identity = 65/161 (40.37%), Postives = 105/161 (65.22%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHEL---GDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            + ++A  ++ GD +HNF DG+A+GAAF+     GL+T++A+  HE+PHE+   GDF  LL++GM +  A+  N +SS+    G+ +G+ L     +  WIF +TAGMF YI+LVD+MPEL    +K    F  P ++F  QN+G + G +IM+++A++E+ 
Sbjct:  233 MSSLAIMILVGDSIHNFADGLAMGAAFSASNRAGLTTSLAIFFHEVPHEIERSGDFAALLNSGMRVCPALVLNFISSLTAFTGLYVGLSLSNDTIVQQWIFSVTAGMFYYISLVDLMPEL----MKVTGKF--PWVVFALQNVGLLAGWSIMVLLAVFEDQ 387          

HSP 2 Score: 69.707 bits (169), Expect = 8.312e-13
Identity = 49/167 (29.34%), Postives = 82/167 (49.10%), Query Frame = 1
Query:  391 CHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHAL-MDDGEKGHSHNGH-----NKMVWKSLVALIGIHLFFLTERI 873
            C+S  ++   F    SG+++ +F  L  +++ Q++S  C  +  +          T        LA+ + S  +++ ++++ +          +  Y  I Q  IALAVG+L+GDA LHLIP  L + D   GH+H        N  VWK +  L GI++FFL E+I
Sbjct:    1 CYSAHELFDVFEFNSSGVARRNFSALAVAIVQQLLSGACWVHGDEEATAPGAAPTTVEKYGYGTLAVLVVSLSSLMGVAVILVTSC-------QETYRVILQTFIALAVGTLSGDATLHLIPTMLVLHDHSDGHNHAEEDFVEKNSHVWKLMALLGGIYMFFLVEKI 160          
BLAST of slc39a-4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009266.1 (pep scaffold:Pmarinus_7.0:GL483721:1641:4019:1 gene:ENSPMAG00000008381.1 transcript:ENSPMAT00000009266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 4.335e-27
Identity = 66/152 (43.42%), Postives = 98/152 (64.47%), Query Frame = 1
Query: 1660 VIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFH--RPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            V+ GDGLHNF DG+A+GAAF+  +  GL+T +AV  HELPHE+  F +LL+ G+S++ A+  NL+S++   IG  IG  + +  +   WI     GMFLY+++ +M+ E+        K FH  RP +L L QN+G  +G A ML++ALYE+
Sbjct:    2 VLIGDGLHNFADGLALGAAFSLSLSDGLATMLAVALHELPHEIDIFSILLNTGLSIQAALGLNLLSALTALIGFYIGASVSENETAMQWIIAFATGMFLYLSINNMISEM--------KRFHVDRPWLLLLLQNLGLFLGWAFMLLLALYED 145          
BLAST of slc39a-4 vs. Ensembl Yeast
Match: YKE4 (Zinc transporter; localizes to the ER; null mutant is sensitive to calcofluor white, leads to zinc accumulation in cytosol; ortholog of the mouse KE4 and member of the ZIP (ZRT, IRT-like Protein) family [Source:SGD;Acc:S000001285])

HSP 1 Score: 67.3958 bits (163), Expect = 2.671e-12
Identity = 48/164 (29.27%), Postives = 83/164 (50.61%), Query Frame = 1
Query: 1660 VIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKL-----------PSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKI--FHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            VI+G   H+  DGIA+  +F +    G+ T+IAV  HE+PHELGDF +LL +G +   AI    +++    +G  IG  + ++            + S  +   TAG  +YIA   ++P++       +K+  F + ++  ++  +GF        V+AL +EH
Sbjct:  191 VISGIA-HHITDGIALATSFYSSTQVGIMTSIAVTFHEIPHELGDFAILLSSGFTFPQAIRAQAVTAFGAVVGTSIGCWMNEIGNNSHKATSSSANASELMLPFTAGGLIYIATTSVVPQILHSSAPDSKLREFKKWALQLVFIFVGFA-------VMALMDEH 346          
BLAST of slc39a-4 vs. Ensembl Nematostella
Match: EDO37361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG18])

HSP 1 Score: 153.295 bits (386), Expect = 4.308e-43
Identity = 70/152 (46.05%), Postives = 102/152 (67.11%), Query Frame = 1
Query: 1660 VIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI-LFLWQNIGFVIGSAIMLVIALYEEH 2112
            V+ GD +HNF DG+AIGAAF+N I  G ST++A+ C E+PHELGDF VLL  GM++R A+ +N +S+  C +GM IG+ LG       WI+ L  GMF+YIALV M+PE++   ++  +   R ++ +F  QN+G + G  IM V+A+Y+  
Sbjct:    2 VLLGDSMHNFLDGLAIGAAFSNSIIEGFSTSLAIFCEEVPHELGDFAVLLSGGMTVRQALGFNFLSACVCFVGMAIGLLLGYTTHAVKWIYALAGGMFVYIALVAMLPEVNQMSMRAGQGSVRKNLKVFAMQNVGMICGFIIMFVLAMYQSQ 153          
BLAST of slc39a-4 vs. Ensembl Nematostella
Match: EDO29311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T403])

HSP 1 Score: 146.362 bits (368), Expect = 1.392e-40
Identity = 75/156 (48.08%), Postives = 106/156 (67.95%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLK-GNKIFHRPSILFLWQNIGFVIGSAIMLVIALY 2103
            VK IA+T++ GD +HNF DG+AIGAAF++ +  G+STA+A++  E+PHELGDF VLL +GM  R A+ +NL+S V C  G+V+G+ L    +   WI+ + AGMFLYI+LVDM+PE +    K G          F  QN G ++G +IMLV+A+Y
Sbjct:    2 VKPIAWTIVIGDCVHNFIDGVAIGAAFSSSVVEGISTALAIIGEEVPHELGDFAVLLSSGMKYRHAVLFNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEANEMSCKEGEHSVWSNLKTFALQNSGMLVGFSIMLVLAIY 157          
BLAST of slc39a-4 vs. Ensembl Nematostella
Match: EDO47899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLA9])

HSP 1 Score: 148.288 bits (373), Expect = 7.931e-40
Identity = 76/156 (48.72%), Postives = 108/156 (69.23%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI-LFLWQNIGFVIGSAIMLVIALY 2103
            VK IA+T++ GD +HNF DG+AIGAAF++ +  G+STA+A+L  E+PHELGDF VLL +GM  R A+ +NL+S V C  G+V+G+ L    +   WI+ + AGMFLYI+LVDM+PE +    K  K     ++  F  QN G ++G +IMLV+A+Y
Sbjct:  116 VKPIAWTIVIGDCVHNFIDGVAIGAAFSSSVVEGISTALAILGEEVPHELGDFAVLLSSGMKYRHAVLFNLLSGVICYTGLVLGLLLAYATASVQWIYAIAAGMFLYISLVDMLPEANEMSCKEGKHSVWSNLKTFALQNSGMLVGFSIMLVLAIY 271          
BLAST of slc39a-4 vs. Ensembl Nematostella
Match: EDO49001 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHM0])

HSP 1 Score: 142.51 bits (358), Expect = 2.747e-39
Identity = 75/160 (46.88%), Postives = 103/160 (64.38%), Query Frame = 1
Query: 1660 VIAGDGLHNFCDGIAIGAAFANDIGGGLSTAI----AVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSI------LFLWQNIGFVIGSAIMLVIALYEE 2109
            +I GD +HN  DG+AIGAAF+     G+S  I    AV CHELPHELGDF VLL AGMS++ A+  NL+S+  C +G++IG+ +G+   +  WIF +  GMF+Y+ALVDM+P+L           H  S+       FL QNIG + G A+ML+IA++EE
Sbjct:    2 IIIGDTIHNISDGLAIGAAFSEGGSSGISGGISTSIAVFCHELPHELGDFAVLLTAGMSVKMALLANLLSACSCYLGLIIGIVIGQQMEVRLWIFAVAGGMFIYVALVDMLPDL----------MHSESLQTDTWKTFLLQNIGILTGFALMLIIAVFEE 151          
BLAST of slc39a-4 vs. Ensembl Nematostella
Match: EDO47900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLB0])

HSP 1 Score: 135.191 bits (339), Expect = 1.052e-36
Identity = 68/153 (44.44%), Postives = 103/153 (67.32%), Query Frame = 1
Query: 1648 IAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLK-GNKIFHRPSILFLWQNIGFVIGSAIMLVIALY 2103
            + + ++ GD LHNF DG+AIGA +++ I  G STA+A+ C ELPHELGDF VLL+ GM+ + A+F+N +S+  C +G+V+G+ LG       WI+ L AGMF+YI+LV+M+ E +   +K G     +    F  QN+G +IG A+M ++A+Y
Sbjct:    4 VCWMIVLGDALHNFIDGLAIGAGYSSSILEGASTALAIFCEELPHELGDFAVLLNGGMTYKQAMFFNFISACTCFLGLVMGLLLGYATPAVKWIYALAAGMFIYISLVNMLQEATEMSVKEGEGSIKKNLKTFALQNVGMIIGFAVMFILAIY 156          
BLAST of slc39a-4 vs. Ensembl Medaka
Match: ENSORLT00000032294.1 (zinc transporter ZIP10 [Source:NCBI gene;Acc:101174784])

HSP 1 Score: 186.422 bits (472), Expect = 1.396e-48
Identity = 87/162 (53.70%), Postives = 125/162 (77.16%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEE 2109
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++   +GM+IG  +G+   ++++WIF +TAGMFLY+ALVDM+PE+    L G+   H+ S L  FL QN+G + G ++ML+IA++E+
Sbjct:  648 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYVGMIIGAAVGQYTHNVTNWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRSHLGHFLLQNLGLLTGFSLMLLIAIFED 805          

HSP 2 Score: 95.5153 bits (236), Expect = 1.131e-19
Identity = 70/199 (35.18%), Postives = 111/199 (55.78%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM---------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLS 954
            +C +  Q+LS++     S +S   F  LCP+LL Q+ SRVC  +  Q     KP+N+         + +W+C F ++ VISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+    G+  HS +G  +          VWK L AL GI+L F+ E    ++++ + ++   K      + +KLS
Sbjct:  365 ECLNLTQLLSYYGLNPHSLISPSQFTYLCPALLYQIDSRVCIQHYHQMEVEQKPVNS---------VWVWVCGFVSITVISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHS---QGQHDHSQHGAKEATDLVTDFDGVWKGLTALAGIYLLFIIEHCIAMFKHHKDQKSLGKTSEEGHIGRKLS 551          
BLAST of slc39a-4 vs. Ensembl Medaka
Match: ENSORLT00000011005.2 (zinc transporter ZIP10 [Source:NCBI gene;Acc:101174784])

HSP 1 Score: 186.422 bits (472), Expect = 1.563e-48
Identity = 87/162 (53.70%), Postives = 125/162 (77.16%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEE 2109
            + + +IA+ VI GDG+HNF DG+AIGAAF+ +I GG+ST++AV CHELPHELGDF VLL AGMS++ AI YNL+S++   +GM+IG  +G+   ++++WIF +TAGMFLY+ALVDM+PE+    L G+   H+ S L  FL QN+G + G ++ML+IA++E+
Sbjct:  657 AGIASIAWMVIMGDGMHNFSDGLAIGAAFSANITGGISTSVAVFCHELPHELGDFAVLLKAGMSVKQAIVYNLLSALMAYVGMIIGAAVGQYTHNVTNWIFAVTAGMFLYVALVDMLPEM----LHGDSEEHKRSHLGHFLLQNLGLLTGFSLMLLIAIFED 814          

HSP 2 Score: 95.5153 bits (236), Expect = 1.076e-19
Identity = 70/199 (35.18%), Postives = 111/199 (55.78%), Query Frame = 1
Query:  388 KCHSPIQMLSWFN-KTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM---------VWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLS 954
            +C +  Q+LS++     S +S   F  LCP+LL Q+ SRVC  +  Q     KP+N+         + +W+C F ++ VISL+ LL V L+PI+ +S +  +   L+ALAVG+L+GDALLHL+PH+    G+  HS +G  +          VWK L AL GI+L F+ E    ++++ + ++   K      + +KLS
Sbjct:  374 ECLNLTQLLSYYGLNPHSLISPSQFTYLCPALLYQIDSRVCIQHYHQMEVEQKPVNS---------VWVWVCGFVSITVISLLSLLGVVLVPILNQSCFKFLLTFLVALAVGTLSGDALLHLLPHS---QGQHDHSQHGAKEATDLVTDFDGVWKGLTALAGIYLLFIIEHCIAMFKHHKDQKSLGKTSEEGHIGRKLS 560          
BLAST of slc39a-4 vs. Ensembl Medaka
Match: slc39a6 (solute carrier family 39 member 6 [Source:NCBI gene;Acc:101164750])

HSP 1 Score: 171.4 bits (433), Expect = 5.857e-44
Identity = 84/159 (52.83%), Postives = 111/159 (69.81%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM++R AI YN++S++   +GMV G+ +G    +I  WIF LTAG+FLY+ALVDM+PE+       +   H     FL QN G ++G  IML+IA++E
Sbjct:  538 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVRQAILYNVLSAMMGYLGMVTGIVIGHYAENICMWIFALTAGLFLYVALVDMVPEMLHNDASDHGFSH--CGFFLLQNAGILLGFCIMLLIAVFE 694          

HSP 2 Score: 69.707 bits (169), Expect = 9.755e-12
Identity = 63/195 (32.31%), Postives = 95/195 (48.72%), Query Frame = 1
Query:  382 SIKCHSPIQMLSWFNKTKS-GLSKEDFITLCPSLLVQMVSRVC-RPNVTQPMKPMKPM--------NNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM------------------VWKSLVALIGIHLFFLTERITIL 882
            S +C +   +L++   ++  G++  DF  LCP+LL QM S  C R    Q                NN +     N    W   F ++ +ISL+ LL V LIP+M + ++  +   L+ALAVG+L+GDA LHLIPH+     + GH+H+ H ++                  VWK L AL G+++ FL E    L
Sbjct:  203 STECLNASSILTYHGMSQEVGVTLVDFSYLCPALLNQMDSGACIRHKDHQNHSHGHHGNHNHSDHSNNRTGDDSKNITMAWAGGFLSITIISLLSLLGVVLIPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLIPHS-----QAGHNHH-HQEVGLNPEPHLHLHEEENLDGVWKGLTALGGVYVMFLIEHFLTL 391          
BLAST of slc39a-4 vs. Ensembl Medaka
Match: slc39a6 (solute carrier family 39 member 6 [Source:NCBI gene;Acc:101164750])

HSP 1 Score: 170.629 bits (431), Expect = 8.517e-44
Identity = 84/159 (52.83%), Postives = 111/159 (69.81%), Query Frame = 1
Query: 1633 SSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLP-SISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            + V  +A+ VI GDGLHNF DG+AIGAAF   +  GLST++AV CHELPHELGDF VLL AGM++R AI YN++S++   +GMV G+ +G    +I  WIF LTAG+FLY+ALVDM+PE+       +   H     FL QN G ++G  IML+IA++E
Sbjct:  534 AGVATLAWMVIMGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVRQAILYNVLSAMMGYLGMVTGIVIGHYAENICMWIFALTAGLFLYVALVDMVPEMLHNDASDHGFSH--CGFFLLQNAGILLGFCIMLLIAVFE 690          

HSP 2 Score: 72.4034 bits (176), Expect = 1.294e-12
Identity = 62/175 (35.43%), Postives = 90/175 (51.43%), Query Frame = 1
Query:  430 TKSGLSKE------DFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKM------------------VWKSLVALIGIHLFFLTERITIL 882
            T  G+S+E      DF  LCP+LL QM S  C  +   P     P  +T + V  +    W   F ++ +ISL+ LL V LIP+M + ++  +   L+ALAVG+L+GDA LHLIPH+     + GH+H+ H ++                  VWK L AL G+++ FL E    L
Sbjct:  223 TYHGMSQEVGVTLVDFSYLCPALLNQMDSGACIRHKGDP----PPHTHTKTTVCVS----WAGGFLSITIISLLSLLGVVLIPLMNRVFFKFLLSFLVALAVGTLSGDAFLHLIPHS-----QAGHNHH-HQEVGLNPEPHLHLHEEENLDGVWKGLTALGGVYVMFLIEHFLTL 383          
BLAST of slc39a-4 vs. Ensembl Medaka
Match: SLC39A12 (solute carrier family 39 member 12 [Source:NCBI gene;Acc:101161276])

HSP 1 Score: 157.532 bits (397), Expect = 2.673e-40
Identity = 71/156 (45.51%), Postives = 111/156 (71.15%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYE 2106
            V  +A  VI GD LHNF DG+A+GAAF++ +  G++  +A+LCHE+PHE+GDF VLL +G+S++TA+  N +S++   +G+ IG+ +     +  WIF +TAG+FLY++LV+M+PE+S  R+K +    RP ++FL QN+G  +G A +  IAL+E
Sbjct:  381 VSLLAVMVIVGDSLHNFADGLAVGAAFSSSVETGMAITVAILCHEIPHEMGDFAVLLSSGLSVKTAVLMNFLSALTAFMGLFIGLLVSSENEVQQWIFSITAGIFLYLSLVEMLPEMS--RVKSD----RPCLMFLLQNLGLWMGWACLFFIALFE 530          

HSP 2 Score: 53.9138 bits (128), Expect = 5.483e-7
Identity = 30/72 (41.67%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  670 KSYYNSISQLLIALAVGSLAGDALLHLIPHAL-MDDGEKGHSHNGH---NKMVWKSLVALIGIHLFFLTERI 873
            K  Y  + QL + LAVG+L+G+ALLHLIP  L + D    H    H    + +WK L  + GI+ FFL E++
Sbjct:  280 KETYALVLQLFVGLAVGTLSGEALLHLIPQILGLHDDLHSHGDGQHVNEKEYLWKVLGLIAGIYGFFLIEKM 351          
BLAST of slc39a-4 vs. Planmine SMEST
Match: SMESG000026205.1 (SMESG000026205.1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 674/682 (98.83%), Postives = 674/682 (98.83%), Query Frame = 1
Query:   67 MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQHFLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSXXXXXXXXXXXVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPXXXXXXXXXDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 2112
            MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAVIVISLVGLLVVWLIPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQH        LSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSPQIPPENNPNNVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPHGHHHGHSHDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH
Sbjct:    1 MISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQTFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSLILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAVIVISLVGLLVVWLIPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQH--------LSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASKSRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNYELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTDRQLTNISSAQNETSNWSNKEDHKLLSPQIPPENNPNNVEIKTVGTKHSDHTERLEIGAGGATVKSSLAHPFKNKPHGHHHGHSHDLSSVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEH 674          
BLAST of slc39a-4 vs. Planmine SMEST
Match: SMESG000050464.1 (SMESG000050464.1)

HSP 1 Score: 197.593 bits (501), Expect = 3.455e-54
Identity = 94/160 (58.75%), Postives = 120/160 (75.00%), Query Frame = 1
Query: 1636 SVKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLK--GNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            S+ A+A+ VI GDGLHNF DG+AIGAAF   I GG+STA+AV CHELPHELGDF VLL  GM ++ A+FYN++SSV C +GMVIG+ L  + S S WIF +TAG F+YIALVDM+PEL++  ++   ++I H     FL QN+G + G  IML+IALYEE
Sbjct:  369 SIAAVAWMVILGDGLHNFSDGLAIGAAFGVQISGGISTAVAVFCHELPHELGDFAVLLKTGMKVKQALFYNIVSSVLCFLGMVIGIALQSVESASYWIFAITAGTFVYIALVDMLPELNSAEVRPGESRIVH-----FLIQNLGLLTGVGIMLLIALYEE 523          

HSP 2 Score: 70.4774 bits (171), Expect = 3.152e-12
Identity = 45/100 (45.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:  577 NNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGE--KGHSHNGHNKMVWKSLVALIGIHLFFLTER 870
             +L +W+ S  +V +IS VGLL V ++P++ K +YN I Q L+ALAVGSL GDA LHLIPHA++   +  +          V K LVAL G++ FF+ E+
Sbjct:   56 RSLKVWIASTISVFIISAVGLLGVAVVPLVQKVFYNKIIQYLVALAVGSLTGDAFLHLIPHAILGQVQIPEEQKEKEEYTAVLKGLVALGGVYFFFMAEK 155          
BLAST of slc39a-4 vs. Planmine SMEST
Match: SMESG000016243.1 (SMESG000016243.1)

HSP 1 Score: 156.377 bits (394), Expect = 1.173e-40
Identity = 77/160 (48.12%), Postives = 115/160 (71.88%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPEL-STRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEE 2109
            V  +A+ +I GD LHNF DG++IGAAF+++   G+S +IAV+C ELPHELGDF +LL+AGM+++ A+ +N++S+  C IG +IGV LG+  S S+W+F +  GMFLYI+LVDMM E+ +T   K +       I   F+ QNIG ++G +I+L++ALY +
Sbjct:  290 VAPVAWMIIFGDALHNFIDGLSIGAAFSHNTMTGISLSIAVICEELPHELGDFAILLNAGMNIKQALMWNMLSAATCYIGFIIGVILGETTSGSTWVFAVAGGMFLYISLVDMMSEMNATLEDKDSVEVVEFGIFKTFIIQNIGLLMGYSILLLMALYGD 449          

HSP 2 Score: 58.9214 bits (141), Expect = 9.525e-9
Identity = 64/209 (30.62%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  268 KNSSDNMSAFLSSEGFSSLILKLGLRK-----RNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRP--NVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN-KMVWKSLVALIGIHLFFLTER 870
            K+S DN       + F +L L   L+      +N +SK   N S +C     +   F  +   L K  F      L+  +V +V  P  N+ +   P     N SS      + +W+  F +V +I+    L +  IP+M K +Y  +   +I+LAVGSL G ALL LIP A M   E  H + G+     +K+ V   G+++FFL ER
Sbjct:   16 KSSYDNFV-----DLFGNLFLNFSLQNAGDLMKNKLSKA--NFSTEC-----LARRFVNSTPELQKSTF----EGLIAMIVDKVIIPHCNIIKLNSPSHSKCNLSS------VKMWVYGFISVTIINACAGLGILFIPLMNKKFYKVLMTFMISLAVGSLTGSALLILIPDA-MQLAELQHGYPGYQVSYKYKATVVFGGVYMFFLLER 201          
BLAST of slc39a-4 vs. Planmine SMEST
Match: SMESG000016243.1 (SMESG000016243.1)

HSP 1 Score: 155.992 bits (393), Expect = 2.476e-40
Identity = 77/160 (48.12%), Postives = 115/160 (71.88%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPEL-STRRLKGNKIFHRPSIL--FLWQNIGFVIGSAIMLVIALYEE 2109
            V  +A+ +I GD LHNF DG++IGAAF+++   G+S +IAV+C ELPHELGDF +LL+AGM+++ A+ +N++S+  C IG +IGV LG+  S S+W+F +  GMFLYI+LVDMM E+ +T   K +       I   F+ QNIG ++G +I+L++ALY +
Sbjct:  307 VAPVAWMIIFGDALHNFIDGLSIGAAFSHNTMTGISLSIAVICEELPHELGDFAILLNAGMNIKQALMWNMLSAATCYIGFIIGVILGETTSGSTWVFAVAGGMFLYISLVDMMSEMNATLEDKDSVEVVEFGIFKTFIIQNIGLLMGYSILLLMALYGD 466          

HSP 2 Score: 58.9214 bits (141), Expect = 1.024e-8
Identity = 64/209 (30.62%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  268 KNSSDNMSAFLSSEGFSSLILKLGLRK-----RNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCPSLLVQMVSRVCRP--NVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAXXXXXXXXXXXXXXXPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHN-KMVWKSLVALIGIHLFFLTER 870
            K+S DN       + F +L L   L+      +N +SK   N S +C     +   F  +   L K  F      L+  +V +V  P  N+ +   P     N SS      + +W+  F +V +I+    L +  IP+M K +Y  +   +I+LAVGSL G ALL LIP A M   E  H + G+     +K+ V   G+++FFL ER
Sbjct:   33 KSSYDNFV-----DLFGNLFLNFSLQNAGDLMKNKLSKA--NFSTEC-----LARRFVNSTPELQKSTF----EGLIAMIVDKVIIPHCNIIKLNSPSHSKCNLSS------VKMWVYGFISVTIINACAGLGILFIPLMNKKFYKVLMTFMISLAVGSLTGSALLILIPDA-MQLAELQHGYPGYQVSYKYKATVVFGGVYMFFLLER 218          
BLAST of slc39a-4 vs. Planmine SMEST
Match: SMESG000016191.1 (SMESG000016191.1)

HSP 1 Score: 154.066 bits (388), Expect = 7.628e-40
Identity = 73/157 (46.50%), Postives = 104/157 (66.24%), Query Frame = 1
Query: 1639 VKAIAYTVIAGDGLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMSLRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVDMMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEE 2109
            +  +A+ V+ GD LHN  DG++IGA F+  +  G+S ++AVLC ELPHELGDF VLL AGMS++ A+F+NLMS++ C +G +IGV +G + S S WIF    GMFLYI+LVDMM  +          +   ++ F  QN+G   G A +LV++LY +
Sbjct:  295 IAPVAWMVVFGDSLHNLVDGMSIGAGFSQSVILGVSISLAVLCEELPHELGDFAVLLTAGMSVKQAVFWNLMSAMTCYLGFIIGVIVGDITSASVWIFAFAGGMFLYISLVDMMNNIIETIDDMIASWKHKALTFALQNLGLFTGYATILVLSLYSD 451          

HSP 2 Score: 58.9214 bits (141), Expect = 9.508e-9
Identity = 27/72 (37.50%), Postives = 45/72 (62.50%), Query Frame = 1
Query:  658 PIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDDGEKGHSHNGHNKMVWKSLVALIGIHLFFLTERI 873
            P+M K  YNS+   +++LA+G+LAG ++L LIP ++        + +  N   WK+   + G++LFFLTER+
Sbjct:  145 PLMKKKIYNSVMTFMVSLAIGALAGTSILILIPDSMQISEIALKAKHDKNDYKWKATGVVAGLYLFFLTERL 216          
The following BLAST results are available for this feature:
BLAST of slc39a-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC39A106.643e-4755.00solute carrier family 39 member 10 [Source:HGNC Sy... [more]
SLC39A106.643e-4755.00solute carrier family 39 member 10 [Source:HGNC Sy... [more]
SLC39A62.190e-4149.69solute carrier family 39 member 6 [Source:HGNC Sym... [more]
SLC39A62.190e-4149.69solute carrier family 39 member 6 [Source:HGNC Sym... [more]
SLC39A129.872e-3944.94solute carrier family 39 member 12 [Source:HGNC Sy... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zipt-152.363e-3945.96Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-151.584e-3845.96Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-176.786e-2839.38Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-161.551e-2033.76Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
zipt-161.551e-2033.76Zrt (ZRT), Irt-(IRT-) like Protein Transporter [S... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foi1.864e-4752.23gene:FBgn0024236 transcript:FBtr0331418[more]
foi1.864e-4752.23gene:FBgn0024236 transcript:FBtr0345601[more]
foi1.864e-4752.23gene:FBgn0024236 transcript:FBtr0331417[more]
foi1.864e-4752.23gene:FBgn0024236 transcript:FBtr0076624[more]
Zip71B2.512e-3546.54gene:FBgn0036461 transcript:FBtr0113171[more]
back to top
BLAST of slc39a-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a104.066e-4853.99solute carrier family 39 member 10 [Source:NCBI ge... [more]
slc39a107.557e-4853.99solute carrier family 39 member 10 [Source:NCBI ge... [more]
slc39a63.985e-4551.88solute carrier family 39 member 6 [Source:ZFIN;Acc... [more]
BX119991.12.201e-3848.45solute carrier family 39 member 5 [Source:NCBI gen... [more]
slc39a52.755e-3848.45solute carrier family 39 member 5 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000051316.11.235e-4652.50solute carrier family 39 member 10 [Source:NCBI ge... [more]
ENSXETT00000051324.11.351e-4652.50solute carrier family 39 member 10 [Source:NCBI ge... [more]
rabl62.333e-4245.70RAB, member RAS oncogene family like 6 [Source:Xen... [more]
tmem1358.592e-3946.84transmembrane protein 135 [Source:Xenbase;Acc:XB-G... [more]
tmem1351.229e-3846.84transmembrane protein 135 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc39a104.416e-4755.00solute carrier family 39 (zinc transporter), membe... [more]
Slc39a61.978e-4149.07solute carrier family 39 (metal ion transporter), ... [more]
Slc39a121.283e-3943.67solute carrier family 39 (zinc transporter), membe... [more]
Slc39a121.782e-3943.67solute carrier family 39 (zinc transporter), membe... [more]
Slc39a145.164e-3946.54solute carrier family 39 (zinc transporter), membe... [more]
back to top
BLAST of slc39a-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PEH9|S39AA_DANRE2.986e-4753.99Zinc transporter ZIP10 OS=Danio rerio OX=7955 GN=s... [more]
sp|Q9VSL7|FOI_DROME1.869e-4652.23Zinc transporter foi OS=Drosophila melanogaster OX... [more]
sp|Q6P5F6|S39AA_MOUSE3.089e-4655.00Zinc transporter ZIP10 OS=Mus musculus OX=10090 GN... [more]
sp|Q9ULF5|S39AA_HUMAN3.190e-4655.00Zinc transporter ZIP10 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q4V887|S39A6_RAT7.330e-4149.07Zinc transporter ZIP6 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of slc39a-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YJK30.000e+0100.00Slc39a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A504YEB01.731e-11539.79Zinc transporter ZIP10 OS=Fasciola gigantica OX=46... [more]
A0A3R7CP081.511e-11440.39Zinc transporter ZIP10 OS=Clonorchis sinensis OX=7... [more]
A0A1S8WKI74.098e-11238.45Metal cation transporter, ZIP family OS=Opisthorch... [more]
A0A5J4NNK54.991e-11038.79Uncharacterized protein OS=Paragonimus westermani ... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc39a109.397e-4954.60solute carrier family 39 member 10 [Source:NCBI ge... [more]
ENSAMXT00000020125.29.523e-4451.57zinc transporter ZIP6-like [Source:NCBI gene;Acc:1... [more]
slc39a51.309e-3848.13zinc transporter ZIP5-like [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000003334.25.954e-3846.25zinc transporter ZIP8-like [Source:NCBI gene;Acc:1... [more]
slc39a57.588e-3848.13zinc transporter ZIP5-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000371.14.574e-4755.28pep scaffold:Pmarinus_7.0:GL476519:142118:151022:-... [more]
slc39a147.240e-3744.94solute carrier family 39 member 14 [Source:NCBI ge... [more]
SLC39A125.147e-3240.37solute carrier family 39 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009266.14.335e-2743.42pep scaffold:Pmarinus_7.0:GL483721:1641:4019:1 gen... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YKE42.671e-1229.27Zinc transporter; localizes to the ER; null mutant... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373614.308e-4346.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293111.392e-4048.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478997.931e-4048.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490012.747e-3946.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479001.052e-3644.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc39a-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032294.11.396e-4853.70zinc transporter ZIP10 [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000011005.21.563e-4853.70zinc transporter ZIP10 [Source:NCBI gene;Acc:10117... [more]
slc39a65.857e-4452.83solute carrier family 39 member 6 [Source:NCBI gen... [more]
slc39a68.517e-4452.83solute carrier family 39 member 6 [Source:NCBI gen... [more]
SLC39A122.673e-4045.51solute carrier family 39 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc39a-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026205.10.000e+098.83SMESG000026205.1[more]
SMESG000050464.13.455e-5458.75SMESG000050464.1[more]
SMESG000016243.11.173e-4048.13SMESG000016243.1[more]
SMESG000016243.12.476e-4048.13SMESG000016243.1[more]
SMESG000016191.17.628e-4046.50SMESG000016191.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30033279
GenBankAKN21669.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033279 ID=SMED30033279|Name=slc39a-4|organism=Schmidtea mediterranea sexual|type=transcript|length=2680bp
AATACATAGGTTGATGATTTTTAAATGAAGCTCATATTTTTAATTTTAAA
ATTATCAAAAGATTCAATGATTTCAAATATTATAGTCAAATCTTTTACTT
TTTTATTCATATTCCAACTTGGTGACTTTTCAAATCAAACAAATTCAAAT
TCAACAATATTGCCAACAATTCAAACCTTTCCACAAAACAGATCATCTGC
CAAATTAAAATCAAAACAAGAAATAATTTTCAAAACATCTATAGCAGATG
TTTATTTGAATTCTTTGAAAAATTCGTCAGACAATATGAGTGCATTCCTT
AGCTCCGAAGGTTTTTCGTCATTGATCCTAAAACTGGGATTGAGGAAACG
AAATAATATCTCAAAGACCTTTAACAATGTTTCTATAAAATGCCATTCTC
CTATTCAAATGCTGAGTTGGTTCAATAAAACAAAATCAGGACTTTCCAAA
GAAGATTTTATTACCCTTTGCCCATCGCTGCTTGTTCAAATGGTTTCAAG
AGTATGTCGACCAAATGTAACTCAGCCAATGAAACCAATGAAACCAATGA
ATAATACGAGCTCACCGGTTATAAATAATAATCTAGCAATTTGGCTATGC
AGTTTTGGAGCAGTTATTGTCATCAGTTTAGTGGGATTATTAGTAGTATG
GTTGATTCCAATAATGCCCAAGTCATATTACAATAGTATTTCTCAATTGT
TGATTGCTCTCGCCGTTGGATCCTTGGCAGGAGATGCTCTTCTGCATTTA
ATACCGCACGCATTAATGGATGACGGAGAAAAGGGCCATAGTCATAATGG
ACATAATAAGATGGTTTGGAAATCTTTAGTGGCGTTAATTGGAATTCATC
TGTTTTTCCTCACTGAAAGAATAACAATTCTTTATCAAAATCTAAGATCC
AAAAGGAAGTCTAAAAAGCAACATTTTTTGAAACTTTTAACCAAAAAGCT
ATCTTTGGAAAACTTTTATTCCGAAGCATCAGCCGGTGACAAATTTGAAG
ATTCAGAAAAAGCACCAGTGAAAAGTTCTGAAAATAAAGCTTTATCTACT
GGTAAATTACATTGGGCGTCAAAATCACGAAAATATAGTGGTAGTTCCAA
GGAACTAGTTCATGCTAGCAGTCATATCGGAATAGATGGCGAGGTAAATA
TTGGTGCTCATTTATGTAATCGTCCGAAAAGCAAGCCTCATGTCAACAGC
GATTGTCCAGACTCCATGAACTATGAGTTGTGTAACACAATAAATCCTTA
TTCAATGAATCCTGAGTCGAATGGATGTAATCCAAATAATTCGGAAGCAC
GATTACAAACTAACGGAGAAATCAAAACCGTGCAGCCGATTGAAGAAAGC
AAACCGAATTATTTATTAACTGATCGACAGTTGACAAATATTTCATCCGC
ACAAAATGAAACTAGCAATTGGTCGAATAAGGAAGACCACAAACTGCTTT
CTCCACAAATTCCTCCGGAAAATAATCCTAATAATGTCGAGATAAAAACT
GTTGGCACAAAACATTCTGACCATACAGAAAGATTGGAAATTGGAGCCGG
TGGTGCGACAGTAAAATCGAGTTTAGCGCATCCTTTTAAAAACAAACCTC
ACGGTCATCATCATGGACATAGCCATGACTTGAGTAGTGTTAAAGCGATT
GCATATACAGTCATTGCCGGAGATGGTCTTCATAATTTCTGTGATGGGAT
AGCGATTGGGGCAGCATTTGCTAATGACATTGGTGGAGGTTTATCGACCG
CTATAGCGGTTCTCTGTCATGAATTGCCCCACGAGCTTGGAGATTTCGTG
GTGTTACTTCATGCTGGAATGTCACTTAGAACTGCAATTTTCTATAATTT
AATGTCGAGTGTATTTTGTGCAATAGGTATGGTAATCGGTGTTCAGCTAG
GTAAATTGCCCTCAATTTCTAGTTGGATATTTATGCTCACTGCTGGGATG
TTTCTCTACATTGCTTTAGTTGATATGATGCCTGAACTCAGCACTCGGAG
GTTAAAAGGAAACAAAATATTTCATCGGCCCAGCATATTATTCCTGTGGC
AAAATATCGGTTTCGTAATTGGATCCGCCATAATGCTAGTTATAGCTTTA
TATGAAGAACATATGTTTTAGATGTTTACCACCTCTTTTTTGATGTCATC
TTCGCCTTTTCATTCTGTTTTCATCGTGTCAACTGGTGATTTTTCCGCTT
AAACTCAATATAATATATAAATATATATGTATACAATCATTTATAGATTT
GTAATTGTAATAATATTTTTGTATTTTCAATTTTTGTTATCTTATTATCC
ATCTTGACTTTTTTAATATCAAATATGCATTCACAATCGTTTTTTGTTTT
CATTTTTCGCCCTTCTATCTAAAATTCAGTTCAGATTTTTGTTTGCTTAC
TTCCGAGCGGCTGAGATGTTGCGTTAGATGAGAATTGTTAATATTTTTTT
AATTAATCCAATCTATATATCAATCGTTATATTTTATTGATTATTATTAT
TATATAAATTTGAAACTAATTTATTATTATTAATATTAATGTTATTTGGA
ATGTGAACATATTTTTTTCTCTGGTTTTGGTGGTTTTCAAAAAATATAGT
CGTTTATTTATTATATGTGATTGTTTCTGAATTTTTGTCAATGATATTTG
ATACGATTTTGTTTTTATCGTATATATATA
back to top

protein sequence of SMED30033279-orf-1

>SMED30033279-orf-1 ID=SMED30033279-orf-1|Name=SMED30033279-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=699bp
MKLIFLILKLSKDSMISNIIVKSFTFLFIFQLGDFSNQTNSNSTILPTIQ
TFPQNRSSAKLKSKQEIIFKTSIADVYLNSLKNSSDNMSAFLSSEGFSSL
ILKLGLRKRNNISKTFNNVSIKCHSPIQMLSWFNKTKSGLSKEDFITLCP
SLLVQMVSRVCRPNVTQPMKPMKPMNNTSSPVINNNLAIWLCSFGAVIVI
SLVGLLVVWLIPIMPKSYYNSISQLLIALAVGSLAGDALLHLIPHALMDD
GEKGHSHNGHNKMVWKSLVALIGIHLFFLTERITILYQNLRSKRKSKKQH
FLKLLTKKLSLENFYSEASAGDKFEDSEKAPVKSSENKALSTGKLHWASK
SRKYSGSSKELVHASSHIGIDGEVNIGAHLCNRPKSKPHVNSDCPDSMNY
ELCNTINPYSMNPESNGCNPNNSEARLQTNGEIKTVQPIEESKPNYLLTD
RQLTNISSAQNETSNWSNKEDHKLLSPQIPPENNPNNVEIKTVGTKHSDH
TERLEIGAGGATVKSSLAHPFKNKPHGHHHGHSHDLSSVKAIAYTVIAGD
GLHNFCDGIAIGAAFANDIGGGLSTAIAVLCHELPHELGDFVVLLHAGMS
LRTAIFYNLMSSVFCAIGMVIGVQLGKLPSISSWIFMLTAGMFLYIALVD
MMPELSTRRLKGNKIFHRPSILFLWQNIGFVIGSAIMLVIALYEEHMF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR003689ZIP
Vocabulary: molecular function
TermDefinition
GO:0046873metal ion transmembrane transporter activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0030001metal ion transport
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003689Zinc/iron permeasePFAMPF02535Zipcoord: 188..329
e-value: 3.8E-22
score: 79.0
coord: 448..691
e-value: 7.8E-49
score: 166.7
NoneNo IPR availablePANTHERPTHR12191SOLUTE CARRIER FAMILY 39coord: 82..696
NoneNo IPR availableTMHMMTMhelixcoord: 264..286
NoneNo IPR availableTMHMMTMhelixcoord: 604..626
NoneNo IPR availableTMHMMTMhelixcoord: 222..244
NoneNo IPR availableTMHMMTMhelixcoord: 630..649
NoneNo IPR availableTMHMMTMhelixcoord: 187..209
NoneNo IPR availableTMHMMTMhelixcoord: 670..692