SCM-like with MBT domains protein

Overview
NameSCM-like with MBT domains protein
Smed IDSMED30033271
Length (bp)2754
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SCM-like with MBT domains protein (SMED30033271) t-SNE clustered cells

Violin plots show distribution of expression levels for SCM-like with MBT domains protein (SMED30033271) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SCM-like with MBT domains protein (SMED30033271) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SCM-like with MBT domains protein (SMED30033271) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033271

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30033271SMESG000060677.1 SmedASXL_016003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:HGNC Symbol;Acc:HGNC:20255])

HSP 1 Score: 183.341 bits (464), Expect = 4.203e-47
Identity = 182/683 (26.65%), Postives = 291/683 (42.61%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFV----RGSPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAE---ILPANTSKVSGYSI-----VGLRNNSWDAHL----LSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP-SAYLMPAPVLAPFDPDDIT-------------------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     ++ ++   + + +W   VI    +  + + + YG     D    W D++  K  +  I WC  N+K+  +P    +  SD    + +  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S+     +N   +L+YLD  LH +GWA   G++  PP  I    + +     +           P  L  D++ I  H F    ++EAV+P  P  I PAT+  V D+ YFLVE+                  PE      F   A+   I P   S  +G  I        ++  W  +L      ++PQ+  P L             E  F    KLEAVNP   + +  AT I ++ GS L W++L+ S+  +P+ +V  + S +IFP+GWCE   +P+  P  A +     +A   P+                                  I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTAVPYGSFKHVDTRL----QNGFAPG---MKLEVAVRTDPETYWVATVITTCEQLLLLRYDGYGEDRRAD---FWCDIR--KADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESS-----DNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMD--------------DLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWADYLKQCGAEAAPQRCFPPL-----------ISEHEFKENMKLEAVNPILPEEVCVAT-ITAVRGSYL-WLQLEGSKKPIPECIVS-VESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPP 651          

HSP 2 Score: 57.7658 bits (138), Expect = 9.686e-8
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  785 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 866          
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Match: SFMBT2 (Scm like with four mbt domains 2 [Source:HGNC Symbol;Acc:HGNC:20256])

HSP 1 Score: 182.956 bits (463), Expect = 6.315e-47
Identity = 171/644 (26.55%), Postives = 278/644 (43.17%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSP-----PLNIGINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGF--GGMAEILPANTSKVSGYSIVGLRNNS-----WDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAPFD-----PDDITIFLH-------------------PACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            W EYLEETG    P   FKHV  S+    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+  +   +  + WC  N K  + P    E  +D    + ++   S       LE   +      LI VG+ +E     +    W V V+ N GGRL+L + G +     +T +   +LFYLDYRL  +GW + N ++  P     PL +      +   + +  +    PME+  D  +++ HFF  G ++E VN  +P  I PA++  V +  +F V +                  PEP   +         ILP      +G S+   +  S     W  +      Q+  P    F+N      S    F    KLEAVNP N   +  A+++ S++G RL+W+ L+  +  +P+ +VD + S +IFPVGWCE   YP+  P           A + P   L P       P D+ +F H                     C+ GPYL++   AE LP+ +GPG C+ VL+E+  +++  ++KP +++R LQ+   ED H      T+   K+++  +  R+  +V++      +  FCR+    L  CP+  +
Sbjct:   45 WGEYLEETGASAAPHTSFKHVEISI----QSNFQPG---MKLEVANKNNPDTYWVATIITTC--GQLLLLRYCGYGEDRRADFWCDVVIA--DLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLE-----DTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTID--------------DLRPEPSKLSMLCHADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFC--FRN-----TSFSRGFTKNMKLEAVNPRNPGELCVASVV-SVKG-RLMWLHLEGLQTPVPEVIVD-VESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAVVQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAE-LPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQL--VEDPHWNFQEETL---KAKYRGKTYRA--VVKIVRTSDQVANFCRRVCAKLECCPNLFS 640          

HSP 2 Score: 51.6026 bits (122), Expect = 8.119e-6
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL WTV  +  ++  TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  812 ERLVLESNPLEWTVTDVVRFIKLTDCAPLAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN 893          
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Match: SFMBT2 (Scm like with four mbt domains 2 [Source:HGNC Symbol;Acc:HGNC:20256])

HSP 1 Score: 182.956 bits (463), Expect = 6.639e-47
Identity = 171/644 (26.55%), Postives = 278/644 (43.17%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSP-----PLNIGINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGF--GGMAEILPANTSKVSGYSIVGLRNNS-----WDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAPFD-----PDDITIFLH-------------------PACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            W EYLEETG    P   FKHV  S+    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+  +   +  + WC  N K  + P    E  +D    + ++   S       LE   +      LI VG+ +E     +    W V V+ N GGRL+L + G +     +T +   +LFYLDYRL  +GW + N ++  P     PL +      +   + +  +    PME+  D  +++ HFF  G ++E VN  +P  I PA++  V +  +F V +                  PEP   +         ILP      +G S+   +  S     W  +      Q+  P    F+N      S    F    KLEAVNP N   +  A+++ S++G RL+W+ L+  +  +P+ +VD + S +IFPVGWCE   YP+  P           A + P   L P       P D+ +F H                     C+ GPYL++   AE LP+ +GPG C+ VL+E+  +++  ++KP +++R LQ+   ED H      T+   K+++  +  R+  +V++      +  FCR+    L  CP+  +
Sbjct:   46 WGEYLEETGASAAPHTSFKHVEISI----QSNFQPG---MKLEVANKNNPDTYWVATIITTC--GQLLLLRYCGYGEDRRADFWCDVVIA--DLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLE-----DTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTID--------------DLRPEPSKLSMLCHADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFC--FRN-----TSFSRGFTKNMKLEAVNPRNPGELCVASVV-SVKG-RLMWLHLEGLQTPVPEVIVD-VESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAVVQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAE-LPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQL--VEDPHWNFQEETL---KAKYRGKTYRA--VVKIVRTSDQVANFCRRVCAKLECCPNLFS 641          

HSP 2 Score: 51.6026 bits (122), Expect = 8.332e-6
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL WTV  +  ++  TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  813 ERLVLESNPLEWTVTDVVRFIKLTDCAPLAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN 894          
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Match: SFMBT2 (Scm like with four mbt domains 2 [Source:HGNC Symbol;Acc:HGNC:20256])

HSP 1 Score: 182.956 bits (463), Expect = 6.639e-47
Identity = 171/644 (26.55%), Postives = 278/644 (43.17%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSP-----PLNIGINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGF--GGMAEILPANTSKVSGYSIVGLRNNS-----WDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAPFD-----PDDITIFLH-------------------PACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            W EYLEETG    P   FKHV  S+    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+  +   +  + WC  N K  + P    E  +D    + ++   S       LE   +      LI VG+ +E     +    W V V+ N GGRL+L + G +     +T +   +LFYLDYRL  +GW + N ++  P     PL +      +   + +  +    PME+  D  +++ HFF  G ++E VN  +P  I PA++  V +  +F V +                  PEP   +         ILP      +G S+   +  S     W  +      Q+  P    F+N      S    F    KLEAVNP N   +  A+++ S++G RL+W+ L+  +  +P+ +VD + S +IFPVGWCE   YP+  P           A + P   L P       P D+ +F H                     C+ GPYL++   AE LP+ +GPG C+ VL+E+  +++  ++KP +++R LQ+   ED H      T+   K+++  +  R+  +V++      +  FCR+    L  CP+  +
Sbjct:   46 WGEYLEETGASAAPHTSFKHVEISI----QSNFQPG---MKLEVANKNNPDTYWVATIITTC--GQLLLLRYCGYGEDRRADFWCDVVIA--DLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLE-----DTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTID--------------DLRPEPSKLSMLCHADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFC--FRN-----TSFSRGFTKNMKLEAVNPRNPGELCVASVV-SVKG-RLMWLHLEGLQTPVPEVIVD-VESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAVVQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAE-LPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQL--VEDPHWNFQEETL---KAKYRGKTYRA--VVKIVRTSDQVANFCRRVCAKLECCPNLFS 641          

HSP 2 Score: 51.6026 bits (122), Expect = 8.332e-6
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL WTV  +  ++  TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  813 ERLVLESNPLEWTVTDVVRFIKLTDCAPLAKIFQEQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN 894          
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Match: L3MBTL2 (L3MBTL histone methyl-lysine binding protein 2 [Source:HGNC Symbol;Acc:HGNC:18594])

HSP 1 Score: 74.3294 bits (181), Expect = 5.411e-13
Identity = 115/475 (24.21%), Postives = 193/475 (40.63%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVS-----RSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGW-IKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTS-DIKLEFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVD-----TFVRGSPSAFPMELSCDREI--KEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSA 1530
            W ++L++   +  P + FKHV        + K  + E L  N D+ +       S  +W   VI   + G+ + L + G +N+  +   W ++ +    V  I WC  N K  + P       +D +  + K  + S  + ++F  K  ES +   + G  LE   ++ V       V +  GGRL+L++   DS       +  F+       +H +GW++  G         GI +S    D     TF +    A P      R +  +  +FEEG ++EA++P++   IC AT+  VL   Y ++ +    +                  F        I PA   + +   +    G    +++  + L  +  K AP   +      +DC     F  G KLEAV+    + I  AT+ R +   RL+ I  D      D  VD   S +I+PVGWCE+  Y +  P A
Sbjct:  181 WGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVL--NSDAVL------PSRVYWIASVIQ--TAGYRVLLRYEGFENDASH-DFWCNLGTV--DVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKRLVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDGDS-------DDDFWCHMWSPLIHPVGWSRRVGH--------GIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTDGLD------------WFCYHASSHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLF-----NMDCPNHG-FKVGMKLEAVDLMEPRLICVATVKRVVH--RLLSIHFDGWDSEYDQWVD-CESPDIYPVGWCELTGYQLQPPVA 606          
BLAST of SCM-like with MBT domains protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0080491)

HSP 1 Score: 71.2478 bits (173), Expect = 2.905e-12
Identity = 84/388 (21.65%), Postives = 157/388 (40.46%), Query Frame = 1
Query:  397 EIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANC---FESDIQMIIEKNKLTSDIKLEFITKKTESYR-LIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVR-----GSPSAFPMELSCDR---EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            + D+   W ++ +++  V S+ WC    K  I P      ++     ++ +      +   F  K  +S +   ++G  LEC  ++ +  V    V    G RL L +F  D           F+       +H +GWA + G   + P +  +   ++  +  +       +   F M  + D    + K + F EG ++EAV+P++ S ICPAT+  VL   Y ++ +         +           +  AGF  +  I   + +  +GY     R  +W+ +L  +       HL +           +  F  G  LE  +  + + +  AT+ R +   RL+ +  D   D  D  +D   S +I+PVGWC +V++ +  P
Sbjct:  264 DTDSHDFWVNLCNAE--VHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDD---------GFWCHEDSPIIHPVGWATTVGHNLAAPQDY-LERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNI---SVTPPNGYDS---RTFTWEGYLRDTGAVAAGQHLFH-------RIIPDHGFEVGMSLECADLMDPRLVCVATVARVV--GRLLKVHFDGWTDEYDQWLD-CESADIYPVGWCVLVNHKLEGP 623          
BLAST of SCM-like with MBT domains protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0080492)

HSP 1 Score: 70.0922 bits (170), Expect = 8.268e-12
Identity = 84/388 (21.65%), Postives = 157/388 (40.46%), Query Frame = 1
Query:  397 EIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANC---FESDIQMIIEKNKLTSDIKLEFITKKTESYR-LIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVR-----GSPSAFPMELSCDR---EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            + D+   W ++ +++  V S+ WC    K  I P      ++     ++ +      +   F  K  +S +   ++G  LEC  ++ +  V    V    G RL L +F  D           F+       +H +GWA + G   + P +  +   ++  +  +       +   F M  + D    + K + F EG ++EAV+P++ S ICPAT+  VL   Y ++ +         +           +  AGF  +  I   + +  +GY     R  +W+ +L  +       HL +           +  F  G  LE  +  + + +  AT+ R +   RL+ +  D   D  D  +D   S +I+PVGWC +V++ +  P
Sbjct:  616 DTDSHDFWVNLCNAE--VHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDD---------GFWCHEDSPIIHPVGWATTVGHNLAAPQDY-LERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNI---SVTPPNGYDS---RTFTWEGYLRDTGAVAAGQHLFHR-------IIPDHGFEVGMSLECADLMDPRLVCVATVARVV--GRLLKVHFDGWTDEYDQWLD-CESADIYPVGWCVLVNHKLEGP 975          
BLAST of SCM-like with MBT domains protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0333236)

HSP 1 Score: 70.0922 bits (170), Expect = 8.268e-12
Identity = 84/388 (21.65%), Postives = 157/388 (40.46%), Query Frame = 1
Query:  397 EIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANC---FESDIQMIIEKNKLTSDIKLEFITKKTESYR-LIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVR-----GSPSAFPMELSCDR---EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            + D+   W ++ +++  V S+ WC    K  I P      ++     ++ +      +   F  K  +S +   ++G  LEC  ++ +  V    V    G RL L +F  D           F+       +H +GWA + G   + P +  +   ++  +  +       +   F M  + D    + K + F EG ++EAV+P++ S ICPAT+  VL   Y ++ +         +           +  AGF  +  I   + +  +GY     R  +W+ +L  +       HL +           +  F  G  LE  +  + + +  AT+ R +   RL+ +  D   D  D  +D   S +I+PVGWC +V++ +  P
Sbjct:  616 DTDSHDFWVNLCNAE--VHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDD---------GFWCHEDSPIIHPVGWATTVGHNLAAPQDY-LERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNI---SVTPPNGYDS---RTFTWEGYLRDTGAVAAGQHLFHR-------IIPDHGFEVGMSLECADLMDPRLVCVATVARVV--GRLLKVHFDGWTDEYDQWLD-CESADIYPVGWCVLVNHKLEGP 975          
BLAST of SCM-like with MBT domains protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0289981)

HSP 1 Score: 70.0922 bits (170), Expect = 9.366e-12
Identity = 84/388 (21.65%), Postives = 157/388 (40.46%), Query Frame = 1
Query:  397 EIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANC---FESDIQMIIEKNKLTSDIKLEFITKKTESYR-LIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVR-----GSPSAFPMELSCDR---EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            + D+   W ++ +++  V S+ WC    K  I P      ++     ++ +      +   F  K  +S +   ++G  LEC  ++ +  V    V    G RL L +F  D           F+       +H +GWA + G   + P +  +   ++  +  +       +   F M  + D    + K + F EG ++EAV+P++ S ICPAT+  VL   Y ++ +         +           +  AGF  +  I   + +  +GY     R  +W+ +L  +       HL +           +  F  G  LE  +  + + +  AT+ R +   RL+ +  D   D  D  +D   S +I+PVGWC +V++ +  P
Sbjct:  616 DTDSHDFWVNLCNAE--VHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRYFDSDD---------GFWCHEDSPIIHPVGWATTVGHNLAAPQDY-LERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNI---SVTPPNGYDS---RTFTWEGYLRDTGAVAAGQHLFHR-------IIPDHGFEVGMSLECADLMDPRLVCVATVARVV--GRLLKVHFDGWTDEYDQWLD-CESADIYPVGWCVLVNHKLEGP 975          
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Match: sfmbt1 (Scm like with four mbt domains 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2592])

HSP 1 Score: 171.4 bits (433), Expect = 1.772e-43
Identity = 174/654 (26.61%), Postives = 275/654 (42.05%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTS----DIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDRE-------IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAP---FDPDDI---------------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            W +YLEE+G   +P + FKHV + L    E    P     E+ +    ES +W  V  I       + L + G +++      W D+ ++   +  I W     +    P    E   D + ++EK    S       LE   +      L+  G  +E       G VW   +  N GGRL+L + G D  G P  N +  ++FYLD  LH  GWA+ +     PP  + + +        V+ S S+   + S   E       I  H F EG ++EAV+P  P  I PAT+  V ++ +FLV +              +        F        I P   S  +G  +    G +   +D A  L     + AP    F       C +ES+      LEAVNP   ++IH AT+ + ++G  + WIRL+  +  +P+ +V    S +IFPV WCE   YP++ P           A + P     P     PD                        I+ +  C+ GPYL++   AE LP+ +GPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V   C+  C
Sbjct:   21 WDDYLEESGALSVPHHAFKHVDQGL----ETGLTPG-MKLEVCVRTESESVYW--VATIITTCGQLLLLRYEGYQDD-RRADFWCDIMTA--DLHPIGWSKQQGRMMKPPEGVREKHQDWEALLEKALAESCSVPASLLEGAQRGCNPIDLLSPGLNVELVDHQDAGVVWSAVIEENIGGRLRLRYAGTD--GLPE-NQSITWVFYLDPLLHLSGWAQEHNCTLRPPAAL-LPLRTEAEWEEVKKSISSQEQDPSISEEFYRDRSAITPHCFTEGMKLEAVDPAAPFTISPATVAKVFNEQFFLVLMDDMRDEAQKEGGAHS--------FLCHRDSPGIFPTQWSLKNGVKLSPPPGFQGQDFDWADYLKQCEAEAAPQ-QCFPPDPSDQCIKESMM-----LEAVNPICPENIHVATVTK-VKGQHM-WIRLEGLKQAMPEIIVH-TDSMDIFPVSWCETNGYPLLHPCKPRVEKQRKVAVVQPEKHRVPSKDSSPDTTKQHMNSSQAEMGQANGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQEGRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADQVADFCRKTCIKLECCPNLFGPRMVLERCSENC 635          

HSP 2 Score: 51.6026 bits (122), Expect = 4.784e-6
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L S+PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  786 QKLCLESSPLEWSVTDVVRFIRTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 866          
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:NCBI gene;Acc:100001629])

HSP 1 Score: 171.4 bits (433), Expect = 2.089e-43
Identity = 174/655 (26.56%), Postives = 275/655 (41.98%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTS----DIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDRE-------IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAP---FDPDDI----------------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            W +YLEE+G   +P + FKHV + L    E    P     E+ +    ES +W  V  I       + L + G +++      W D+ ++   +  I W     +    P    E   D + ++EK    S       LE   +      L+  G  +E       G VW   +  N GGRL+L + G D  G P  N +  ++FYLD  LH  GWA+ +     PP  + + +        V+ S S+   + S   E       I  H F EG ++EAV+P  P  I PAT+  V ++ +FLV +              +        F        I P   S  +G  +    G +   +D A  L     + AP    F       C +ES+      LEAVNP   ++IH AT+ + ++G  + WIRL+  +  +P+ +V    S +IFPV WCE   YP++ P           A + P     P     PD                         I+ +  C+ GPYL++   AE LP+ +GPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V   C+  C
Sbjct:   21 WDDYLEESGALSVPHHAFKHVDQGL----ETGLTPG-MKLEVCVRTESESVYW--VATIITTCGQLLLLRYEGYQDD-RRADFWCDIMTA--DLHPIGWSKQQGRMMKPPEGVREKHQDWEALLEKALAESCSVPASLLEGAQRGCNPIDLLSPGLNVELVDHQDAGVVWSAVIEKNIGGRLRLRYAGTD--GLPE-NQSITWVFYLDPLLHLSGWAQEHNCTLRPPAAL-LPLRTEAEWEEVKKSISSQEQDPSISEEFYRDRSAITPHCFTEGMKLEAVDPAAPFTISPATVAKVFNEQFFLVLMDDMRDEAQKEGGAHS--------FLCHRDSPGIFPTQWSLKNGVKLSPPPGFQGQDFDWADYLKQCEAEAAPQ-QCFPPDPSDQCIKESMM-----LEAVNPICPENIHVATVTK-VKGQHM-WIRLEGLKQAMPEIIVH-TDSMDIFPVSWCETNGYPLLHPCKPRVEKQRKVAVVQPEKHRVPSKDSSPDTTKQHMNSSQAEMAGQANGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQEGRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADQVADFCRKTCIKLECCPNLFGPRMVLERCSENC 636          

HSP 2 Score: 51.6026 bits (122), Expect = 4.704e-6
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L S+PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  787 QKLCLESSPLEWSVTDVVRFIRTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 867          
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Match: sfmbt2 (Scm like with four mbt domains 2 [Source:ZFIN;Acc:ZDB-GENE-041210-196])

HSP 1 Score: 169.859 bits (429), Expect = 6.527e-43
Identity = 171/645 (26.51%), Postives = 276/645 (42.79%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYL--FYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSA-----FPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD--SEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP-SAYLMPAPVLAPFDPDDIT---------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSC-----PSFITTSAVRVCN 1962
            W EYLE+TG    P   F+HV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+ +++  +  + WC  N+K+   P    E  SD    + K    S       LE   +   +  LI  G+ LE    +     W  +V  N GGRL L + G         N+ ++Y+  FYLD RL  LGWAK N     PP ++    S S   T +  + +       P+E+  D  ++  H F  G ++E V+P++P  ICP ++  V ++ +F + +               T D  P           ILP      +G  +    G     +D A  L  +  + AP    F N      SQ   F     LEAVNP +   +  A  I  ++G  L+W+RL+  ++P LPD +VD + S  IFPVGWCE   YP+        +P   +A   P+  T                     +F++  C+ GPYL++   AE LP+ +GPG C  VL+E+  +L+  ++KP +++R LQ+  +   +    T+     K+++  ++ RS   + +      +  FCR+    L  C     P+F++      C+
Sbjct:   36 WEEYLEDTGATAAPHTSFRHVELSL----QSSFQPG---MKLEVANKGSVDTYWVATIITTC--GQLLLLRYCGYGEDRKADFWCDVMTAE--LHPVGWCAQNDKTLQPPEAIKEKYSDWTEFLIKELTGSRTAPANLLEGPLRGKNTVDLIMEGSILELRDASEPSVYWATQVQRNVGGRLCLSYVG--------LNDPSYYMWMFYLDTRLRPLGWAKENNLPMKPPTDLCDLRSSSEWTTALDEATAEALNNPLPLEVFKDHADLHTHSFRAGMKLEMVSPVEPFHICPVSVTKVYNEYHFQITV------------DDLTADATPTSAVCHAESPGILPVQWCLKNGVELERPRGFETQDFDWADYLKHTSTEAAPD-ACFPNA-----SQSRGFCKDMWLEAVNPLHPAELCVAR-ITQVKGC-LLWLRLEGLTKP-LPDCIVD-VESMNIFPVGWCEANGYPLTHSLKTVCLPQKKIAVVQPEKHTYFLLTCLCCLGLVNGKYCCSQLFINHRCFSGPYLNKGRIAE-LPKAVGPGKCAVVLKEILTMLINSAYKPGRVLRELQMVEDPQWNCQEETL-----KAKYKGKSYRS--TMRIVRTADQVSEFCRRVCERLQCCLNLFGPTFVSDKCPENCS 631          

HSP 2 Score: 53.5286 bits (127), Expect = 1.266e-6
Identity = 30/82 (36.59%), Postives = 50/82 (60.98%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            +R+ L +NPL W+V  + D++++TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  783 DRLVLDTNPLQWSVSDVVDFITSTDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLGPAIKLCHQIERVKVAFYSQYAN 864          
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Match: sfmbt2 (Scm like with four mbt domains 2 [Source:ZFIN;Acc:ZDB-GENE-041210-196])

HSP 1 Score: 163.696 bits (413), Expect = 5.215e-41
Identity = 173/659 (26.25%), Postives = 278/659 (42.19%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYL--FYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSA-----FPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD--SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAP---VLAPFDPDDI-----------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSC-----PSFITTSAVRVCN 1962
            W EYLE+TG    P   F+HV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+ +++  +  + WC  N+K+   P    E  SD    + K    S       LE   +   +  LI  G+ LE    +     W  +V  N GGRL L + G         N+ ++Y+  FYLD RL  LGWAK N     PP ++    S S   T +  + +       P+E+  D  ++  H F  G ++E V+P++P  ICP ++  V ++ +F + +               T D  P           ILP      +G  +    G     +D A  L  +  + AP    F N      SQ   F     LEAVNP +   +  A  I  ++G  L+W+RL+  ++P LPD +VD + S  IFPVGWCE   YP                +V P  +L  +    +L P   D                    +F++  C+ GPYL++   AE LP+ +GPG C  VL+E+  +L+  ++KP +++R LQ+  +   +    T+     K+++  ++ RS   + +      +  FCR+    L  C     P+F++      C+
Sbjct:   15 WEEYLEDTGATAAPHTSFRHVELSL----QSSFQPG---MKLEVANKGSVDTYWVATIITTC--GQLLLLRYCGYGEDRKADFWCDVMTAE--LHPVGWCAQNDKTLQPPEAIKEKYSDWTEFLIKELTGSRTAPANLLEGPLRGKNTVDLIMEGSILELRDASEPSVYWATQVQRNVGGRLCLSYVG--------LNDPSYYMWMFYLDTRLRPLGWAKENNLPMKPPTDLCDLRSSSEWTTALDEATAEALNNPLPLEVFKDHADLHTHSFRAGMKLEMVSPVEPFHICPVSVTKVYNEYHFQITVD------------DLTADATPTSAVCHAESPGILPVQWCLKNGVELERPRGFETQDFDWADYLKHTSTEAAPD-ACFPNA-----SQSRGFCKDMWLEAVNPLHPAELCVAR-ITQVKGC-LLWLRLEGLTKP-LPDCIVD-VESMNIFPVGWCEANGYPLTHSLKTVCLPQKKIAVVQPEKHLWKSHTIFILFPLHHDLCLSKVRAYCLVNGKYCCSQLFINHRCFSGPYLNKGRIAE-LPKAVGPGKCAVVLKEILTMLINSAYKPGRVLRELQMVEDPQWNCQEETL-----KAKYKGKSYRS--TMRIVRTADQVSEFCRRVCERLQCCLNLFGPTFVSDKCPENCS 624          

HSP 2 Score: 53.5286 bits (127), Expect = 1.243e-6
Identity = 30/82 (36.59%), Postives = 50/82 (60.98%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            +R+ L +NPL W+V  + D++++TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  780 DRLVLDTNPLQWSVSDVVDFITSTDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLGPAIKLCHQIERVKVAFYSQYAN 861          
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Match: l3mbtl2 (L3MBTL histone methyl-lysine binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8713])

HSP 1 Score: 87.0409 bits (214), Expect = 5.952e-17
Identity = 113/468 (24.15%), Postives = 192/468 (41.03%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYN-YESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESD-IQMIIEKNKLTSDIKLEFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIW--FGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREI--KEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQE--------SVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            W  YLE++G    P + F+HV      C + E +      E+  ++    S  +W   V+ +L+     L + G +++ D   LW ++ ++   V  I WC  N K  + P    + D    ++E+      I ++F  K  +S R   + G  +E    + V       V +  GGRL+L++   G   +G+  ++   F+       +H +GW+++             N+++ +   F R   ++ P +    R +     FF+EG +IEA++P++   IC A++R VL   Y +V +     G  +              F        ILP       GY      NN     +     Q       Y +  G +   Q           F  G KLEAV+    + +  AT+ R +   RL+ +  D  EP+  D  VD   S EI+PVGWCE+  Y +  P
Sbjct:  255 WGSYLEKSGLLAAPVSCFRHVPL----CAQWEDVYVGLKVEVLNTHTALPSKVYWIATVV-QLAGYKALLRYEGFEDD-DRHDLWCNLGTA--DVHPIGWCAVNNKPLVPPQEVHQQDWKSYLMERLVGAHTIPVDFHVKMADSLRCPFRQGVRVEVVDRSQVSRTRLAVVDTVIGGRLRLLYEDAGLGPSGEVLSD---FWCHMQSPLVHHVGWSETVDHSIK---ETDTNVNMGSHPAFRRVHQNSVPDQFKKLRTVYMGATFFKEGMKIEAIDPLNLGNICVASVRKVLLDGYIMVGIDGVEIGDGSD------------WFCYHASSHAILPV------GY----CENNDIPLTVPPGYDQATFTWPVYLEETGAVAAPQRLFNTDDVGHGFTSGMKLEAVDLMEPRLVCVATVRRCV--GRLLLLHFDGWEPEF-DQWVD-CQSPEIYPVGWCEITGYQLQPP 682          
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Match: kif5b (kinesin family member 5B [Source:Xenbase;Acc:XB-GENE-854737])

HSP 1 Score: 161.77 bits (408), Expect = 2.745e-40
Identity = 174/669 (26.01%), Postives = 272/669 (40.66%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDI---QMIIEKNKLTSDIK---LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINI----SISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLL----SSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSE-PDLP--DFLVDPLTSTEIFPVGWCEMVDYPIVLP-----------------------SAYLMPAPVL-APFDPDDITIFLHPA------CYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRL 2031
            W EYLEETG    P ++FKHV  SL    +N   P      + + +  ES  +W  ++I    +  + L + G   E  +   W DM +S   +  + W   N KS   P    E      + + E +   S      LE   +  +   L   G+ LE          WPV+VL N GGRL+L + G              +LFYL   LH +GWA  + +   PP      +    SI  ++          P+ +        H F  G ++EA++P +PS   PAT+  V  + YF++E                       + +   G ++ +        GYS        WD +L     S++P+   P +           S + VF    KLEAVNP+ ++ I  AT+ + M      +IRL  E   LP  + +V  + S +IFP+GWCE   + +  P                       S    PA  L +P   D    +L P       C+ GPYL++   AE LP+ +GPG C+ VL+E+  LL+  ++KP +++R L++  +    +   TI     K+++  +  RS   VE+      +  FCR+T L L  CP+      V   C+  C      +       +R K L
Sbjct:   22 WEEYLEETGCIAAPHSFFKHVDTSL----KNGLSPG---MRLEVPHGTESQVYWIANIITTCGK-LLLLRYLGC-GEDRSADFWCDMVTS--DLHPLGWAQQNGKSLRPPEGIREKLQNWEEFLAENSTGVSSAPAHLLEGPHRGKDPLDLFGPGSKLELQHCRDSIVAWPVRVLENTGGRLQLQYEGVSD---------CVWLFYLHPSLHQVGWAAQHKYDMQPPQGTSCFLLTFCSIWYINFLFSVVQEQLPLPV--------HSFLAGMKVEALDPSNPSCFMPATVTKVFSERYFMIEFDDLRPLDSKTSRPLLCHCNSTGIIS--VGSSQKMGVPLRPPPGYS---EEEFDWDKYLTQCEGSAAPESNFPMV-----------SSDHVFQEQMKLEAVNPFQQEDICIATVTQVMGP----YIRLQLEGSKLPIAECIVH-VESMDIFPMGWCETNGHLLCAPPRTKVILMVKMKNQLARVLSELCSECFKPASFLCSPCHSDSNGKYLCPKIYFNHRCFSGPYLNKGRIAE-LPKSVGPGSCVLVLKEVLSLLINAAYKPSRVLRELELQEDSSWPQHTETI-----KAKYKGKTYRST--VELVRTSDQVPDFCRKTCLKLECCPNLFGPQMVLDQCSENCSVLTKTKYTHYYGKRRGKNL 633          

HSP 2 Score: 52.7582 bits (125), Expect = 2.636e-6
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            E + L S+PL WTV  +  Y+ +TDC  L      +++DG+A LLLTLP +     L+L  A+RLC H+  +K  F +  +
Sbjct:  750 EPLILDSSPLDWTVNDVIQYIKSTDCANLAKHFQEQEIDGKALLLLTLPAVQDCMDLKLAAAVRLCYHIERVKLAFYQSLS 830          
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Match: kif5b (kinesin family member 5B [Source:Xenbase;Acc:XB-GENE-854737])

HSP 1 Score: 158.303 bits (399), Expect = 4.221e-39
Identity = 170/658 (25.84%), Postives = 270/658 (41.03%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDI---QMIIEKNKLTSDIK---LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISN----VDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLL----SSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSE-PDLP--DFLVDPLTSTEIFPVGWCEMVDYPIVLPSA-------YLMPAPVLAPFDPDDI-----------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRL 2031
            W EYLEETG    P ++FKHV  SL    +N   P      + + +  ES  +W  ++I    +  + L + G   E  +   W DM +S   +  + W   N KS   P    E      + + E +   S      LE   +  +   L   G+ LE          WPV+VL N GGRL+L + G              +LFYL   LH +GWA  + +   PP  I    S       +  +        P E   ++  +  H F  G ++EA++P +PS   PAT+  V  + YF++E                       + +   G ++ +        GYS        WD +L     S++P+   P               + VF    KLEAVNP+ ++ I  AT+ + M      +IRL  E   LP  + +V  + S +IFP+GWCE   + +  P         Y+     L+  +P               I+ +  C+ GPYL++   AE LP+ +GPG C+ VL+E+  LL+  ++KP +++R L++  +    +   TI     K+++  +  RS   VE+      +  FCR+T L L  CP+      V   C+  C      +       +R K L
Sbjct:   22 WEEYLEETGCIAAPHSFFKHVDTSL----KNGLSPG---MRLEVPHGTESQVYWIANIITTCGK-LLLLRYLGC-GEDRSADFWCDMVTS--DLHPLGWAQQNGKSLRPPEGIREKLQNWEEFLAENSTGVSSAPAHLLEGPHRGKDPLDLFGPGSKLELQHCRDSIVAWPVRVLENTGGRLQLQYEGVSD---------CVWLFYLHPSLHQVGWAAQHKYDMQPPQAISHLKSEEEWKEILTKWETDPGDCVPAEFFQEQLPLPVHSFLAGMKVEALDPSNPSCFMPATVTKVFSERYFMIEFDDLRPLDSKTSRPLLCHCNSTGIIS--VGSSQKMGVPLRPPPGYS---EEEFDWDKYLTQCEGSAAPESNFPM---------PQPQSDHVFQEQMKLEAVNPFQQEDICIATVTQVMG----PYIRLQLEGSKLPIAECIVH-VESMDIFPMGWCETNGHLLCAPPRTKGVIFLYVHNVNGLSTTEPAPCKFNSNGKYLCPKIYFNHRCFSGPYLNKGRIAE-LPKSVGPGSCVLVLKEVLSLLINAAYKPSRVLRELELQEDSSWPQHTETI-----KAKYKGKTYRS--TVELVRTSDQVPDFCRKTCLKLECCPNLFGPQMVLDQCSENCSVLTKTKYTHYYGKRRGKNL 632          

HSP 2 Score: 53.1434 bits (126), Expect = 2.379e-6
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            E + L S+PL WTV  +  Y+ +TDC  L      +++DG+A LLLTLP +     L+L  A+RLC H+  +K  F +  +
Sbjct:  749 EPLILDSSPLDWTVNDVIQYIKSTDCANLAKHFQEQEIDGKALLLLTLPAVQDCMDLKLAAAVRLCYHIERVKLAFYQSLS 829          
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Match: kif5b (kinesin family member 5B [Source:Xenbase;Acc:XB-GENE-854737])

HSP 1 Score: 154.451 bits (389), Expect = 6.146e-38
Identity = 171/670 (25.52%), Postives = 272/670 (40.60%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDI---QMIIEKNKLTSDIK---LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISN----VDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLL----SSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSE-PDLP--DFLVDPLTSTEIFPVGWCEMVDYPIVLP-------------SAYLMPAPV------LAPFDPDDI-----------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRL 2031
            W EYLEETG    P ++FKHV  SL    +N   P      + + +  ES  +W  ++I    +  + L + G   E  +   W DM +S   +  + W   N KS   P    E      + + E +   S      LE   +  +   L   G+ LE          WPV+VL N GGRL+L + G              +LFYL   LH +GWA  + +   PP  I    S       +  +        P E   ++  +  H F  G ++EA++P +PS   PAT+  V  + YF++E                       + +   G ++ +        GYS        WD +L     S++P+   P               + VF    KLEAVNP+ ++ I  AT+ + M      +IRL  E   LP  + +V  + S +IFP+GWCE   + +  P             + +  P P       L+  +P               I+ +  C+ GPYL++   AE LP+ +GPG C+ VL+E+  LL+  ++KP +++R L++  +    +   TI     K+++  +  RS   VE+      +  FCR+T L L  CP+      V   C+  C      +       +R K L
Sbjct:   22 WEEYLEETGCIAAPHSFFKHVDTSL----KNGLSPG---MRLEVPHGTESQVYWIANIITTCGK-LLLLRYLGC-GEDRSADFWCDMVTS--DLHPLGWAQQNGKSLRPPEGIREKLQNWEEFLAENSTGVSSAPAHLLEGPHRGKDPLDLFGPGSKLELQHCRDSIVAWPVRVLENTGGRLQLQYEGVSD---------CVWLFYLHPSLHQVGWAAQHKYDMQPPQAISHLKSEEEWKEILTKWETDPGDCVPAEFFQEQLPLPVHSFLAGMKVEALDPSNPSCFMPATVTKVFSERYFMIEFDDLRPLDSKTSRPLLCHCNSTGIIS--VGSSQKMGVPLRPPPGYS---EEEFDWDKYLTQCEGSAAPESNFPM---------PQPQSDHVFQEQMKLEAVNPFQQEDICIATVTQVMGP----YIRLQLEGSKLPIAECIVH-VESMDIFPMGWCETNGHLLCAPPRTKVSPPKETVTTQHEKPIPSSKNVNGLSTTEPAPCKFNSNGKYLCPKIYFNHRCFSGPYLNKGRIAE-LPKSVGPGSCVLVLKEVLSLLINAAYKPSRVLRELELQEDSSWPQHTETI-----KAKYKGKTYRS--TVELVRTSDQVPDFCRKTCLKLECCPNLFGPQMVLDQCSENCSVLTKTKYTHYYGKRRGKNL 644          

HSP 2 Score: 53.1434 bits (126), Expect = 2.494e-6
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            E + L S+PL WTV  +  Y+ +TDC  L      +++DG+A LLLTLP +     L+L  A+RLC H+  +K  F +  +
Sbjct:  761 EPLILDSSPLDWTVNDVIQYIKSTDCANLAKHFQEQEIDGKALLLLTLPAVQDCMDLKLAAAVRLCYHIERVKLAFYQSLS 841          
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Match: ankrd13b (ankyrin repeat domain 13B [Source:Xenbase;Acc:XB-GENE-5907157])

HSP 1 Score: 154.066 bits (388), Expect = 9.294e-38
Identity = 154/633 (24.33%), Postives = 271/633 (42.81%), Query Frame = 1
Query:  181 LEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISP----ANCFESDIQMI--IEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISN-----VDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEP--VMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP------SAYLMPAPVLAPFDPDDI----------------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            LEE+    +P   FKHV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+ ++   +  I WC  N K  + P      C +    +I  +  ++      LE   +      LI   + +E     +    W V V+ N GGRL+L + G +      +++   +LFYLDYRL  +GW + N ++  PP ++    SIS        +  +      P+E+  D  +++ H    G ++E V+P + + I PAT+  V +  YF V +                  PE   V          +LP     ++G ++   +G     +D A        + APH   F+N      S    F    KLEAVNP N   I  A++ + ++G RL+W+ L+  +  +P+++VD + S +IFPVGWCE   YP+  P         L    +   F  ++                        +F++  C+ GP+L++   AE LP+ +GPG C+ VL+E+  +++  ++KP +++R LQ+  +      +      + K+++  +  R+   V++      +  FCR+    L  CP+  +
Sbjct:    1 LEESASSAVPHTSFKHVEISL----QSSFQPG---MKLEVANKSNPDTYWVATIITTC--GQLLLLRYCGYGEDRKADFWCDVMTA--DLHPIGWCTQNNKLLMPPDAIKEECTDWAEYLIHDLTGSRTAPAKLLEGPLRGKTPVDLITADSLMELQDNQNPFQYWTVHVIENIGGRLRLRYVGLE-----ESDSWDQWLFYLDYRLRPVGWCQENQFRMDPPTDLCPLQSISEWKSALEKSLAKAERCPLPVEVFKDHADLRSHSLTYGMKVEVVDPEEYTCIRPATVTKVFNNLYFQVTVD--------------DLRPEAKGVSMLCHADSLALLPVQWCLINGVNLTPPIGYPGQDFDWADYQKQCGAEAAPH-TLFRNS-----SSSWGFTKDMKLEAVNPRNPAEICVASVTK-VKG-RLLWLHLEGLQKPVPEYIVD-VESMDIFPVGWCEANSYPLSTPLKAADRKLCLNKKSLNQNFISENFKYKLYKNIFDFLGTANGKYCCPQLFINHRCFSGPFLNKGRIAE-LPQSVGPGKCVLVLKEVLGMVINAAYKPGRVLRELQLVEDS-----LWNFQEETLKAKYKGKTYRA--TVKIVRTSDQVPDFCRKICSKLECCPNLFS 586          

HSP 2 Score: 52.373 bits (124), Expect = 3.896e-6
Identity = 37/113 (32.74%), Postives = 60/113 (53.10%), Query Frame = 1
Query: 2326 RREGRGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            RR+ + R +   S+   KD       +  + E + L SNPL WTV  +  ++ +TDC  L     ++ +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  723 RRDRKTRSL--SSIDGDKDIT-----MKAEEEHLVLESNPLQWTVTDVVRFIKSTDCAPLAKIFQDQDIDGQALLLLTLPTVQECMELKLGPAIKLCHQIERVKVAFYAQYAN 828          
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Match: kif5b (kinesin family member 5B [Source:Xenbase;Acc:XB-GENE-854737])

HSP 1 Score: 138.658 bits (348), Expect = 5.549e-33
Identity = 166/665 (24.96%), Postives = 259/665 (38.95%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDI---QMIIEKNKLTSDIK---LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLL----SSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSE-PDLP--DFLVDPLTSTEIFPVGWCEMVDYPIVLP-------------SAYLMPAPV------LAPFDPDDI-----------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRL 2031
            W EYLEETG    P ++FKHV  SL    +N   P      + + +  ES  +W  ++I    +  + L + G   E  +   W DM +S   +  + W   N KS   P    E      + + E +   S      LE   +  +   L   G+ LE          WPV+VL N GGRL+L + G              +LFYL   LH +GWA  + +   PP  I                       L  + E KE   +  W+       DP    PA    V  + YF++E                       + +   G ++ +        GYS        WD +L     S++P+   P               + VF    KLEAVNP+ ++ I  AT+ + M      +IRL  E   LP  + +V  + S +IFP+GWCE   + +  P             + +  P P       L+  +P               I+ +  C+ GPYL++   AE LP+ +GPG C+ VL+E+  LL+  ++KP +++R L++  +    +   TI     K+++  +  RS   VE+      +  FCR+T L L  CP+      V   C+  C      +       +R K L
Sbjct:   22 WEEYLEETGCIAAPHSFFKHVDTSL----KNGLSPG---MRLEVPHGTESQVYWIANIITTCGK-LLLLRYLGC-GEDRSADFWCDMVTS--DLHPLGWAQQNGKSLRPPEGIREKLQNWEEFLAENSTGVSSAPAHLLEGPHRGKDPLDLFGPGSKLELQHCRDSIVAWPVRVLENTGGRLQLQYEGVSD---------CVWLFYLHPSLHQVGWAAQHKYDMQPPQAIS---------------------HLKSEEEWKEILTK--WE------TDPGDCVPAEFFQVFSERYFMIEFDDLRPLDSKTSRPLLCHCNSTGIIS--VGSSQKMGVPLRPPPGYS---EEEFDWDKYLTQCEGSAAPESNFPM---------PQPQSDHVFQEQMKLEAVNPFQQEDICIATVTQVMG----PYIRLQLEGSKLPIAECIVH-VESMDIFPMGWCETNGHLLCAPPRTKVSPPKETVTTQHEKPIPSSKNVNGLSTTEPAPCKFNSNGKYLCPKIYFNHRCFSGPYLNKGRIAE-LPKSVGPGSCVLVLKEVLSLLINAAYKPSRVLRELELQEDSSWPQHTETI-----KAKYKGKTYRS--TVELVRTSDQVPDFCRKTCLKLECCPNLFGPQMVLDQCSENCSVLTKTKYTHYYGKRRGKNL 610          

HSP 2 Score: 53.1434 bits (126), Expect = 2.546e-6
Identity = 35/98 (35.71%), Postives = 52/98 (53.06%), Query Frame = 1
Query: 2383 FVIDPTFLAGDI-----ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            F  +   L  DI     E + L S+PL WTV  +  Y+ +TDC  L      +++DG+A LLLTLP +     L+L  A+RLC H+  +K  F +  +
Sbjct:  710 FSDNEKLLTKDIRIELKEPLILDSSPLDWTVNDVIQYIKSTDCANLAKHFQEQEIDGKALLLLTLPAVQDCMDLKLAAAVRLCYHIERVKLAFYQSLS 807          
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Match: Sfmbt1 (Scm-like with four mbt domains 1 [Source:MGI Symbol;Acc:MGI:1859609])

HSP 1 Score: 190.66 bits (483), Expect = 7.771e-50
Identity = 184/672 (27.38%), Postives = 288/672 (42.86%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-AESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Match: Sfmbt1 (Scm-like with four mbt domains 1 [Source:MGI Symbol;Acc:MGI:1859609])

HSP 1 Score: 191.045 bits (484), Expect = 9.819e-50
Identity = 184/672 (27.38%), Postives = 288/672 (42.86%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-AESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          

HSP 2 Score: 57.7658 bits (138), Expect = 6.099e-8
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  782 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 863          
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Match: Sfmbt1 (Scm-like with four mbt domains 1 [Source:MGI Symbol;Acc:MGI:1859609])

HSP 1 Score: 191.045 bits (484), Expect = 9.819e-50
Identity = 184/672 (27.38%), Postives = 288/672 (42.86%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-AESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          

HSP 2 Score: 57.7658 bits (138), Expect = 6.099e-8
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  782 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 863          
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Match: Sfmbt1 (Scm-like with four mbt domains 1 [Source:MGI Symbol;Acc:MGI:1859609])

HSP 1 Score: 191.045 bits (484), Expect = 9.819e-50
Identity = 184/672 (27.38%), Postives = 288/672 (42.86%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-AESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          

HSP 2 Score: 57.7658 bits (138), Expect = 6.099e-8
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  782 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 863          
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Match: Sfmbt1 (Scm-like with four mbt domains 1 [Source:MGI Symbol;Acc:MGI:1859609])

HSP 1 Score: 187.193 bits (474), Expect = 1.431e-49
Identity = 181/648 (27.93%), Postives = 281/648 (43.36%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVSA-ESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRAT--VEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENC 624          
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Match: sp|Q9JMD2|SMBT1_RAT (Scm-like with four MBT domains protein 1 OS=Rattus norvegicus OX=10116 GN=Sfmbt1 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 2.567e-49
Identity = 188/673 (27.93%), Postives = 289/673 (42.94%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK-----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNI-GINISISNVDTFVR-GSPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP----SAYLMPAPVLAP------------------FDPDDI---------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG    P   FKHV      C ++ F P     E+ L  + E+  +W   VI    +  + + E YG   + D    W D++  +  +  I WC  N+K+  +P    +  SD    +++  LT         LE +        LI  G+ LEC         W V V+ N GGRLKL + G +       +    +L+YLD  LH +GWA   G++  PPL I  +       +   R       P  L  D++ I+ H F    ++EAV+P  P  I PATI  V D  YFLVE+        A  +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V  + S  IFP+GWCE   +P+  P       L    V+ P                    P  +          I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGATTAPYASFKHVD----ICLQSGFAPG-MKLEVALRKDPET--YWVATVITACEQLLLLRYEGYGEDRKAD---FWCDIR--RAGLYPIGWCQQNKKTLEAPEGIRDKVSDWSAFLQRT-LTGACGPPVALLEGLRNGRNPLDLIAPGSRLECQDFRDSVSTWIVTVVENIGGRLKLQYEGLE-----RHDGFEHWLYYLDPFLHHIGWAAQQGYELQPPLAIRHLKNEADWQEILARVKEEEPLPSYLFKDKQVIRTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEIDDLRPEDHARRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------VSEHQFKENMKLEAVNPLFPEEVSIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-VESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSPHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          

HSP 2 Score: 57.7658 bits (138), Expect = 4.606e-7
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  782 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 863          
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Match: sp|Q9JMD1|SMBT1_MOUSE (Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 6.868e-49
Identity = 184/672 (27.38%), Postives = 288/672 (42.86%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRG--SPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYP----------------IVLPSAYLMPAPVLAPFDPDDIT---------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     E+ L  + E+  +W   +I    +  + + E YG   + D    W D++  K  +  I WC  N+K+  +P    +  SD    +++  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S      +    +L+YLD  LH +GWA   G    PPL I    S ++    +         P  L  D++ I  H F    ++EAV+P  P  I PATI  V D  YFLVE+           +           F        I P   S  +G  I    G R+  +D A  L     + AP   + Q+        E  F    KLEAVNP   + +  AT + ++ GS L W++L+ S+  +P+F+V    S  IFP+GWCE   +P                +V P   ++ +  +     + +                I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTTVPYASFKHVDIRL----QNGFAPG-MKLEVALKNDPET--YWVATIITACEQLLLLRYEGYGEDRKAD---FWCDIR--KAGLYPIGWCQQNKKTLEAPEGIRDKVSDWNAFLQQTLIGACGPPVSLLEGLRNGRNPLDLIAPGSKLECQDFRDSLSTWLVTVVENIGGRLKLRYEGLESR-----DGFEHWLYYLDPFLHHIGWAAQQGCDLQPPLAIKHLKSEADWQEILAKVKEEEPLPSYLFKDKQVIGTHEFSINMKLEAVDPWSPFGISPATIAKVFDDKYFLVEMDDLRPEDHTRRS-----------FVCHANSPGIFPVQWSLKNGLHINPPPGFRSQDFDWADYLKQCGAEAAPQKCFPQS------ISEHQFKENMKLEAVNPLFPEEVCIAT-VTAVRGSYL-WLQLEGSKKPVPEFIVS-AESMNIFPLGWCETNGHPLSTPRRARGHKLRKIAVVQPEKQILSSRTVHEGLKNQLNSTHSVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVRTADRVTEFCRQTCIKLECCPNLFGPRMVLDTCSENCSVLTKTKYTHYYGKKKNKRIGRPP 648          

HSP 2 Score: 57.7658 bits (138), Expect = 4.266e-7
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  782 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 863          
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Match: sp|Q9UHJ3|SMBT1_HUMAN (Scm-like with four MBT domains protein 1 OS=Homo sapiens OX=9606 GN=SFMBT1 PE=1 SV=2)

HSP 1 Score: 183.341 bits (464), Expect = 2.018e-46
Identity = 182/683 (26.65%), Postives = 291/683 (42.61%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWI-KLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFV----RGSPSAFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAE---ILPANTSKVSGYSI-----VGLRNNSWDAHL----LSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD-SEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP-SAYLMPAPVLAPFDPDDIT-------------------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRRKRLFSRP 2043
            W +YLEETG   +P   FKHV   L    +N F P     ++ ++   + + +W   VI    +  + + + YG     D    W D++  K  +  I WC  N+K+  +P    +  SD    + +  + +       LE +        LI  G+ LEC         W V V+ N GGRLKL + G +S+     +N   +L+YLD  LH +GWA   G++  PP  I    + +     +           P  L  D++ I  H F    ++EAV+P  P  I PAT+  V D+ YFLVE+                  PE      F   A+   I P   S  +G  I        ++  W  +L      ++PQ+  P L             E  F    KLEAVNP   + +  AT I ++ GS L W++L+ S+  +P+ +V  + S +IFP+GWCE   +P+  P  A +     +A   P+                                  I+ +  C+ GPYL++   AE LP+ +GPG+C+ VLRE+  LL+  ++KP +++R LQ+D +   H     +     K+++  ++ R+   VE+      +  FCRQT + L  CP+      V   C+  C      +       ++ KR+   P
Sbjct:   22 WEDYLEETGSTAVPYGSFKHVDTRL----QNGFAPG---MKLEVAVRTDPETYWVATVITTCEQLLLLRYDGYGEDRRAD---FWCDIR--KADLYPIGWCEQNKKTLEAPEGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESS-----DNYEHWLYYLDPFLHHVGWAAQQGYELQPPSAIRHLKNEAEWQEILAKVKEEEEEPLPSYLFKDKQVIGIHTFSVNMKLEAVDPWSPFGISPATVVKVFDEKYFLVEMD--------------DLRPENHARRSFVCHADSPGIFPVQWSLKNGLHISPPPGYPSQDFDWADYLKQCGAEAAPQRCFPPL-----------ISEHEFKENMKLEAVNPILPEEVCVAT-ITAVRGSYL-WLQLEGSKKPIPECIVS-VESMDIFPLGWCETNGHPLSTPRRARVYKQRKIAVVQPEKQVPSSRTVHEGLRNQELNSTESVMINGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVL-----KAKYKGKSYRA--TVEIVKTADRVTEFCRQTCIKLECCPNLFGPRMVLDKCSENCSVLTKTKYTHYYGKKKNKRIGRPP 651          

HSP 2 Score: 57.7658 bits (138), Expect = 4.651e-7
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            ER+ L SNPL W+V  +  ++ +TDC  L     ++++DG+A LLLTLP +     L+L  AI+LC H+  +K  F E+FA+
Sbjct:  785 ERLHLDSNPLKWSVADVVRFIRSTDCAPLARIFLDQEIDGQALLLLTLPTVQECMDLKLGPAIKLCHHIERIKFAFYEQFAN 866          
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Match: sp|Q5VUG0|SMBT2_HUMAN (Scm-like with four MBT domains protein 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 3.748e-46
Identity = 171/644 (26.55%), Postives = 278/644 (43.17%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSP-----PLNIGINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGF--GGMAEILPANTSKVSGYSIVGLRNNS-----WDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLAPFD-----PDDITIFLH-------------------PACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            W EYLEETG    P   FKHV  S+    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+  +   +  + WC  N K  + P    E  +D    + ++   S       LE   +      LI VG+ +E     +    W V V+ N GGRL+L + G +     +T +   +LFYLDYRL  +GW + N ++  P     PL +      +   + +  +    PME+  D  +++ HFF  G ++E VN  +P  I PA++  V +  +F V +                  PEP   +         ILP      +G S+   +  S     W  +      Q+  P    F+N      S    F    KLEAVNP N   +  A+++ S++G RL+W+ L+  +  +P+ +VD + S +IFPVGWCE   YP+  P           A + P   L P       P D+ +F H                     C+ GPYL++   AE LP+ +GPG C+ VL+E+  +++  ++KP +++R LQ+   ED H      T+   K+++  +  R+  +V++      +  FCR+    L  CP+  +
Sbjct:   46 WGEYLEETGASAAPHTSFKHVEISI----QSNFQPG---MKLEVANKNNPDTYWVATIITTC--GQLLLLRYCGYGEDRRADFWCDVVIA--DLHPVGWCTQNNKVLMPPDAIKEKYTDWTEFLIRDLTGSRTAPANLLEGPLRGKGPIDLITVGSLIELQDSQNPFQYWIVSVIENVGGRLRLRYVGLE-----DTESYDQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPFYISPASVTKVFNNHFFQVTID--------------DLRPEPSKLSMLCHADSLGILPVQWCLKNGVSLTPPKGYSGQDFDWADYHKQHGAQEAPPFC--FRN-----TSFSRGFTKNMKLEAVNPRNPGELCVASVV-SVKG-RLMWLHLEGLQTPVPEVIVD-VESMDIFPVGWCEANSYPLTAPHKTVSQKKRKIAVVQPEKQLPPTVPVKKIPHDLCLFPHLDTTGTVNGKYCCPQLFINHRCFSGPYLNKGRIAE-LPQSVGPGKCVLVLKEVLSMIINAAYKPGRVLRELQL--VEDPHWNFQEETL---KAKYRGKTYRA--VVKIVRTSDQVANFCRRVCAKLECCPNLFS 641          
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Match: sp|Q5DTW2|SMBT2_MOUSE (Scm-like with four MBT domains protein 2 OS=Mus musculus OX=10090 GN=Sfmbt2 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 8.084e-46
Identity = 179/682 (26.25%), Postives = 288/682 (42.23%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SD-----IQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPP-----LNIGINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPA--------NTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGY---FQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP-----------------SAYLMPAPV--------LAPFDPDDIT-----------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQI--DNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGCEARMAARAGEKMSHQRR 2022
            W +YLEETG   +P   F+HV  S+     + F P     ++ ++     D +W   +I     G + L  Y    E      W D+  +   +  + WC  N K    P    +  SD     I+ +       +++ LE   +      LI V + +E     +    W V V  N GGRL+L + G +     +T +   +LFYLDYRL  +GW + N ++  PP     L +      +     V  + S  PME+  D  +++ HFF  G ++E ++  DP  I PA++  V +  +F V +                   +P M      +  ILP         N +   GYS  G   N  D H    + +  APH  +   F  G          F    KLEAVNP N   +  AT++ S++G RL+W+ L+  E  +PD +VD + S +IFPVGWCE   YP+  P                    L P P+        L P   D              +F++  C+ GP+L++   +E LP+ +GPG C+ VL+E+  L+   ++KP +++R LQ+  D E +  E +        K+++G +  R+  +V++      ++ FCRQ    L  CP+ ++   +   C   C      R       +RR
Sbjct:   45 WGDYLEETGTRAVPHVSFRHVEISI----RSNFQPG---MKLEVANKNNPDTYWVATIITTC--GQLLLLRYCGYGEDRRADFWCDVIIA--DLHPVGWCTQNNKVLRPPDAIKDKYSDWTDFLIRELTGSRTAPANL-LEGPLRGKGPIDLITVDSLIELQDSQNPFQYWIVSVTENVGGRLRLRYVGLE-----HTESYDRWLFYLDYRLRPIGWCQENKYRMDPPSDLYYLKLPFEWKCALEKALVLAAESPLPMEVFKDHADLQSHFFTVGMRLETLHISDPFHIYPASVTKVFNSKFFQVAID-----------DLRPEADKPTMLCHADSLG-ILPVQWCLKNGVNLAPPKGYS--GQDFNWVDYHKQRQAEE--APHFCFKNAFSRG----------FSKNMKLEAVNPVNPGEVCVATVV-SVKG-RLLWLHLEGLETPMPDIIVD-MDSMDIFPVGWCEANSYPLTTPYKASSKSKRKTVHFKMEKQLLSPVPIEKIPHELCLLPPQMDSPVGAINAKYCCPQLFVNHRCFSGPFLNKGRISE-LPQSVGPGMCVLVLKEILTLITNAAYKPGRVLRELQLVEDPEWNSQEEIL-------KAKYGGKTYRA--VVKIVRTADQVMNFCRQVCAKLECCPNLLSPVLISETCPENCSVHTKTRYTYYYGKRRR 670          
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Match: A0A481NUZ9 (SCM-like with MBT domains protein OS=Dugesia japonica OX=6161 GN=scm PE=2 SV=1)

HSP 1 Score: 1222.61 bits (3162), Expect = 0.000e+0
Identity = 640/886 (72.23%), Postives = 730/886 (82.39%), Query Frame = 1
Query:  157 MSSIWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGK-PNT-NNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAPVL--APFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWG--------------NRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRVCNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAAX---------XXXXXXXXXXXDREDQNNNNNAVESRMCTRGMRLXXXXXXX------------XXXXXXXXXFFKPPKGEVVKMEEEEQLMGTDGIRREG-RGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFADMQELLLPDDI 2694
            MSSIWYEYLEETGGE+IP  +FKHVS+S TK N NE   N    +   ++NYES+FWWP+ +I+KLSEGWIK+E+YGV  E  NC+LW+D+K+  + +QSIKWC+DN+K F SP  C + DI +I+EKNK + D KLEF+  KTESYRLIKVGAYLECWLENSVGFVWPVKVLSN GGRLKLIWFGCDST K PN  NN  FY+FYLDY LHSLGWAK NGWKYSPPLNIGINISISNVDTFVRGSPSAFPME+SC REIKEHFFEEGWQIEAVNPIDPSKICPA IRYVLDK+YFLVEL R     +  +  G + D + VMFAGFGGMAE+LPANTS+VSGYS+VGL+NNSW+ HL +++PQ+YAPHLGYFQNGGGID  Q++VFLPGCKLEAVNPWNKQ+IHAATLIRSMEGSRLVWIRLDSEPD+PDFL+DP+TSTEIFPVGWCEMV + +VLPS+YL+    L  +PFD D+ITI+LHPACYLGPYLSR+AA ELLP+FIGPGHCLPV RELFHLLLKVSHKPYKLMRLLQ+D  +DRHE MATI VPSPKSEWG              N   RS+WLVEVA+RKRAI GFCRQTALSLGSCP F+TTS +R C+L C+AR+AA+AGEKMSHQRRKRLFSRPLM+LGISYRELKSRV GA +         NSS++    SSDREDQNNN     SRMCTRGMRLVVSDS                 ++++VKF K PK E++K E+ E+      IRREG RGRD++ QSVI++KD+VIDPTFLAGDIERVTLSSNPL W+VEQL +YLS TDCRQLTTWLANEKVDGRAFLLLTLPVLSTLCGLQLEVAIRLCRHVVSLKRVFVE++AD+QELL  +D+
Sbjct:    1 MSSIWYEYLEETGGEIIPAFFFKHVSKSFTKSNGNENQFNISPGDHRFAFNYESNFWWPISIIEKLSEGWIKIEYYGVNIEDKNCNLWFDLKNKNEKIQSIKWCLDNKKEFKSPNICNKVDIDLILEKNK-SEDSKLEFLEMKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNIGGRLKLIWFGCDSTTKQPNQINNNVFYMFYLDYHLHSLGWAKLNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMEMSCSREIKEHFFEEGWQIEAVNPIDPSKICPAIIRYVLDKTYFLVELCR-FESKELQIQNGISNDNDRVMFAGFGGMAELLPANTSRVSGYSVVGLKNNSWETHLSTNNPQRYAPHLGYFQNGGGIDFHQDTVFLPGCKLEAVNPWNKQTIHAATLIRSMEGSRLVWIRLDSEPDVPDFLIDPVTSTEIFPVGWCEMVGHHLVLPSSYLLSCLPLSPSPFDSDEITIYLHPACYLGPYLSRSAATELLPQFIGPGHCLPVFRELFHLLLKVSHKPYKLMRLLQLDRPDDRHESMATIVVPSPKSEWGNHNNNNNNNNYYYYNSKHRSNWLVEVAVRKRAIPGFCRQTALSLGSCPYFLTTSPIRSCSLSCDARLAAKAGEKMSHQRRKRLFSRPLMSLGISYRELKSRVAGAVANSNNNNNNNNSSNSEMDYSSDREDQNNNGEQ-SSRMCTRGMRLVVSDSVARRPTKRRTVHHLHLHQQQTVKFLKSPKSELIKTEKIEEGEIDGSIRREGRRGRDVIAQSVIDMKDYVIDPTFLAGDIERVTLSSNPLNWSVEQLAEYLSGTDCRQLTTWLANEKVDGRAFLLLTLPVLSTLCGLQLEVAIRLCRHVVSLKRVFVEQYADLQELLPSEDV 883          
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Match: T1J4G1 (SAM domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 238.039 bits (606), Expect = 1.386e-62
Identity = 237/871 (27.21%), Postives = 373/871 (42.82%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEG-WIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPA---NCFESDIQMIIEKNKLTSDIKLEFI-TKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGIN-ISISNVDTFVRGSPSAFPMELSCD-----REIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSG----YSIVGLRNNS----WDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP-------SAYLMPAPVLAP---------FDPDDIT----IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-----RVCNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAAXXXXXXXXXXXXDREDQNNNNNAVESRMCTRGMRLXXXXXXXXXXXXXXXXFFKPPKGEVVKMEEEEQLMGTDGIRREGRGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVF 2646
            IW EYLEET     P   F HV +SL  C            ++ +    + D +W   V+  ++ G  ++L + G  +E  +   W D+ +++  V +I WC +N K  I P+   + F    Q +      +  I +  +    T    LI  G  +E   + +   VW   VL N GGRL L + G        T +  F+LFYL YRLH +GWA  N +KY PP  +    ++   VD   +    A    L  D       I+EH F+EG ++E VNP +  +ICPAT+  VL+  YF+V++                   +P + +       I P   +K +     +S  G  N+     WD +L     +     +           + +  F  G KLEAVNP+    I AAT+ + ++   L+WI+LDS        + P  S EIFPVGWCE   YP+  P          +M  P+             +PD       I+ +  C+ GPYLS T  A+ LPR +GPG  + VL+E+   L+ V++K  K+++ L+   + +       +     K+++  +  R   +VE+      +  FCR   L L  CP       V       C+L  +AR A+R     ++ RRKR   RP MA     +  K    G              D E+    NN  E    +    +++ D+  ++ + ++     PP       +            +E    + V  +   +  F I P+ L        L++NPL W+VE +  ++ +TDC QL   L ++ +DG+A LLLTLP +     LQL  A++LC  V  +K  F
Sbjct:   34 IWDEYLEETDSVAAPPTSFIHVEKSLQSCFSEGM-------KLEVRNKEQDDAYWVASVV--MTCGPLLRLRYEGY-SEDRSSDFWCDIATNE--VHAIGWCSENGKELIPPSAIKHKFSDWSQFLNTALAGSITIPIHLLEANGTNPIDLITQGMKIEVQEKLNPLNVWIATVLENVGGRLLLRYDGA-------TASEDFWLFYLSYRLHPVGWASINKFKYKPPEALASRRLTDEWVDILQQALEEAKQSPLLQDIFRLQDCIREHNFKEGMKLEMVNPTNLIQICPATVTKVLNSEYFIVQIDDNSLSDK-----------QPQVMSCHADSCLIFPKGWAKSNDLAVMHSKAGWMNSKHEFEWDEYLAFCKAEVVPDQVFNL-------LTVDHGFEKGMKLEAVNPFQPHQICAATVTKVVK--HLLWIQLDSIDTFHPNHIVPYNSHEIFPVGWCESNHYPLKPPLHIQRGNGRVVMKVPIFIQEKPKKEKKRVNPDAKAWCPKIYFNHRCFTGPYLSNTRLAQ-LPRHVGPGPVVLVLKEVLSKLINVAYKSSKVLQELEFKGKHNPDMQQCVL-----KAKYKGKCHRK--IVEILSNSEHVKEFCRDICLKLDCCPYLFGPKHVGDDCPHNCSLLTKARYASR-----TYSRRKRRLGRPPMAKKDENQPAKRGRKGK-----------LLDNEETEKTNNKSEEDADSNETEILMEDAEIKNGQNKANTASNPPSSPNTNSD----------ASKEASLSEEVESTKTPIMKF-ISPSIL-------RLTTNPLHWSVEDVMQFMRDTDCAQLVRLLKDQDIDGQALLLLTLPTVQEHLELQLGPAMKLCHQVERVKLAF 823          
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Match: A0A0L8GMH4 (SLED domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22031075mg PE=4 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 1.361e-54
Identity = 181/641 (28.24%), Postives = 293/641 (45.71%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEG-WIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFES-----DIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVR-----GSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWD-----AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP--SAYLMPAPVLAPFDPDDITIFLHPA---------------------------CYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV 1950
            +W EYL+ETG   +P   FKHV  SL    ++ F+      ++ ++     D +W   VI  ++ G  ++L + G  ++  +   W+D+ +S+  + SI WC  N K+ + P           D          T+ + L   T  T     IK G  LE     +   VW VKVL N GGRL L   G       N +   F+LFYL++ LH + WAK N ++YSPP       +    D   +           P+++  D+ EI+ H F+ GW++EAVNP+  ++ICPAT+  V+D  YF+VE+       + +           + F        I PA   +  G  +   +   WD     A  LS+   K AP   +      +   Q   F  G KLEAVNP N   I AAT+ + ++  RL+WI LD+   +    ++ + S  +FPVGWCE   Y +  P  + +  P   +A   P+ +TI  H +                           C+ GPYL+++  AE LP+ IGPG    V+ E+  +L+ V++K  +++R LQ+D E++ +     +     K+++  ++ R+   VE+    + +  FCRQ  + L  CP+ I+   +
Sbjct:  272 VWEEYLQETGALEVPPTAFKHVECSL----QSGFVKG---MKLEVAVKSTPDTYWVASVI--MTCGPLLRLRYDGYGDD-GSADFWHDLTASE--IHSIGWCAQNNKTLMPPDELKNKIGNWRDFLTTSLVGAATAPLYLLDKTTGTTPVDQIKQGMRLELQDHINPNHVWIVKVLENVGGRLYLRQEGL------NHSETDFWLFYLNHLLHPIDWAKQNNYEYSPPKEYEDQYTKEEWDEIFQEALKEAEAMPLPVDIFKDQIEIRRHNFKAGWKLEAVNPVTKNEICPATVIDVIDDKYFIVEIDDVRPLNERSY----------IRFGCHIDSPGIFPAMWCRRKGIHL--KKPAGWDGEFDWAEYLSNIDCKAAPRNCFGSVCMDVPYHQ---FQRGLKLEAVNPDNSNQICAATITKIVD--RLMWIHLDNSSKMKASFIEDIDSHNLFPVGWCESNGYQLNPPRRTGFRRPHKQVAVVQPEPVTIESHLSATDTYNKIKNVNIEEDTWCPKIYYNHRCFSGPYLAKSRIAE-LPKSIGPGPIKLVMTEVLTMLINVAYKSSRVLRELQVDGEDNPNMHQQVL-----KAKYKGKSYRA--AVELCRNVKQLDEFCRQICIKLECCPNLISPHCI 869          
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Match: K1Q738 (Scm-like with four MBT domains protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10006381 PE=4 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 2.259e-53
Identity = 184/628 (29.30%), Postives = 293/628 (46.66%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISP---ANCFESDIQMIIEKNKLTSDIKLEFITKK---TESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINIS-----ISNVDTFVRGSPS-AFPMELSCDRE-IKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAPVLAPFDPDDIT--------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFIT 1938
            +W EYLE+TG   +P   FKHV  SL    E+ F+      E+    N  +  +W   VI       ++L F G + E  +   W D+ SS+  +  I WC  N +    P    + FE D +  + K+   +     F+  K   T     +K G  LE     +   VW VKV+ N GGRL L   G +S       +  F+LFYL++R+H +GWAK+NG+KYSPP  + +        +  ++T +R S     P+ +  D+E I  H F++GW++EA+NP+  ++ICPAT+  VLD  YF+VE+               T DP P+ F+       I P+   K +   +    G R N +D    L+      AP     Q+        E++F  G KLEAVNP N   I AAT+ R      L+WI LD++       ++ + S ++FPVGWC   +YP+  P         +   D   +                     I+ +  C+ GPYLS+   A  LP+ +GPG    V++E+   L+ V++K +++++ LQ++ + +      TI     K+++  ++ R+  +VE+      +  FCR     L  CP+ I+
Sbjct:  350 VWEEYLEDTGSVAVPNEAFKHVEYSL----ESGFV-KGMKLEVPNKCNIGT--YWVTSVIMTCGP-LLRLRFDGYE-EDSSADFWCDLISSE--IHPIGWCAQNNQVLQPPEAIKDKFE-DWREFLVKSLTGARTAPSFLLDKSTGTTPVDQLKRGMRLELQHAINPVDVWLVKVIENVGGRLYLRLEGAES------GSHDFWLFYLNHRIHPIGWAKANGYKYSPPPELIMQFQEEVDWMKVLETALRESEKMVLPLAIFKDQEEIHVHRFKKGWKLEALNPLTTNQICPATVIRVLDCRYFVVEID------------SLTEDPYPIRFSCHSRSKFIFPSGWCKKNDIDLTPPKGWRKNDFDWQEYLTFCNATAAPEFVVPQS--------ENLFEVGMKLEAVNPENPNQICAATVTRV--ACPLLWIHLDNKRKSASSHIEHMHSHKLFPVGWCASNNYPLQPPKKAHKAVKTVNTTDRKQVNLTDEAYSQSQQNEENCWCPKIYYNHKCFSGPYLSKGRIAS-LPKCVGPGPVGLVMKEVLTNLINVAYKSFRVLKELQLEGKPNPKMQQQTI-----KAKYKGKSYRA--VVEICRDINGLENFCRHICKKLECCPNLIS 929          
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Match: A0A210Q4B2 (Scm-like with four MBT domains protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11224 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 3.146e-51
Identity = 179/644 (27.80%), Postives = 303/644 (47.05%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISP---ANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLI---KVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINIS----ISNVDTFVRGSPSA-FPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLR-----NNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPA------PVLAPFDPDDIT--------------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV 1950
            +W EYL+ETG   +P   FKHV  SL    E+ F+      ++ +     +D +W   VI       ++L + G + E  +   W D+ +S+  +  I WC  N +    P    + FE D +  + K+   +     ++  K      I   K G  LE     +   +W VK++ N GGRL L + G D+          F+LFYL++RLH +GWAKSN ++Y+PP  +    S    +  ++  ++ S +   P+ +  D+ EI  H F++GW++EA+NPI  ++ICPAT+  +LDK YFLVEL    +                + F+ +     I PAN     G  +   +     + +W+ +L  +   K AP   +      +D   +  F  G KLEAVN  N   I AAT+ + +E   LVWI LD+   +    ++ + S  +FPVGWCE   Y +  P    +         V+ P  PD++T                          I+ +  C+ GPYLS+   A LLP+ +GPG    V++E+  +L+ V++K  +++R LQ++ + + + +  ++     K+++  ++ R+  +VE+      +  FCR   + L  CP+ I+ + V
Sbjct:  351 VWEEYLQETGASAVPPTAFKHVECSL----ESGFVKG---MKLEVPNKCHTDTYWVASVIMTCGP-LLRLRYDGYE-EDTSADFWCDLMTSE--IHPIGWCAQNNQILQPPEAIKDKFE-DWREFLVKSLTGARTAPSYLLDKMTGITPIDQLKQGMRLELQHPINPMEIWLVKIIENVGGRLYLRFEGADTAAN------DFWLFYLNHRLHPIGWAKSNAYRYNPPKELFSEHSEQEWMQILEKALQESENMILPLAIFKDQVEIVHHTFQKGWKLEALNPITRNQICPATVVDILDKKYFLVELDDLQSVDPHFR----------IRFSCYSDSKCIFPANWCHYKGLKLTPPKGWPKMDFNWNEYLEYNR-AKAAPESCF-----NLD-KPDHQFERGMKLEAVNSENPNQICAATITKIVE--PLVWIHLDNSARVVASHIEHVDSHNLFPVGWCESNGYQLKPPRKTGLKGRPQKRVAVVPPGLPDNLTDEAYTQLKNGDSAVGGLLTGNAWCPKIYYNHQCFSGPYLSKGRIA-LLPKCVGPGPISLVMKEVLSMLINVAYKSCRVLRELQVEGKINPNMMQQSL-----KAKYKGKSYRA--MVEICRTTDQLDEFCRSVCIKLECCPNLISPNFV 949          
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:NCBI gene;Acc:103036664])

HSP 1 Score: 165.622 bits (418), Expect = 1.117e-41
Identity = 161/627 (25.68%), Postives = 267/627 (42.58%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEK----NKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNI----------GINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAP---VLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            W +YLEETG   +P + FKH+ + L        L      E+ +    +  +W  V  I       + L + G +++      W D+ ++   +  I W     +    P    E   D + ++EK    ++  S        +      L+  G  +E          W   +  N GGRL+L + G  + G P+  +   ++FYL+  LH  GWAK +G  + PP  +          G+  +IS      +   S+   E   DR  I  H F EG ++EA +P  P  I PAT+  V    +FLV++                       F        I P   S  +G  +    G +   +D A  L     + AP   +      +  S  + F     LEAVNP   ++IH AT+ + ++G   +WIRL+  +  +P+ +V  + S +IFPV WCE   YP+  P    +       +A        I+ +  C+ GPYL++   AEL P+ +GPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V   C+  C
Sbjct:   17 WDDYLEETGALSVPHHAFKHMDQGL-----QTGLAPGMKLEVLVRSEGDEAYW--VSTIITTCGQLLLLRYEGYQDD-RRADFWCDITTA--DLHPIGWSKQQGRPMKPPEGVREKHQDWEALLEKALSLSESCSAPASLLEGRGCNPVDLLSTGLSVELVDNQDAAAAWCAVIEDNVGGRLRLRYSG--TEGLPDAQSIT-WVFYLNPLLHLPGWAKEHGLTFRPPSALLPLHTEEEWEGVRQTIS-----TQSQDSSISEEFYKDRPAITTHCFTEGMKLEAADPAAPFTISPATVAKVFGDQWFLVQMDDLREEEKREGR---------RAFLCHKDSPGIFPTQWSLKNGVKLSPPPGYQGQDFDWADYLKQCEAEAAPQHCF--PPVSVISSLHTCFKESMMLEAVNPLCPENIHVATVTK-VKGQH-IWIRLEGVKQPVPEIIVH-MDSMDIFPVSWCETNGYPLQYPCKPKVEKQKKIAVANGKYCCPKIYFNHRCFSGPYLNKGRIAEL-PQCVGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQEGRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADRVAEFCRKTCIKLECCPNLFGPRMVLERCSENC 603          

HSP 2 Score: 51.9878 bits (123), Expect = 3.157e-6
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L S+PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  754 QKLCLDSSPLEWSVTDVVRFIRTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 834          
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:NCBI gene;Acc:103036664])

HSP 1 Score: 165.236 bits (417), Expect = 1.819e-41
Identity = 169/659 (25.64%), Postives = 273/659 (41.43%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDI------KLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNI----------GINISISNVDTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS----------AYLMPAPVLA---PFDPDDI--------------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            W +YLEETG   +P + FKH+ + L        L      E+ +    +  +W  V  I       + L + G +++      W D+ ++   +  I W     +    P    E   D + ++EK    S+        LE   +      L+  G  +E          W   +  N GGRL+L + G  + G P+  +   ++FYL+  LH  GWAK +G  + PP  +          G+  +IS      +   S+   E   DR  I  H F EG ++EA +P  P  I PAT+  V    +FLV++                       F        I P   S  +G  +    G +   +D A  L     + AP    F       C +ES+      LEAVNP   ++IH AT+ + ++G   +WIRL+  +  +P+ +V  + S +IFPV WCE   YP+  P           A + P    A      PD +                     I+ +  C+ GPYL++   AE LP+ +GPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V   C+  C
Sbjct:   21 WDDYLEETGALSVPHHAFKHMDQGL-----QTGLAPGMKLEVLVRSEGDEAYW--VSTIITTCGQLLLLRYEGYQDD-RRADFWCDITTA--DLHPIGWSKQQGRPMKPPEGVREKHQDWEALLEKALSLSESCSAPASLLEGAQRGCNPVDLLSTGLSVELVDNQDAAAAWCAVIEDNVGGRLRLRYSG--TEGLPDAQSIT-WVFYLNPLLHLPGWAKEHGLTFRPPSALLPLHTEEEWEGVRQTIS-----TQSQDSSISEEFYKDRPAITTHCFTEGMKLEAADPAAPFTISPATVAKVFGDQWFLVQMDDLREEEKREGR---------RAFLCHKDSPGIFPTQWSLKNGVKLSPPPGYQGQDFDWADYLKQCEAEAAPQ-HCFPPDPSDQCFKESMM-----LEAVNPLCPENIHVATVTK-VKGQH-IWIRLEGVKQPVPEIIVH-MDSMDIFPVSWCETNGYPLQYPCKPKVEKQKKIAVVQPERHRALSKDSSPDALKQPLGSQTEMSQANGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQCVGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQEGRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADRVAEFCRKTCIKLECCPNLFGPRMVLERCSENC 635          

HSP 2 Score: 51.9878 bits (123), Expect = 3.419e-6
Identity = 29/81 (35.80%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L S+PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  786 QKLCLDSSPLEWSVTDVVRFIRTTDCAPLARIFMDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 866          
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Match: ENSAMXT00000006035.2 (pep primary_assembly:Astyanax_mexicanus-2.0:7:13923359:13977084:-1 gene:ENSAMXG00000005894.2 transcript:ENSAMXT00000006035.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 163.31 bits (412), Expect = 5.828e-41
Identity = 172/662 (25.98%), Postives = 277/662 (41.84%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIK----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNI-GINISISNVDTFVRGSPSA----FPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPE--PVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLD--SEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAP-----------VLAPFDPDDIT--IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRVCNLGCEARMAARAGEKMS-HQRRKRLFSRPLMA 2052
            W EYLEE G    P   FKHV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    +      W D+ +++  +  + WC  N K    P    E  SD    + K    S       LE   +   +  LI  G  LE    +     W  +VL N GGRL L + G D            ++FYLD RL  LGW K N     PP  +  +  ++   +   + +  A     P+E+  D  ++ +H F  G ++E V P +P  ICP ++    ++ +F V +                  PE  P           ILP      +G  +    G ++  +D A  L  S  + AP    F N      S    F     LEAVNP N   +  A  I  ++G RL+W+RL+  S+P L + +VD + S +IFPVGWCE   YP+      +  +            ++A  +       IF++  C+ GPYL++   AE LP+ +GPG C  VL+E+  +L+  ++KP +++R LQ+      + L  T+     K+++  ++ R+   V +      +  FCR   + L  CP+    + +   +  C    +     K + H  ++R   RP + 
Sbjct:    7 WDEYLEELGATAAPHTSFKHVEISL----QSSFQPG---MKLEVANKSCPDTYWVATIITTC--GQLLLLRYCGYGDDRKADFWCDVMAAE--LHPVGWCTQNNKRLQPPEAIKEKHSDWTEFLIKELTGSRTAPANLLEGPLRGKNTVDLIVSGCVLEIRDASEPCVYWAARVLRNVGGRLCLSYVGLDDPAH------CIWIFYLDTRLRPLGWTKENQLSVEPPKELRDLRSAVEWSEALEKATSEAMKNPLPLEVFKDHADLHKHSFTTGMKLEMVTPGEPFHICPVSVTKAYNEYFFQVTVD--------------DLTPEATPCSVVCHADSPGILPVQWCLKNGVGLEKPRGCQSGDFDWADYLKYSGTEAAPE-ACFPNA-----SVSRGFCKDTWLEAVNPLNPAELCVAR-ITQVKG-RLLWLRLEGLSKP-LSECIVD-VESMDIFPVGWCEANGYPLTAIKKTICQSQKKIAVCVCLLCLIASVNGKYCCSHIFVNHRCFSGPYLNKGRIAE-LPQTVGPGKCTLVLKEVLTMLINSAYKPGRVLRELQMVENPKWNCLEETL-----KAKYKGKSYRAS--VRIVRLAEQVSEFCRSVCVRLQCCPNLFGPTLI---SDHCPENCSTHTKTKYTYHYGKRRRVGRPSLG 616          

HSP 2 Score: 51.6026 bits (122), Expect = 3.898e-6
Identity = 30/81 (37.04%), Postives = 48/81 (59.26%), Query Frame = 1
Query: 2422 RVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFAD 2664
            R+ L  NPL W+V  + D++++TDC  L      + +DG+A LLLTLP +     L+L  AI+LC  +  +K  F  ++A+
Sbjct:  749 RLVLERNPLEWSVSDVVDFITSTDCASLAKIFQEQDIDGQALLLLTLPTVQECMDLKLGPAIKLCHQIERVKVAFYSQYAN 829          
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Match: l3mbtl2 (lethal(3)malignant brain tumor-like protein 2 [Source:NCBI gene;Acc:103040308])

HSP 1 Score: 78.5666 bits (192), Expect = 2.234e-14
Identity = 109/470 (23.19%), Postives = 184/470 (39.15%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIF-LSYNYESDFWWPVHVIDKLS-EGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPA---NCFESDIQMIIEKNKLTSDIKLEFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIW--FGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREI--KEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQE--------SVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            W  YL++ G    P + F+HV      C + E +      E+  +     S  +W   +I     +  ++ E +G     D    W ++ S++  V  + WC  N K  + P    N   +    +++K      + ++F +K  ES +   + G  +E    + V       V +  GGRL+LI+   G  ++G+  ++   F+       LH + W+   G           ++ +S+  TF +G   + P +    R +     FFEEG ++EA++P++   IC A+IR VL   Y +V +     G  +              F        ILP    +          NN     L     Q       Y +  G I   +           F  G KLEAV+    + +  AT+ R +   RL+ +  D      D  VD   S +I+PVGWCE+  Y +  P
Sbjct:  263 WGGYLKKHGYLAAPVSCFRHVPL----CAQWEDIEVGLQVEVLNIHTTVMSKVYWIATIIRLAGYKALLRYEGFGDDASYD---FWCNLGSAE--VHPVGWCAVNSKLLVPPQALQNHVTNWKSYLMKKLVGACTLPVDFHSKLAESMKYPFRQGVRVEVVDRSLVSRTRRAVVDTVIGGRLRLIYEDAGLGASGEVLSD---FWCHMWSPLLHPINWSVRVGHDIK---RTDKSVDMSSHPTFRKGFSDSVPKQFKTLRTVYMDGGFFEEGMKLEAIDPLNLGNICVASIRKVLLDGYLMVGIDGVEIGDGSD------------WFCYHASSHAILPTEYCQ----------NNEIPLTLPPGHDQATFTWSKYLEESGSIAAPRRLFNTDPTGHGFTVGMKLEAVDLMEPRLVCVATVQRCV--GRLLLLHFDGWESEFDQWVD-CESPDIYPVGWCELTGYQLQPP 692          
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Match: l3mbtl2 (lethal(3)malignant brain tumor-like protein 2 [Source:NCBI gene;Acc:103040308])

HSP 1 Score: 77.7962 bits (190), Expect = 3.327e-14
Identity = 110/471 (23.35%), Postives = 187/471 (39.70%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIF-LSYNYESDFWWPVHVIDKLS--EGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPA---NCFESDIQMIIEKNKLTSDIKLEFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIW--FGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREI--KEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQE--------SVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            W  YL++ G    P + F+HV      C + E +      E+  +     S  +W +  I +L+  +  ++ E +G     D    W ++ S++  V  + WC  N K  + P    N   +    +++K      + ++F +K  ES +   + G  +E    + V       V +  GGRL+LI+   G  ++G+  ++   F+       LH + W+   G           ++ +S+  TF +G   + P +    R +     FFEEG ++EA++P++   IC A+IR VL   Y +V +     G  +              F        ILP              +NN     L     Q       Y +  G I   +           F  G KLEAV+    + +  AT+ R +   RL+ +  D      D  VD   S +I+PVGWCE+  Y +  P
Sbjct:  263 WGGYLKKHGYLAAPVSCFRHVPL----CAQWEDIEVGLQVEVLNIHTTVMSKVYW-IATIIRLAGYKALLRYEGFGDDASYD---FWCNLGSAE--VHPVGWCAVNSKLLVPPQALQNHVTNWKSYLMKKLVGACTLPVDFHSKLAESMKYPFRQGVRVEVVDRSLVSRTRRAVVDTVIGGRLRLIYEDAGLGASGEVLSD---FWCHMWSPLLHPINWSVRVGHDIK---RTDKSVDMSSHPTFRKGFSDSVPKQFKTLRTVYMDGGFFEEGMKLEAIDPLNLGNICVASIRKVLLDGYLMVGIDGVEIGDGSD------------WFCYHASSHAILPTEY----------CQNNEIPLTLPPGHDQATFTWSKYLEESGSIAAPRRLFNTDPTGHGFTVGMKLEAVDLMEPRLVCVATVQRCV--GRLLLLHFDGWESEFDQWVD-CESPDIYPVGWCELTGYQLQPP 692          
BLAST of SCM-like with MBT domains protein vs. Ensembl Sea Lamprey
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:HGNC Symbol;Acc:HGNC:20255])

HSP 1 Score: 82.0333 bits (201), Expect = 2.321e-16
Identity = 88/298 (29.53%), Postives = 130/298 (43.62%), Query Frame = 1
Query:  925 EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS------------AYLMP-APVLAPF-------------DPDDI----------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLREL 1695
            E + H F +G ++EAV+P  P  I PAT+  VL + +F+VE+   G                P++ +  G  A  LPA  S  +G       G     +D A  L SS  + AP   +  +        +  F+ G +LE VNP     +  AT+        L+W+RL+  +   PD +VD + S +IFPVGW E   YP+  P             A + P   V  PF              P D            IF++  C+ GP+L++   AE LP+ +GPG C+ VLRE+
Sbjct:  261 ESRSHRFSQGMKLEAVHPTLPFSIAPATVTKVLSEWFFVVEMDTAGGEVAPLA---------PLVCSLDGPTA--LPAQWSLKNGVPCTPPPGYEGQDFDWAEYLKSSGAEAAPGSCFPMD------EPQHGFIQGMRLEVVNPLLPSELCVATVTHLRH--HLMWLRLEGLQQPQPDCIVD-VRSMDIFPVGWSESNGYPLRAPRRSPPVGGARRKIAVVQPKQQVPVPFAAGETRARRELSLQPSDTGPGSGKYCCPKIFINHRCFSGPFLNKGRIAE-LPQSVGPGSCVLVLREV 537          
BLAST of SCM-like with MBT domains protein vs. Ensembl Sea Lamprey
Match: mbtd1 (mbt domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-060810-138])

HSP 1 Score: 78.9518 bits (193), Expect = 2.149e-15
Identity = 96/374 (25.67%), Postives = 150/374 (40.11%), Query Frame = 1
Query:  448 VQSIKWCIDNEKSFISPANCFE--SDIQMIIEKNKLTSDIKL--EFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPE--PVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAP 1548
            V  I WC    K  + P       S+ +  + K KLT    L  +F  K  ES     K G  LE   +  +       V S  GGRL+L +   D  G  +     F+       +H +GW+++ G ++  P     +   S+  +++       P +  C        F EG ++EA++P++ S IC AT+R VL   + ++ +               +  P   PV F     +    P   +K        LR  S  A  +S    K  P+ G               F  G KLEAV+    + I  AT++R +  +RL+ I  D   D  D  VD   S ++FPVGWCE+  Y +  P + +  +P
Sbjct:  233 VHPIGWCATIGKPLVPPQTIMHRCSNWKAFLVK-KLTGSKTLPPDFQAKVQESLSFPFKRGMRLEVVDKAQISRTRVALVDSVIGGRLRLAYR--DGAGTEDD----FWCHMRSPLIHPIGWSRAVGHQHKSPEGAKKHDGSSDAGSYLFPIVKEMPQKQEC--------FREGMKLEAIDPLNLSSICVATVRKVLGDGFLMIGIDGSEAADGTDWFCYHSMSPSIFPVGFCEINQIELASPRGYNKTPFNWFEYLRETSSPAAPVSLF-NKEIPNHG---------------FRVGMKLEAVDLMEPRLICVATVVRIV--NRLLRIHFDGWEDEYDQWVD-CQSPDLFPVGWCELTGYQLQPPLSSVPASP 572          
BLAST of SCM-like with MBT domains protein vs. Ensembl Nematostella
Match: EDO34899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN41])

HSP 1 Score: 144.05 bits (362), Expect = 4.437e-36
Identity = 157/593 (26.48%), Postives = 246/593 (41.48%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDI---QMIIE--KNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISN-------VDTFVRGSPSAFPMELSCDREIKE---HFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEP--VMFAGFGGMAEILP---ANTSKVSGYSIVGLRNN--SWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSA-----YLM------PAPVLAPFDPDD--------------ITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITV 1800
            IW +YL++   + +P + FKHVS + T            D      Y   S  +W V  I  +S   + L F G  N+      W D  +S   VQ I WC       I P    + +    Q +++  K+ + +   L F  ++      + +G  LE    +     W   V+  FG RLKL + G +S           +++YL   +H LGW K  G     P       S++N       +D   R S ++     S  +  +    H F+ G ++EAVNP DPS IC AT+  V+++ YF+V +                  PE   + F        I P      +KVS     G +     WDA+L+SS   +  P L    +           F  G KLEAVN   +  I AAT+ + M   R +WI+LD+   D+ + + D + S ++FPVGWC M  +P++ P A     Y M         +L  F P +              I +++   C  GPYL +   A+ LP  IGP      LR+L   ++  SH   K++++L  + E+     +  ++V
Sbjct:    2 IWEDYLKKCRAKSVPKSAFKHVSVNPTSGFRRGMKVEAKD------YKSNSGTYW-VATIIMVSGPLLLLRFDGYGNDRSE-DFWCD--ASTPDVQPIGWCAKTNTILIPPQALRQQNTNWAQFLMDNLKDAVAAPESL-FKQQEAGESSGVPIGTMLELQDYDDPLCYWVASVVERFGLRLKLRYAGAES------EEHDVWVYYLSDNVHKLGWGKRYGLTLQAPKGTSTLESLTNRVDMSAIIDDLNRLSTTSNNGSTSLKKNDQLPPIHGFKSGMKLEAVNPTDPSSICVATVSRVVNEHYFVVTID-------------DFVVPEARKISFWCHAKSRNIFPCRWCEKNKVSVVPPAGYQTKPFHWDAYLISS---RQEPALASLFD----QTVPNHGFEAGYKLEAVNQIERDVISAATVKQIM--GRTMWIQLDAYTSDVVEHIYD-VESCDLFPVGWCGMQGHPLLTPQAKSKTFYFMINWKPKKIIILYGFSPGNKKFNGLNYYLLLGKICLYVKSTCSCGPYLDKKKLAK-LPPVIGPESANLALRKLVEHIVVSSHSSKKVLKMLAAEKEKKTFASILKVSV 553          
BLAST of SCM-like with MBT domains protein vs. Ensembl Nematostella
Match: EDO39310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAH4])

HSP 1 Score: 54.6842 bits (130), Expect = 9.566e-8
Identity = 81/346 (23.41%), Postives = 136/346 (39.31%), Query Frame = 1
Query:  496 PANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTF---VRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP 1524
            P + F+  +       +   D+KLE +  K  SY  +                     ++   G RL+L + G   +    TN  + +++        +GW + NG   SPP   G + S  N +T+   ++  P+  P  L       +H F+ G ++EA++  +P  IC AT+  V+    FLV         D            PV +    G  ++ P N  +V  +         W+ +L  ++     P L   +   G        F PG +LEAV+  N   I AAT+++ +E    V++  D   D          STE+ PV +CE   +P+  P
Sbjct:   24 PVSVFQQLLMFPKPCTEFKKDMKLEAVDPKHPSYICV-------------------CTIVRVKGARLRLHFDGWSESYDFWTNADSPFIY-------PVGWCEKNGQIISPPR--GFSKSDFNWETYLTKMKALPA--PSHLFKPVSPTKHGFKTGMKLEAIDRKNPDLICVATVTNVIGNR-FLVHFDEWDDTYDYWCEEDCPYI-HPVGWCAANG-GKLNPPNDDEVDTF--------QWEEYLKKTNSLAAPPELFKKRFTPG--------FKPGHRLEAVDKRNPSLIRAATVVKVVE--YRVFVHFDGW-DDIYDDWYDADSTEVHPVSYCEKTGHPLEAP 317          
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:NCBI gene;Acc:101169849])

HSP 1 Score: 187.193 bits (474), Expect = 1.270e-48
Identity = 179/654 (27.37%), Postives = 285/654 (43.58%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFES--DIQMIIEKNKLTSDIK-----LEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPP---LNIGINISISNVDTFVRGSPS--AFPMELSCDREI-KEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIV---GLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP----------SAYLMPAPVLAP---FDPDDI--------------------TIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV-RVCNLGC 1971
            IW +YLEETG   +P + FKHV + L        L      E+ +    +S +W  V  I       + L + G +++  +   W D+ ++   +  + W   + K+  +P    E   D + ++EK  L          LE   +  +   L+  G Y+E       G  W  +V  N GGRLKL   G  + G P+T  A  +LFYL  RLH  GWA+ +G+   PP   L +  +     V   +   P   A   ELS ++ I   H F+EG ++EAV+P  P  I PAT+  V +  YFLV +       ++  ++ +        F        I P   S  +G  +    G +   +D A  L     +  P   +           E  F    KLEAVN  + ++IH AT+ R     + +W+ L+  +  +P+ +V  + S +IFPV WCE   YP+V P           A + P     P     PD +                     I+ +  C+ GPYL++   AE LP+FIGPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V   C+  C
Sbjct:   20 IWDDYLEETGSVSVPHHAFKHVDQGL-----QTGLTPGMKLEVCVRSEVDSPYW--VATIITTCGQLLLLRYEGCQDDRRS-DFWCDIMTA--DLHPLGWSRHHGKTMRAPEGVREKNEDWEALLEK-ALAEGCSAPASLLELPQRGRDPVELLCAGCYVELQDNVDPGLAWAAEVEENVGGRLKLRLVG--TEGLPDTP-ATLWLFYLHPRLHPPGWAQEHGYTLKPPSDLLALRTDEEWEEVRQRICDLPQDEALVAELSKEQPIIAAHCFKEGMKLEAVDPTAPISIRPATVTKVYNDKYFLVTMDDLCGIEESEGSSRS--------FLCHRDSPGIFPTQWSLKNGLPLSPPPGYQGPDFDWADYLKQCEAEAVPQHCFPTE------QSEHSFKEAMKLEAVNLLSPENIHVATVTRVK--GQYIWLSLEGLKQPMPELIVH-VDSLDIFPVSWCETNGYPLVYPIKPSVEKERKVAVVQPEKHRTPPKSSSPDAVKQQMANQSETGQGNGKYCCPKIYFNHRCFSGPYLNKGRIAE-LPQFIGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQESRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADRVADFCRKTCIKLECCPNLFGPRMVLEHCSENC 634          

HSP 2 Score: 50.8322 bits (120), Expect = 6.827e-6
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L ++PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  785 QKLCLDTSPLEWSVADVVRFIRTTDCAPLAKIFLDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 865          
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Match: sfmbt2 (Scm like with four mbt domains 2 [Source:NCBI gene;Acc:101167414])

HSP 1 Score: 176.022 bits (445), Expect = 5.771e-45
Identity = 171/641 (26.68%), Postives = 275/641 (42.90%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISP-------ANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNV--------DTFVRGSPSAFPMELSCDR-EIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPE--PVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPD-LPDFLVDPLTSTEIFPVGWCEMVDYPIVLP----------SAYLMPAPVLAPFDPDDIT------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV 1950
            W EYLEETG E  P   F+HV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+ +++  +  + WC  N K+ + P       ++  E  IQ +       +++ LE   +   +  LI+ G+ LE    +     WPV+V+ N GGRL+L + G       +  +  F+LFYLD RL  L WA  N  K   P  I    S+ N         +  + G  +  P+E+  D  ++ +H F  G ++E V+  +  +ICP ++  + D  YF V L     G +          P   PV +    G+A        K  GY     ++  W A  L  S  + AP   +       D      F     LEAVNP     +  A +I+     RL+W+RL+  P  L + +VD + S +IFPVGWCE   YP+  P           A + P     P  P+ +                   IF++  C+ GPYL++   AE LP+ +GPG C  VL+E+  +L+  ++KP ++++ LQ   ++       T+     K+++  +  RS   +        I  FC++  L L  CP+  + + V
Sbjct:   41 WEEYLEETGAEAAPHTTFRHVEISL----QSSFQPG---MKLEVANKGSPDTYWVASIITTC--GQLLLLRYSGYGEDRKADFWCDVMTAE--LHPVGWCAQNNKTLMPPQAIKDKFSDWTEFLIQDLTGSQTAPANL-LEGPLRGKNTVDLIQEGSVLELQDLSDPFLYWPVRVVQNVGGRLRLRYAGL------SEEDRDFWLFYLDVRLRPLSWALENHLKLETPAEIR---SMRNAAEWQQVLEEVQLDGQKNPLPLEVFKDHVDLPKHSFRTGMKLEIVSRWEQLQICPVSVTKIYDDVYFQVTLDDLSEGAERRSVVCHASLPGILPVQWCLKNGVA------LEKPRGYEG---QDFDW-ADYLKQSGTEAAPESCF------PDTWHNRGFAKDMWLEAVNPQRPAEVCVAQIIQVR--GRLLWLRLEGVPKPLSECIVD-VDSMDIFPVGWCEANSYPLTSPLKPVCRKQKQVAVVQPEKHFVP--PETLVSALLGVSGSANGRYCCSKIFVNHRCFSGPYLNKGRIAE-LPQAVGPGKCTLVLKEMLSMLVNSAYKPGRVLKELQELEDQSWDCQEETL-----KAKYKGKTYRS--TIRTVRLAEQIPDFCQKVCLKLQCCPNLFSPALV 631          
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:NCBI gene;Acc:101169849])

HSP 1 Score: 173.711 bits (439), Expect = 2.524e-44
Identity = 167/621 (26.89%), Postives = 271/621 (43.64%), Query Frame = 1
Query:  166 IWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFES--DIQMIIEKN--KLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPP----LNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTR--QXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDS-EPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP---------------SAYLMPAPVLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV 1950
            IW +YLEETG   +P + FKHV + L        L      E+ +    +S +W  V  I       + L + G +++  +   W D+ ++   +  + W   + K+  +P    E   D + ++EK   +  S        +  +   L+  G Y+E       G  W  +V  N GGRLKL   G  + G P+T  A  +LFYL  RLH  GWA+ +G+   PP     ++  + ++    + VR  PS   M L        H      ++EAV+P  P  I PAT+  V +  YFLV +         + +  +       P +F     +   LP   S   GY         W  +L     +    H    Q+        E  F    KLEAVN  + ++IH AT+ R     + +W+ L+  +  +P+ +V  + S +IFPV WCE   YP+V P               +++        P       I+ +  C+ GPYL++   AE LP+FIGPG+C+ VL+E+  LL+  ++KP +++R LQ+D E        T+     K+++  ++ R+   VE+      +  FCR+T + L  CP+      V
Sbjct:   44 IWDDYLEETGSVSVPHHAFKHVDQGL-----QTGLTPGMKLEVCVRSEVDSPYW--VATIITTCGQLLLLRYEGCQDDRRS-DFWCDIMTA--DLHPLGWSRHHGKTMRAPEGVREKNEDWEALLEKALAEGCSAPASLLELRGRDPVELLCAGCYVELQDNVDPGLAWAAEVEENVGGRLKLRLVG--TEGLPDTP-ATLWLFYLHPRLHPPGWAQEHGYTLKPPSGQICDLPQDEALVAELSKVRLQPSDL-MAL--------HVGFRWMKLEAVDPTAPISIRPATVTKVYNDKYFLVTMDDLCGIEESEGSSRSFLCHRDSPGIFPTQWSLKNGLP--LSPPPGYQGPDF---DWADYLKQCEAEAVPQHCFPTQS--------EHSFKEAMKLEAVNLLSPENIHVATVTRVK--GQYIWLSLEGLKQPMPELIVH-VDSLDIFPVSWCETNGYPLVYPIKPSGKRLQCMRRNSNSWQGNGKYCCP------KIYFNHRCFSGPYLNKGRIAE-LPQFIGPGNCVLVLKEVLTLLINSAYKPSRVLRELQLDQESRWQGHGETL-----KAKYKGKSYRA--TVEIVRTADRVADFCRKTCIKLECCPNLFGPRMV 612          

HSP 2 Score: 50.8322 bits (120), Expect = 6.571e-6
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 1
Query: 2419 ERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFA 2661
            +++ L ++PL W+V  +  ++  TDC  L     ++++DG+A LLL LP +     L+L  AI+LC H+  +K  F ++FA
Sbjct:  773 QKLCLDTSPLEWSVADVVRFIRTTDCAPLAKIFLDQEIDGQALLLLNLPTVQECMDLKLGPAIKLCHHIERVKLAFYQQFA 853          
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Match: sfmbt2 (Scm like with four mbt domains 2 [Source:NCBI gene;Acc:101167414])

HSP 1 Score: 164.466 bits (415), Expect = 2.721e-41
Identity = 166/637 (26.06%), Postives = 270/637 (42.39%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISP-------ANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKY-SPPLNIGINISISNVDTFVRGSPS-----AFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSI---VGLRNNSWD-AHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLP--------SAYLMPAPVLAPFDPDDIT------------------IFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAV 1950
            W EYLEETG E  P   F+HV  SL    ++ F P     ++ ++     D +W   +I     G + L  Y    E      W D+ +++  +  + WC  N K+ + P       ++  E  IQ +       +++ LE   +   +  LI+ G+ LE    +     WPV+V+ N GGRL+L + G       +  +  F+LFYLD RL  L WA  N  K  +P L   + +       F++G         FP +   D  + +H F  G ++E V+  +  +ICP ++  V   +  L +L+                    V  A   G   ILP      +G ++    G     +D A  L  S  + AP   +       D      F     LEAVNP     +  A +I+     RL+W+RL+    L + +VD + S +IFPVGWCE   YP+  P         A + P     P  P+ +                   IF++  C+ GPYL++   AE LP+ +GPG C  VL+E+  +L+  ++KP ++++ LQ   ++       T+     K+++  +  RS   +        I  FC++  L L  CP+  + + V
Sbjct:   13 WEEYLEETGAEAAPHTTFRHVEISL----QSSFQPG---MKLEVANKGSPDTYWVASIITTC--GQLLLLRYSGYGEDRKADFWCDVMTAE--LHPVGWCAQNNKTLMPPQAIKDKFSDWTEFLIQDLTGSQTAPANL-LEGPLRGKNTVDLIQEGSVLELQDLSDPFLYWPVRVVQNVGGRLRLRYAGL------SEEDRDFWLFYLDVRLRPLSWALENHLKLETPSLMTCMEL------FFIKGGAGWSKLVVFPRQDHVD--LPKHSFRTGMKLEIVSRWEQLQICPVSVTKVTQVT--LDDLSEGAERRSV------------VCHASLPG---ILPVQWCLKNGVALEKPRGYEGQDFDWADYLKQSGTEAAPESCF------PDTWHNRGFAKDMWLEAVNPQRPAEVCVAQIIQVR--GRLLWLRLEGTDPLSECIVD-VDSMDIFPVGWCEANSYPLTSPLKPVCQKQVAVVQPEKHFVP--PETLVSALLGVSGSANGRYCCSKIFVNHRCFSGPYLNKGRIAE-LPQAVGPGKCTLVLKEMLSMLVNSAYKPGRVLKELQELEDQSWDCQEETL-----KAKYKGKTYRS--TIRTVRLAEQIPDFCQKVCLKLQCCPNLFSPALV 587          
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Match: ENSORLT00000045352.1 (MBT domain-containing protein 1 [Source:NCBI gene;Acc:101165206])

HSP 1 Score: 81.2629 bits (199), Expect = 2.255e-15
Identity = 108/466 (23.18%), Postives = 182/466 (39.06%), Query Frame = 1
Query:  169 WYEYLEETGGEVIPTNYFKHVSRSLTKCNEN-----EFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANC---FESDIQMIIEKNKLTSDIKLEFITKKTESYRL-IKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEH--FFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPE--PVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPS 1527
            W  YL +      P + FKHV   + KC  N          N DS + +        +W   ++ KL+     L + G  ++      W ++      +  + WC    K  + P      F +    +I++   +  + L+F +K   S R   K    +E   +  +       V    GGRL+L++  CD      T++  F+       +HS+GW++S          IG     S+V     G   A        +E+ +   +F++G ++EA++P++ S IC AT+R VL   Y ++ +        +      +  P   PV F     + ++ P        +S       S  A    S   K  P  G               F PG KLEAV+    + +  AT+ R +   RL+ I  D   D  D  VD   S +++PVGWC++  Y +  P+
Sbjct:  166 WGRYLGDGDATGAPVSCFKHVM--MGKCWSNISEGVRVEVPNTDSSLPMK------VYWIAGIV-KLAGFKALLRYEGFDSDSTR-DFWLNL--CVPDIHPVGWCAAGGKPLVPPQTILHRFSNWKSFLIKRLTGSKTLPLDFSSKVQRSMRYPFKKQMRVEVVDKTHLCRTRVALVEQVIGGRLRLVYEECDD----GTDD--FWCHMYSPLIHSIGWSRS----------IGHRFKRSDVSKVWNGQVDAPGQLFVKVKEVDQSGSWFQDGMKLEAIDPLNLSTICVATVRKVLADGYLMIGIDGSEAADGSDWFCYHSTSPSIFPVGFCEINNI-QLTPPRGHTAQPFSWFQYLKQSGSAAAPVSLFSKDVPDHG---------------FCPGMKLEAVDLMEPRLVCVATVTRIVH--RLLRIHFDGWEDEYDQWVD-CESPDLYPVGWCQLTGYQLQPPA 584          
BLAST of SCM-like with MBT domains protein vs. Planmine SMEST
Match: SMESG000060677.1 (SMESG000060677.1)

HSP 1 Score: 1621.29 bits (4197), Expect = 0.000e+0
Identity = 846/846 (100.00%), Postives = 846/846 (100.00%), Query Frame = 1
Query:  157 MSSIWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQXXXXXXXXXXXXXXXPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAPVLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRVCNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAAXXXXXXXXXXXXDREDQNNNNNAVESRMCTRGMRLXXXXXXXXXXXXXXXXFFKPPKGEVVKMEEEEQLMGTDGIRREGRGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFXXXXXXXXXXXXXXQLEVAIRLCRHVVSLKRVFVEKFADMQELLLPDDI 2694
            MSSIWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQGTGGDAAVTTGATGDPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAPVLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRVCNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAASNSSSNSEIESSDREDQNNNNNAVESRMCTRGMRLVVSDSRTRSTKRRSVKFFKPPKGEVVKMEEEEQLMGTDGIRREGRGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFLLLTLPVLSTLCGLQLEVAIRLCRHVVSLKRVFVEKFADMQELLLPDDI
Sbjct:    1 MSSIWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSYNYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQSIKWCIDNEKSFISPANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLIKVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAFYLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPMELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTRQGTGGDAAVTTGATGDPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNNSWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQSIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVDYPIVLPSAYLMPAPVLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRFIGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPSPKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRVCNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAASNSSSNSEIESSDREDQNNNNNAVESRMCTRGMRLVVSDSRTRSTKRRSVKFFKPPKGEVVKMEEEEQLMGTDGIRREGRGRDMVPQSVINVKDFVIDPTFLAGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFLLLTLPVLSTLCGLQLEVAIRLCRHVVSLKRVFVEKFADMQELLLPDDI 846          
The following BLAST results are available for this feature:
BLAST of SCM-like with MBT domains protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFMBT14.203e-4726.65Scm like with four mbt domains 1 [Source:HGNC Symb... [more]
SFMBT26.315e-4726.55Scm like with four mbt domains 2 [Source:HGNC Symb... [more]
SFMBT26.639e-4726.55Scm like with four mbt domains 2 [Source:HGNC Symb... [more]
SFMBT26.639e-4726.55Scm like with four mbt domains 2 [Source:HGNC Symb... [more]
L3MBTL25.411e-1324.21L3MBTL histone methyl-lysine binding protein 2 [So... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sfmbt2.905e-1221.65gene:FBgn0032475 transcript:FBtr0080491[more]
Sfmbt8.268e-1221.65gene:FBgn0032475 transcript:FBtr0080492[more]
Sfmbt8.268e-1221.65gene:FBgn0032475 transcript:FBtr0333236[more]
Sfmbt9.366e-1221.65gene:FBgn0032475 transcript:FBtr0289981[more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sfmbt11.772e-4326.61Scm like with four mbt domains 1 [Source:ZFIN;Acc:... [more]
SFMBT12.089e-4326.56Scm like with four mbt domains 1 [Source:NCBI gene... [more]
sfmbt26.527e-4326.51Scm like with four mbt domains 2 [Source:ZFIN;Acc:... [more]
sfmbt25.215e-4126.25Scm like with four mbt domains 2 [Source:ZFIN;Acc:... [more]
l3mbtl25.952e-1724.15L3MBTL histone methyl-lysine binding protein 2 [So... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kif5b2.745e-4026.01kinesin family member 5B [Source:Xenbase;Acc:XB-GE... [more]
kif5b4.221e-3925.84kinesin family member 5B [Source:Xenbase;Acc:XB-GE... [more]
kif5b6.146e-3825.52kinesin family member 5B [Source:Xenbase;Acc:XB-GE... [more]
ankrd13b9.294e-3824.33ankyrin repeat domain 13B [Source:Xenbase;Acc:XB-G... [more]
kif5b5.549e-3324.96kinesin family member 5B [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sfmbt17.771e-5027.38Scm-like with four mbt domains 1 [Source:MGI Symbo... [more]
Sfmbt19.819e-5027.38Scm-like with four mbt domains 1 [Source:MGI Symbo... [more]
Sfmbt19.819e-5027.38Scm-like with four mbt domains 1 [Source:MGI Symbo... [more]
Sfmbt19.819e-5027.38Scm-like with four mbt domains 1 [Source:MGI Symbo... [more]
Sfmbt11.431e-4927.93Scm-like with four mbt domains 1 [Source:MGI Symbo... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9JMD2|SMBT1_RAT2.567e-4927.93Scm-like with four MBT domains protein 1 OS=Rattus... [more]
sp|Q9JMD1|SMBT1_MOUSE6.868e-4927.38Scm-like with four MBT domains protein 1 OS=Mus mu... [more]
sp|Q9UHJ3|SMBT1_HUMAN2.018e-4626.65Scm-like with four MBT domains protein 1 OS=Homo s... [more]
sp|Q5VUG0|SMBT2_HUMAN3.748e-4626.55Scm-like with four MBT domains protein 2 OS=Homo s... [more]
sp|Q5DTW2|SMBT2_MOUSE8.084e-4626.25Scm-like with four MBT domains protein 2 OS=Mus mu... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481NUZ90.000e+072.23SCM-like with MBT domains protein OS=Dugesia japon... [more]
T1J4G11.386e-6227.21SAM domain-containing protein OS=Strigamia maritim... [more]
A0A0L8GMH41.361e-5428.24SLED domain-containing protein (Fragment) OS=Octop... [more]
K1Q7382.259e-5329.30Scm-like with four MBT domains protein 1 OS=Crasso... [more]
A0A210Q4B23.146e-5127.80Scm-like with four MBT domains protein 1 OS=Mizuho... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFMBT11.117e-4125.68Scm like with four mbt domains 1 [Source:NCBI gene... [more]
SFMBT11.819e-4125.64Scm like with four mbt domains 1 [Source:NCBI gene... [more]
ENSAMXT00000006035.25.828e-4125.98pep primary_assembly:Astyanax_mexicanus-2.0:7:1392... [more]
l3mbtl22.234e-1423.19lethal(3)malignant brain tumor-like protein 2 [Sou... [more]
l3mbtl23.327e-1423.35lethal(3)malignant brain tumor-like protein 2 [Sou... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SFMBT12.321e-1629.53Scm like with four mbt domains 1 [Source:HGNC Symb... [more]
mbtd12.149e-1525.67mbt domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO348994.437e-3626.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393109.566e-823.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SFMBT11.270e-4827.37Scm like with four mbt domains 1 [Source:NCBI gene... [more]
sfmbt25.771e-4526.68Scm like with four mbt domains 2 [Source:NCBI gene... [more]
SFMBT12.524e-4426.89Scm like with four mbt domains 1 [Source:NCBI gene... [more]
sfmbt22.721e-4126.06Scm like with four mbt domains 2 [Source:NCBI gene... [more]
ENSORLT00000045352.12.255e-1523.18MBT domain-containing protein 1 [Source:NCBI gene;... [more]
back to top
BLAST of SCM-like with MBT domains protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000060677.10.000e+0100.00SMESG000060677.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033271 ID=SMED30033271|Name=SCM-like with MBT domains protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2754bp
TATTTAATATCTAGAACAGTTGTTTTTAAATAAAATTATATTTCAACATA
AAATAATAACTTTTAATAAATTCTATTTTCTAAAATCGGATTGAGTTTTA
ATTGAATTTAGTTATAATTGAATAATTTGTTAATTGATTTTAGACGGCTT
AATTGTATGAGTTCAATATGGTATGAATATTTAGAAGAAACTGGTGGTGA
AGTTATCCCAACAAATTATTTCAAACACGTGTCAAGAAGTTTAACAAAAT
GCAATGAAAATGAATTTTTGCCTAACAATTTTGACAGCGAAATATTTCTA
TCATATAATTATGAATCAGACTTCTGGTGGCCTGTTCATGTGATAGATAA
GTTAAGTGAAGGCTGGATCAAATTAGAATTTTATGGCGTGAAAAATGAAA
TCGATAACTGCAGTTTGTGGTATGATATGAAAAGCTCCAAACAATCTGTT
CAGTCAATTAAATGGTGCATTGACAATGAGAAAAGTTTTATCTCTCCAGC
TAATTGTTTTGAAAGTGATATTCAAATGATTATTGAGAAAAATAAATTAA
CAAGTGACATAAAATTGGAATTTATTACCAAAAAAACCGAATCCTATCGT
TTGATAAAAGTTGGAGCTTATCTGGAGTGTTGGTTGGAAAATAGCGTCGG
ATTCGTTTGGCCGGTGAAAGTGCTGTCAAATTTCGGTGGCCGATTGAAAT
TGATCTGGTTCGGTTGCGATTCCACTGGGAAACCAAATACCAACAACGCA
GCATTTTATTTGTTCTATTTAGATTATCGGTTACACAGTTTGGGATGGGC
GAAATCGAACGGCTGGAAATACTCGCCGCCATTGAATATTGGTATCAATA
TTTCCATTTCCAATGTCGATACGTTCGTTCGAGGCAGTCCAAGTGCATTT
CCAATGGAATTGAGTTGTGATAGAGAAATCAAGGAGCATTTTTTTGAGGA
AGGCTGGCAAATCGAAGCCGTCAATCCGATTGATCCGAGCAAGATTTGCC
CTGCAACGATACGTTATGTGCTGGACAAATCGTATTTTCTCGTGGAATTG
ACTCGACAAGGAACAGGAGGAGACGCGGCAGTCACGACTGGGGCGACTGG
AGATCCCGAGCCGGTAATGTTTGCTGGGTTCGGAGGAATGGCAGAAATAT
TGCCCGCCAACACATCAAAGGTAAGCGGATACTCAATAGTCGGGCTGAGA
AACAATTCTTGGGACGCTCATTTGCTGTCGAGCAGTCCTCAGAAATACGC
GCCGCATTTAGGTTACTTCCAGAACGGAGGCGGAATCGATTGCAGCCAGG
AGAGCGTGTTTCTTCCGGGCTGCAAACTCGAGGCGGTAAACCCCTGGAAC
AAGCAGTCGATTCACGCGGCAACTCTGATCCGATCAATGGAAGGCAGCCG
GTTGGTCTGGATCAGGCTTGACAGTGAACCAGATCTGCCGGATTTCCTTG
TTGATCCGCTTACGAGTACTGAGATTTTCCCAGTCGGCTGGTGTGAAATG
GTCGATTATCCGATCGTTTTACCTTCGGCTTATCTCATGCCGGCTCCTGT
TCTCGCCCCTTTCGACCCCGATGACATTACAATCTTTTTGCATCCTGCTT
GCTACCTTGGTCCATATCTGAGTCGAACGGCTGCGGCCGAATTGTTGCCT
AGATTTATTGGACCAGGGCACTGTCTGCCAGTACTGAGAGAATTGTTCCA
TCTCCTACTGAAGGTGTCACACAAACCATATAAATTAATGCGCCTCCTTC
AAATCGATAACGAAGAAGATCGGCACGAATTAATGGCGACAATTACAGTG
CCGAGCCCGAAAAGTGAATGGGGAAACCGAAACAAGCGATCTGATTGGTT
GGTGGAAGTGGCAATTCGTAAGCGAGCTATTTTGGGATTTTGTCGACAAA
CTGCTCTTTCGCTCGGTTCTTGTCCATCGTTCATAACAACATCTGCTGTT
AGAGTCTGTAATTTGGGTTGTGAGGCGCGAATGGCAGCGAGAGCCGGCGA
GAAAATGAGCCACCAGAGACGGAAACGATTATTTTCTCGACCATTAATGG
CATTGGGAATATCGTATCGGGAATTGAAATCAAGAGTCGTTGGAGCGGCT
AGTAACAGCAGTAGCAATTCAGAAATCGAATCCAGTGACCGAGAAGATCA
AAACAATAACAATAATGCTGTCGAATCAAGAATGTGCACAAGGGGAATGC
GATTGGTCGTTTCGGATTCCAGGACTCGGTCGACCAAGCGTAGAAGCGTT
AAATTTTTCAAACCTCCCAAAGGGGAGGTTGTGAAAATGGAGGAAGAGGA
GCAATTGATGGGAACAGATGGAATTCGTCGTGAAGGACGCGGACGAGACA
TGGTGCCACAATCAGTGATCAATGTCAAGGATTTTGTCATTGATCCGACA
TTTCTCGCCGGCGATATTGAACGTGTTACTCTTTCTTCGAATCCTTTGCT
GTGGACTGTGGAACAGCTTACTGATTATCTCTCGAATACCGATTGCCGAC
AATTGACAACTTGGTTGGCCAATGAAAAAGTCGACGGACGAGCATTTTTA
CTATTGACTTTGCCTGTGTTGAGCACATTGTGTGGCCTCCAATTGGAAGT
TGCCATTCGACTCTGTCGACACGTTGTGTCTTTGAAACGCGTATTCGTGG
AGAAATTTGCTGATATGCAAGAACTTTTGTTACCCGATGATATTTGAAGA
AAAATTTATCACTTTATTATCCTTTTTGCATTTGTTTTAATTTTATTACC
TTAT
back to top

protein sequence of SMED30033271-orf-1

>SMED30033271-orf-1 ID=SMED30033271-orf-1|Name=SMED30033271-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=847bp
MSSIWYEYLEETGGEVIPTNYFKHVSRSLTKCNENEFLPNNFDSEIFLSY
NYESDFWWPVHVIDKLSEGWIKLEFYGVKNEIDNCSLWYDMKSSKQSVQS
IKWCIDNEKSFISPANCFESDIQMIIEKNKLTSDIKLEFITKKTESYRLI
KVGAYLECWLENSVGFVWPVKVLSNFGGRLKLIWFGCDSTGKPNTNNAAF
YLFYLDYRLHSLGWAKSNGWKYSPPLNIGINISISNVDTFVRGSPSAFPM
ELSCDREIKEHFFEEGWQIEAVNPIDPSKICPATIRYVLDKSYFLVELTR
QGTGGDAAVTTGATGDPEPVMFAGFGGMAEILPANTSKVSGYSIVGLRNN
SWDAHLLSSSPQKYAPHLGYFQNGGGIDCSQESVFLPGCKLEAVNPWNKQ
SIHAATLIRSMEGSRLVWIRLDSEPDLPDFLVDPLTSTEIFPVGWCEMVD
YPIVLPSAYLMPAPVLAPFDPDDITIFLHPACYLGPYLSRTAAAELLPRF
IGPGHCLPVLRELFHLLLKVSHKPYKLMRLLQIDNEEDRHELMATITVPS
PKSEWGNRNKRSDWLVEVAIRKRAILGFCRQTALSLGSCPSFITTSAVRV
CNLGCEARMAARAGEKMSHQRRKRLFSRPLMALGISYRELKSRVVGAASN
SSSNSEIESSDREDQNNNNNAVESRMCTRGMRLVVSDSRTRSTKRRSVKF
FKPPKGEVVKMEEEEQLMGTDGIRREGRGRDMVPQSVINVKDFVIDPTFL
AGDIERVTLSSNPLLWTVEQLTDYLSNTDCRQLTTWLANEKVDGRAFLLL
TLPVLSTLCGLQLEVAIRLCRHVVSLKRVFVEKFADMQELLLPDDI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038348SLED_sf
IPR004092Mbt
IPR013761SAM/pointed_sf
IPR021987SLED
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004092Mbt repeatSMARTSM00561l3mbt_4coord: 350..456
e-value: 7.9E-8
score: 42.0
IPR004092Mbt repeatPFAMPF02820MBTcoord: 165..227
e-value: 7.8E-6
score: 26.2
coord: 390..459
e-value: 9.1E-12
score: 45.2
coord: 269..343
e-value: 1.8E-4
score: 21.8
IPR004092Mbt repeatPROSITEPS51079MBTcoord: 234..333
score: 7.192
IPR004092Mbt repeatPROSITEPS51079MBTcoord: 120..225
score: 11.353
IPR004092Mbt repeatPROSITEPS51079MBTcoord: 3..114
score: 11.704
IPR004092Mbt repeatPROSITEPS51079MBTcoord: 350..456
score: 17.504
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 383..459
e-value: 2.8E-14
score: 54.9
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 140..254
e-value: 7.3E-12
score: 47.5
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 255..363
e-value: 6.0E-9
score: 37.9
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 1..138
e-value: 4.5E-8
score: 35.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 648..673
NoneNo IPR availablePANTHERPTHR12247LETHAL 3 MALIGNANT BRAIN TUMOR-RELATEDcoord: 755..835
NoneNo IPR availablePANTHERPTHR12247LETHAL 3 MALIGNANT BRAIN TUMOR-RELATEDcoord: 476..625
coord: 4..457
NoneNo IPR availablePANTHERPTHR12247:SF77SCM-LIKE WITH FOUR MBT DOMAINS PROTEIN 1coord: 476..625
coord: 4..457
NoneNo IPR availablePANTHERPTHR12247:SF77SCM-LIKE WITH FOUR MBT DOMAINS PROTEIN 1coord: 755..835
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 385..461
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 145..228
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 249..298
IPR013761Sterile alpha motif/pointed domain superfamilyGENE3DG3DSA:1.10.150.50coord: 759..829
e-value: 1.3E-11
score: 46.0
IPR013761Sterile alpha motif/pointed domain superfamilySUPERFAMILYSSF47769SAM/Pointed domaincoord: 759..830
IPR021987SLED domainPFAMPF12140SLEDcoord: 474..595
e-value: 2.1E-12
score: 47.5
IPR038348SLED domain superfamilyGENE3DG3DSA:1.20.1380.20coord: 471..599
e-value: 2.3E-10
score: 42.7