Actin-binding LIM protein

Overview
NameActin-binding LIM protein
Smed IDSMED30033251
Length (bp)1949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-binding LIM protein (SMED30033251) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-binding LIM protein (SMED30033251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-binding LIM protein (SMED30033251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-binding LIM protein (SMED30033251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30033251SMESG000019042.1 dd_Smed_v4_8089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033251SMESG000019042.1 dd_Smed_v4_8089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033251SMESG000019042.1 dd_Smed_v4_8089_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.398 bits (298), Expect = 2.570e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 78.1814 bits (191), Expect = 2.758e-14
Identity = 43/123 (34.96%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD + YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  166 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 286          

HSP 3 Score: 61.6178 bits (148), Expect = 3.825e-9
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F+++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  686 FPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 748          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.398 bits (298), Expect = 2.581e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 77.7962 bits (190), Expect = 2.925e-14
Identity = 43/123 (34.96%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD + YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  166 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 286          

HSP 3 Score: 61.6178 bits (148), Expect = 3.820e-9
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F+++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  684 FPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 746          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.013 bits (297), Expect = 2.786e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   37 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 150          

HSP 2 Score: 77.7962 bits (190), Expect = 3.294e-14
Identity = 43/123 (34.96%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD + YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  166 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 286          

HSP 3 Score: 61.6178 bits (148), Expect = 3.440e-9
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F+++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  656 FPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 718          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM2 (actin binding LIM protein family member 2 [Source:HGNC Symbol;Acc:HGNC:19195])

HSP 1 Score: 118.627 bits (296), Expect = 2.825e-27
Identity = 52/114 (45.61%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V +KYFH +CF CK C   L + GFF +   + C  DY++     CFSC + I GEVV+AL  T+H DCF C+VC+  F PGDRV+      +C  CS
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCS 135          

HSP 2 Score: 62.3882 bits (150), Expect = 1.820e-9
Identity = 38/128 (29.69%), Postives = 57/128 (44.53%), Query Frame = 1
Query:   16 KLSMTF*ISLRNNFFMGKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL 396
            K S+   +    +   G  +C  C  + K G  L   +K++H  CF CK C K L+   + SKD   YC  DY       C SC + I G V+ A    +H  C  C  C + F  G+ + ++ S+  
Sbjct:  133 KCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLN-AEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIW 259          

HSP 3 Score: 58.5362 bits (140), Expect = 2.693e-8
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++NR   +  K +DR RLE +L  +EFQ++F ++ + F +L  WKRNDLKK+  LF
Sbjct:  550 PYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 611          
BLAST of Actin-binding LIM protein vs. Ensembl Human
Match: ABLIM1 (actin binding LIM protein 1 [Source:HGNC Symbol;Acc:HGNC:78])

HSP 1 Score: 119.398 bits (298), Expect = 2.988e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 78.1814 bits (191), Expect = 2.602e-14
Identity = 46/140 (32.86%), Postives = 72/140 (51.43%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKP 489
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD + YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+  ++++   + N N  P
Sbjct:  226 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL--RLLSPPCLVNFNKNP 361          

HSP 3 Score: 61.6178 bits (148), Expect = 3.619e-9
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F+++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  772 FPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 834          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: unc-115 (pep chromosome:WBcel235:X:10147492:10153085:1 gene:WBGene00006839.1 transcript:F09B9.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-115)

HSP 1 Score: 77.411 bits (189), Expect = 1.261e-14
Identity = 80/324 (24.69%), Postives = 144/324 (44.44%), Query Frame = 1
Query:  907 KLSSYPSGHVEE-NQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETD------IPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNST---------SRS-----------FTSDSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            +L+ YP+ HV + +  P+IER D+P+P     Y  E ++R+    +VE           +      S   + +E   R  +  + K +    SS  H+ R N+E++       +  DP +ASR+PS    P +  RYD+ +  SPSR+ +  +      G   D  N+T         SR+           F  + ++     ++ + Y E   + +G   GP   +   G + R++ P  +         P+++ D           L+ +N    + +DR  LE +L   +F+++F ++   FY+LPEWKR +LK++  LF
Sbjct:  350 ELAHYPAAHVPDPDTLPAIEREDFPAPQFP--YAVEELKRRLSTSSVE----------NEISDDEYSESDKVDEDKLRKTVETLEKYND---SSIAHVIRQNIEDSHKKQRLPLHWDPRNASRTPSGKKMPHLKFRYDVPINASPSRHLNRPRPWVVWQGGERDQGNNTLPCFHIPEDSRANTLRAATLPTEFGQNLSLENLDTTISSHYSEHSTTESGTAGGP---RSAGGAVLRSSLPDMSK--------PAKQYDLLF--------LQTTNSDLPEDVDRQHLERHLPRDQFEEIFKMSLIEFYKLPEWKRINLKRKHKLF 639          

HSP 2 Score: 70.4774 bits (171), Expect = 2.066e-12
Identity = 43/152 (28.29%), Postives = 63/152 (41.45%), Query Frame = 1
Query:   49 NNFFMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFY-CPEDYKKYCAAV----------------------------------------------------CFSCHEKI-IGEVVTALNHTFHKDCFKCSVC 342
            N+  +GK  C  C +KC GDVLK  +KYFH  CF CK C + L +TGF++  E+ Y CP+D++     +                                                    C +C + +  G+V+ AL  ++H  CFKCS C
Sbjct:   11 NHLILGK-KCDVCRKKCSGDVLKANDKYFHINCFQCKKCGRNLGETGFYTTPENAYLCPDDFRAVSKEITVKTTTQQAHASSSSAATPKSPEKSNGTTDVSSSGAANATLQQISPLGSPTTCAACDQALHSGQVLLALGLSWHVYCFKCSEC 161          

HSP 3 Score: 55.0694 bits (131), Expect = 1.507e-7
Identity = 32/114 (28.07%), Postives = 45/114 (39.47%), Query Frame = 1
Query:   70 VTCFHCTRKC-KGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
             TC  C +    G VL      +H  CF C  C   L    + S      C  DY +     C+ C + I G+V+ A  + FH  C +CS C   F  G+ + M+        C
Sbjct:  129 TTCAACDQALHSGQVLLALGLSWHVYCFKCSECSAVLHGE-YMSHHGKPLCLRDYNEKFGVKCYECEKFIAGKVLQAGGYKFHPTCARCSRCGSHFGDGEEMYMQGDEIWHPSC 241          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: unc-115 (pep chromosome:WBcel235:X:10146889:10153142:1 gene:WBGene00006839.1 transcript:F09B9.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-115)

HSP 1 Score: 77.411 bits (189), Expect = 1.267e-14
Identity = 80/324 (24.69%), Postives = 144/324 (44.44%), Query Frame = 1
Query:  907 KLSSYPSGHVEE-NQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETD------IPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNST---------SRS-----------FTSDSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            +L+ YP+ HV + +  P+IER D+P+P     Y  E ++R+    +VE           +      S   + +E   R  +  + K +    SS  H+ R N+E++       +  DP +ASR+PS    P +  RYD+ +  SPSR+ +  +      G   D  N+T         SR+           F  + ++     ++ + Y E   + +G   GP   +   G + R++ P  +         P+++ D           L+ +N    + +DR  LE +L   +F+++F ++   FY+LPEWKR +LK++  LF
Sbjct:  336 ELAHYPAAHVPDPDTLPAIEREDFPAPQFP--YAVEELKRRLSTSSVE----------NEISDDEYSESDKVDEDKLRKTVETLEKYND---SSIAHVIRQNIEDSHKKQRLPLHWDPRNASRTPSGKKMPHLKFRYDVPINASPSRHLNRPRPWVVWQGGERDQGNNTLPCFHIPEDSRANTLRAATLPTEFGQNLSLENLDTTISSHYSEHSTTESGTAGGP---RSAGGAVLRSSLPDMSK--------PAKQYDLLF--------LQTTNSDLPEDVDRQHLERHLPRDQFEEIFKMSLIEFYKLPEWKRINLKRKHKLF 625          

HSP 2 Score: 68.5514 bits (166), Expect = 7.909e-12
Identity = 43/148 (29.05%), Postives = 61/148 (41.22%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFY-CPEDYKKYCAAV----------------------------------------------------CFSCHEKI-IGEVVTALNHTFHKDCFKCSVC 342
            MGK  C  C +KC GDVLK  +KYFH  CF CK C + L +TGF++  E+ Y CP+D++     +                                                    C +C + +  G+V+ AL  ++H  CFKCS C
Sbjct:    1 MGK-KCDVCRKKCSGDVLKANDKYFHINCFQCKKCGRNLGETGFYTTPENAYLCPDDFRAVSKEITVKTTTQQAHASSSSAATPKSPEKSNGTTDVSSSGAANATLQQISPLGSPTTCAACDQALHSGQVLLALGLSWHVYCFKCSEC 147          

HSP 3 Score: 54.6842 bits (130), Expect = 1.711e-7
Identity = 32/114 (28.07%), Postives = 45/114 (39.47%), Query Frame = 1
Query:   70 VTCFHCTRKC-KGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
             TC  C +    G VL      +H  CF C  C   L    + S      C  DY +     C+ C + I G+V+ A  + FH  C +CS C   F  G+ + M+        C
Sbjct:  115 TTCAACDQALHSGQVLLALGLSWHVYCFKCSECSAVLHGE-YMSHHGKPLCLRDYNEKFGVKCYECEKFIAGKVLQAGGYKFHPTCARCSRCGSHFGDGEEMYMQGDEIWHPSC 227          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 65.855 bits (159), Expect = 2.506e-11
Identity = 45/154 (29.22%), Postives = 72/154 (46.75%), Query Frame = 1
Query:   67 KVTCFHCTRKCKGD-VLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVT--ALNHTFHKDCFKCSVCQKKFIPGDRVSM--KNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKP--TLNGKS 507
            +  C  C +K +   V KV  + +H  C  C  C+ +L  T F  +D S YC   + K     C SC+E I+ + V   A NH +H +CF+C +C++    G+   +   ++  +C D      D E+   K  NE      N +P  T++ KS
Sbjct:   45 EAICSLCDKKIRDRFVSKVNGRCYHSSCLRCSTCKDELGATCFLRED-SMYCRAHFYKKFGTKCSSCNEGIVPDHVVRKASNHVYHVECFQCFICKRSLETGEEFYLIADDARLVCKD------DYEQARDKHCNELEGDGSNKRPRTTISAKS 191          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: lim-7 (CeLIM-7; LIM domain family [Source:UniProtKB/TrEMBL;Acc:G5EC36])

HSP 1 Score: 64.3142 bits (155), Expect = 1.252e-10
Identity = 35/121 (28.93%), Postives = 57/121 (47.11%), Query Frame = 1
Query:   97 CKGDVLKVGEKYF---------HKECFTCKICQKKLDDT-GFFSKDESFYCPEDYKKYCAAVCFSCH---EKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLC-GDCSGI 417
            C G  L++ ++YF         H +C  C  C + LD+    F K+   YC +DY++     C  CH   +K    +     + FH +CF C  C+K+   G+   +KN++  C  DC G+
Sbjct:   56 CAGCRLEISDRYFLRVNPNLEFHAQCLKCVQCSRPLDENQTAFVKNGQTYCRDDYRRLFTTRCSRCHGDFDKTDLVMRAGPQNVFHLNCFACVACEKRLQTGEEFQIKNNSLYCRSDCRGL 176          
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Match: pxl-1 (Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09476])

HSP 1 Score: 63.929 bits (154), Expect = 1.413e-10
Identity = 33/93 (35.48%), Postives = 42/93 (45.16%), Query Frame = 1
Query:   76 CFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKF 354
            C  C R      + V  K FH ECFTC  C +   + GF  K+   YC  D+ +  A  C  C + I    +TAL   +H DCF C  C   F
Sbjct:  235 CQGCHRAITDRCVSVMNKNFHIECFTCAECNQPFGEDGFHEKNGQTYCKRDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSF 327          

HSP 2 Score: 62.003 bits (149), Expect = 6.323e-10
Identity = 31/96 (32.29%), Postives = 45/96 (46.88%), Query Frame = 1
Query:   67 KVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKF 354
            K  C  C +   G V+    K +H E +TC  C  +L    FF ++   +C EDY    +  C  CH  I    V+ +N  FH +CF C+ C + F
Sbjct:  173 KGDCAACGKPIIGQVVIALGKMWHPEHYTCCECGAELGQRPFFERNGRAFCEEDYHNQFSPKCQGCHRAITDRCVSVMNKNFHIECFTCAECNQPF 268          

HSP 3 Score: 54.299 bits (129), Expect = 1.708e-7
Identity = 26/106 (24.53%), Postives = 46/106 (43.40%), Query Frame = 1
Query:   46 RNNFFMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPG 363
            R+ F +    C  C++    + +     ++H +CF C+ C    +   FF  + +  C   Y +   ++C  C   I G  V A+   FH + F+CS C  +   G
Sbjct:  284 RDFFRLFAPKCNGCSQPITSNFITALGTHWHPDCFVCQHCGVSFNGASFFEHNGAPLCERHYHESRGSICSQCRGAINGRCVAAMGRKFHPEHFRCSYCNHQLTKG 389          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115a (gene:FBgn0051352 transcript:FBtr0300565)

HSP 1 Score: 119.398 bits (298), Expect = 1.417e-27
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 1
Query:   28 TF*ISLRNNFFMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            T    LR      K+ C  CT+KC G+VL+V + +FHK CF C  C+K L   GFF+KD ++YC  DY++     C +C + + GEVV+ +  T+H+ CF CS C++ F  G +V+      LC  C
Sbjct:   25 TLGTELRTELGKQKIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQC 151          

HSP 2 Score: 86.2705 bits (212), Expect = 3.474e-17
Identity = 90/357 (25.21%), Postives = 149/357 (41.74%), Query Frame = 1
Query:  907 KLSSYPSGHVEE-NQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRM------------GIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIK--QSERHLGYSMDFVNSTSRSFT---SDSAMPKYR---------KSLRNSYVELRQSSNGNLNG-------------------PPLTKMDNGTLPRNNFPSNN-----------DKNLYYSAIPSRESDSFI---ASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            +LS YP+       ++P IER+D+P+PP      T+  RR+  + T + + A +  +     +   +G ++  E   R+            GI   + +   + + Y    + N+       DP +ASR+PSA  EPL   RY+  +  SPSRN D  K    +     S  +  S  +S     S +A+  YR         K+    Y+    SS+ +  G                     +T+ D   L   + P+++              L   ++P+      +   A   PY  L I+N R    +DR  LE +L D EF+ +    R  FY+LP+W+RN+LK++V LF
Sbjct:  494 ELSHYPAAKKPPPGEQPKIERDDFPAPPYP---YTDPERRRRYSDTYKGVPA-SDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNL-------DPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQKPFYEDEMFDRSTSYRGSLGKSLGNAPSYNAIHSYRSPPKPGYGFKTTTLPYIRNGFSSDFSYGGLGDKTHSTDLSCGKSEASVDSITEGDRRALMGGDLPASSTYSGALSYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLPSDVDRCNLERHLSDIEFEHILQCARSEFYRLPQWRRNELKRRVKLF 839          

HSP 3 Score: 60.4622 bits (145), Expect = 4.506e-9
Identity = 37/114 (32.46%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTAL-NHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL---CG 402
            C  C    K G  L   ++ +H  CF CK CQ  L+   +  KD   YC + Y+K     C  C   I G+V+ A  NH FH  C +C+ C   F  G+ + ++ S      CG
Sbjct:  206 CAGCGELLKEGQALVALDRQWHVSCFRCKACQAVLNGE-YMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCG 318          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082097)

HSP 1 Score: 119.013 bits (297), Expect = 1.442e-27
Identity = 50/127 (39.37%), Postives = 73/127 (57.48%), Query Frame = 1
Query:   28 TF*ISLRNNFFMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            T    LR      K+ C  CT+KC G+VL+V + +FHK CF C  C+K L   GFF+KD ++YC  DY++     C +C + + GEVV+ +  T+H+ CF CS C++ F  G +V+      LC  C
Sbjct:   25 TLGTELRTELGKQKIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQC 151          

HSP 2 Score: 60.077 bits (144), Expect = 5.595e-9
Identity = 37/114 (32.46%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTAL-NHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL---CG 402
            C  C    K G  L   ++ +H  CF CK CQ  L+   +  KD   YC + Y+K     C  C   I G+V+ A  NH FH  C +C+ C   F  G+ + ++ S      CG
Sbjct:  206 CAGCGELLKEGQALVALDRQWHVSCFRCKACQAVLNGE-YMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCG 318          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0082094)

HSP 1 Score: 116.701 bits (291), Expect = 8.756e-27
Identity = 47/114 (41.23%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   67 KVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            K+ C  CT+KC G+VL+V + +FHK CF C  C+K L   GFF+KD ++YC  DY++     C +C + + GEVV+ +  T+H+ CF CS C++ F  G +V+      LC  C
Sbjct:   43 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQC 156          

HSP 2 Score: 60.4622 bits (145), Expect = 4.127e-9
Identity = 37/114 (32.46%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTAL-NHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL---CG 402
            C  C    K G  L   ++ +H  CF CK CQ  L+   +  KD   YC + Y+K     C  C   I G+V+ A  NH FH  C +C+ C   F  G+ + ++ S      CG
Sbjct:  211 CAGCGELLKEGQALVALDRQWHVSCFRCKACQAVLNGE-YMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCG 323          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115b (gene:FBgn0260463 transcript:FBtr0346713)

HSP 1 Score: 116.701 bits (291), Expect = 9.006e-27
Identity = 47/114 (41.23%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   67 KVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            K+ C  CT+KC G+VL+V + +FHK CF C  C+K L   GFF+KD ++YC  DY++     C +C + + GEVV+ +  T+H+ CF CS C++ F  G +V+      LC  C
Sbjct:   27 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQC 140          

HSP 2 Score: 60.4622 bits (145), Expect = 4.240e-9
Identity = 37/114 (32.46%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTAL-NHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL---CG 402
            C  C    K G  L   ++ +H  CF CK CQ  L+   +  KD   YC + Y+K     C  C   I G+V+ A  NH FH  C +C+ C   F  G+ + ++ S      CG
Sbjct:  195 CAGCGELLKEGQALVALDRQWHVSCFRCKACQAVLNGE-YMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCG 307          
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Match: Unc-115a (gene:FBgn0051352 transcript:FBtr0346714)

HSP 1 Score: 116.701 bits (291), Expect = 9.761e-27
Identity = 47/114 (41.23%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   67 KVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            K+ C  CT+KC G+VL+V + +FHK CF C  C+K L   GFF+KD ++YC  DY++     C +C + + GEVV+ +  T+H+ CF CS C++ F  G +V+      LC  C
Sbjct:    5 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYGTKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLCEQC 118          

HSP 2 Score: 85.5001 bits (210), Expect = 5.862e-17
Identity = 88/365 (24.11%), Postives = 150/365 (41.10%), Query Frame = 1
Query:  907 KLSSYPSGHVEE-NQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRM------------GIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRN---------DDFIKQSERHLGYSMDFVNSTSRSFTSDSAM-----PKYRKSLRNSYVELRQSSNGNLNGPP---------------------------LTKMDNGTLPRNNFPSNN-----------DKNLYYSAIPSRESDSFI---ASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            +LS YP+       ++P IER+D+P+PP      T+  RR+  + T + + A +  +     +   +G ++  E   R+            GI   + +   + + Y    + N+       DP +ASR+PSA  EPL   RY+  +  SPSRN         D+   +S  + G S+      + S+   SA+     P Y  + R+       S+   ++G                             +T+ D   L   + P+++              L   ++P+      +   A   PY  L I+N R    +DR  LE +L D EF+ +    R  FY+LP+W+RN+LK++V LF
Sbjct:  461 ELSHYPAAKKPPPGEQPKIERDDFPAPPYP---YTDPERRRRYSDTYKGVPA-SDDEDENVENGKPNGKVKNGEEQQRLQREAEQLEKLNSGIGSAIAKDLKEHAKYRKWKQNNL-------DPRNASRTPSASKEPLYKLRYESPIGASPSRNLDHQKPFYEDEMFDRSTSYRG-SLGKSLGNAPSYNVVSALRHVPKPGYGLAPRSHTFSSTTSAAATMHGATDFSYGGLGDKTHSTDLSCGKSEASVDSITEGDRRALMGGDLPASSTYSGALSYHYPQAGLIRRSLPNMSHSMLVHEPAKIYPYHLLLITNYRLPSDVDRCNLERHLSDIEFEHILQCARSEFYRLPQWRRNELKRRVKLF 813          

HSP 3 Score: 60.4622 bits (145), Expect = 4.605e-9
Identity = 37/114 (32.46%), Postives = 52/114 (45.61%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTAL-NHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL---CG 402
            C  C    K G  L   ++ +H  CF CK CQ  L+   +  KD   YC + Y+K     C  C   I G+V+ A  NH FH  C +C+ C   F  G+ + ++ S      CG
Sbjct:  173 CAGCGELLKEGQALVALDRQWHVSCFRCKACQAVLNGE-YMGKDAVPYCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQGSAIWHPRCG 285          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim3 (actin binding LIM protein family, member 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1122])

HSP 1 Score: 115.546 bits (288), Expect = 1.839e-26
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C  DY++     C SC + I GEVV+AL  T+H  CF CSVC+K F  GDRV+      +C  CS
Sbjct:   19 GPIHCFRCRELCKGEVVRVQHVHFHIKCFTCQVCGCDLAHSGFFQKSGEYICTSDYQRLYGTKCDSCGDFISGEVVSALGRTYHPQCFVCSVCRKPFPIGDRVTFSGKECVCQQCS 134          

HSP 2 Score: 61.2326 bits (147), Expect = 2.926e-9
Identity = 39/134 (29.10%), Postives = 55/134 (41.04%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNET 462
            G   C  C  + K G  L   EK +H  CF C+ C   L    + SKD   YC  DY       C +C   I G V+ A    +H  C +C+ CQ  F  G+ + +  S      C   S  + K+  +  +E 
Sbjct:  148 GPSYCAGCKEEIKQGQSLLALEKQWHVSCFRCQTCGLVLTGE-YISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCARCQMMFTEGEEMYLTGSEVWHPVCKQASRTERKLRLRRTSEA 280          

HSP 3 Score: 57.7658 bits (138), Expect = 2.853e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSR----------------ESDSFIASAI------PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG+ PR+NF + ND     +++P                  +S S +   I      PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN++KKQ  LF
Sbjct:  514 NGS-PRSNFAAENDYISKSASLPGYGRNGLHRPQSADYYQYDSGSEVNWGIREYTVYPYEALLVTTRGRNRLPKDVDRARLERHLSAEEFYQVFGMTMVEFDRLALWKRNEMKKQARLF 631          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim3 (actin binding LIM protein family, member 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1122])

HSP 1 Score: 115.546 bits (288), Expect = 1.931e-26
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C  DY++     C SC + I GEVV+AL  T+H  CF CSVC+K F  GDRV+      +C  CS
Sbjct:   20 GPIHCFRCRELCKGEVVRVQHVHFHIKCFTCQVCGCDLAHSGFFQKSGEYICTSDYQRLYGTKCDSCGDFISGEVVSALGRTYHPQCFVCSVCRKPFPIGDRVTFSGKECVCQQCS 135          

HSP 2 Score: 60.8474 bits (146), Expect = 3.138e-9
Identity = 39/134 (29.10%), Postives = 55/134 (41.04%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNET 462
            G   C  C  + K G  L   EK +H  CF C+ C   L    + SKD   YC  DY       C +C   I G V+ A    +H  C +C+ CQ  F  G+ + +  S      C   S  + K+  +  +E 
Sbjct:  149 GPSYCAGCKEEIKQGQSLLALEKQWHVSCFRCQTCGLVLTGE-YISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCARCQMMFTEGEEMYLTGSEVWHPVCKQASRTERKLRLRRTSEA 281          

HSP 3 Score: 57.7658 bits (138), Expect = 2.855e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSR----------------ESDSFIASAI------PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG+ PR+NF + ND     +++P                  +S S +   I      PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN++KKQ  LF
Sbjct:  515 NGS-PRSNFAAENDYISKSASLPGYGRNGLHRPQSADYYQYDSGSEVNWGIREYTVYPYEALLVTTRGRNRLPKDVDRARLERHLSAEEFYQVFGMTMVEFDRLALWKRNEMKKQARLF 632          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim3 (actin binding LIM protein family, member 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1122])

HSP 1 Score: 115.931 bits (289), Expect = 1.976e-26
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C  DY++     C SC + I GEVV+AL  T+H  CF CSVC+K F  GDRV+      +C  CS
Sbjct:   20 GPIHCFRCRELCKGEVVRVQHVHFHIKCFTCQVCGCDLAHSGFFQKSGEYICTSDYQRLYGTKCDSCGDFISGEVVSALGRTYHPQCFVCSVCRKPFPIGDRVTFSGKECVCQQCS 135          

HSP 2 Score: 61.2326 bits (147), Expect = 2.624e-9
Identity = 41/135 (30.37%), Postives = 57/135 (42.22%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNET 462
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C   I G V+ A    +H  C +C+ CQ  F  G+ + +  S      C   S  + K+  +  +E 
Sbjct:  149 GPSYCAGCKEEIKQGQSLLALEKQWHVSCFRCQTCGLVL--TGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCARCQMMFTEGEEMYLTGSEVWHPVCKQASRTERKLRLRRTSEA 281          

HSP 3 Score: 57.7658 bits (138), Expect = 3.270e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSR----------------ESDSFIASAI------PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG+ PR+NF + ND     +++P                  +S S +   I      PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN++KKQ  LF
Sbjct:  567 NGS-PRSNFAAENDYISKSASLPGYGRNGLHRPQSADYYQYDSGSEVNWGIREYTVYPYEALLVTTRGRNRLPKDVDRARLERHLSAEEFYQVFGMTMVEFDRLALWKRNEMKKQARLF 684          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim3 (actin binding LIM protein family, member 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1122])

HSP 1 Score: 115.546 bits (288), Expect = 2.043e-26
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C  DY++     C SC + I GEVV+AL  T+H  CF CSVC+K F  GDRV+      +C  CS
Sbjct:   15 GPIHCFRCRELCKGEVVRVQHVHFHIKCFTCQVCGCDLAHSGFFQKSGEYICTSDYQRLYGTKCDSCGDFISGEVVSALGRTYHPQCFVCSVCRKPFPIGDRVTFSGKECVCQQCS 130          

HSP 2 Score: 60.8474 bits (146), Expect = 3.343e-9
Identity = 39/134 (29.10%), Postives = 55/134 (41.04%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNET 462
            G   C  C  + K G  L   EK +H  CF C+ C   L    + SKD   YC  DY       C +C   I G V+ A    +H  C +C+ CQ  F  G+ + +  S      C   S  + K+  +  +E 
Sbjct:  144 GPSYCAGCKEEIKQGQSLLALEKQWHVSCFRCQTCGLVLTGE-YISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCARCQMMFTEGEEMYLTGSEVWHPVCKQASRTERKLRLRRTSEA 276          

HSP 3 Score: 58.151 bits (139), Expect = 2.474e-8
Identity = 40/118 (33.90%), Postives = 58/118 (49.15%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSR----------------ESDSFIASAI-----PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG+ PR+NF + ND     +++P                  +S S +   I     PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN++KKQ  LF
Sbjct:  510 NGS-PRSNFAAENDYISKSASLPGYGRNGLHRPQSADYYQYDSGSEVNWGIRGEVYPYEALLVTTRGRNRLPKDVDRARLERHLSAEEFYQVFGMTMVEFDRLALWKRNEMKKQARLF 626          
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Match: ablim3 (actin binding LIM protein family, member 3 [Source:ZFIN;Acc:ZDB-GENE-070112-1122])

HSP 1 Score: 115.546 bits (288), Expect = 2.097e-26
Identity = 51/116 (43.97%), Postives = 69/116 (59.48%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C  DY++     C SC + I GEVV+AL  T+H  CF CSVC+K F  GDRV+      +C  CS
Sbjct:   19 GPIHCFRCRELCKGEVVRVQHVHFHIKCFTCQVCGCDLAHSGFFQKSGEYICTSDYQRLYGTKCDSCGDFISGEVVSALGRTYHPQCFVCSVCRKPFPIGDRVTFSGKECVCQQCS 134          

HSP 2 Score: 61.2326 bits (147), Expect = 2.555e-9
Identity = 41/135 (30.37%), Postives = 57/135 (42.22%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNET 462
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C   I G V+ A    +H  C +C+ CQ  F  G+ + +  S      C   S  + K+  +  +E 
Sbjct:  148 GPSYCAGCKEEIKQGQSLLALEKQWHVSCFRCQTCGLVL--TGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCARCQMMFTEGEEMYLTGSEVWHPVCKQASRTERKLRLRRTSEA 280          

HSP 3 Score: 57.7658 bits (138), Expect = 3.592e-8
Identity = 40/119 (33.61%), Postives = 58/119 (48.74%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSR----------------ESDSFIASAI------PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG+ PR+NF + ND     +++P                  +S S +   I      PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN++KKQ  LF
Sbjct:  566 NGS-PRSNFAAENDYISKSASLPGYGRNGLHRPQSADYYQYDSGSEVNWGIREYTVYPYEALLVTTRGRNRLPKDVDRARLERHLSAEEFYQVFGMTMVEFDRLALWKRNEMKKQARLF 683          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 115.161 bits (287), Expect = 4.150e-26
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K+  + C  DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+ +  + +C +CS
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 63.5438 bits (153), Expect = 6.800e-10
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C++ I G V+ A    +H  C +C  CQ+ F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL--TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSI 278          

HSP 3 Score: 57.7658 bits (138), Expect = 5.108e-8
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1609 ASAI-PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            A+AI PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN+LKKQ  LF
Sbjct:  591 ANAIYPYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 657          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 114.775 bits (286), Expect = 4.184e-26
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K+  + C  DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+ +  + +C +CS
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 63.5438 bits (153), Expect = 8.087e-10
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C++ I G V+ A    +H  C +C  CQ+ F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL--TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSI 278          

HSP 3 Score: 57.7658 bits (138), Expect = 4.922e-8
Identity = 32/67 (47.76%), Postives = 42/67 (62.69%), Query Frame = 1
Query: 1609 ASAI-PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            A+AI PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN+LKKQ  LF
Sbjct:  557 ANAIYPYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 623          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 114.005 bits (284), Expect = 7.951e-26
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K+  + C  DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+ +  + +C +CS
Sbjct:   14 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 129          

HSP 2 Score: 62.003 bits (149), Expect = 2.318e-9
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C++ I G V+ A    +H  C +C  CQ+ F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  142 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL--TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSI 276          

HSP 3 Score: 56.9954 bits (136), Expect = 7.787e-8
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN+LKKQ  LF
Sbjct:  545 PYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 606          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 112.849 bits (281), Expect = 1.197e-25
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K+  + C  DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+ +  + +C +CS
Sbjct:   18 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 133          

HSP 2 Score: 60.4622 bits (145), Expect = 5.666e-9
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C++ I G V+ A    +H  C +C  CQ+ F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  146 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVL--TGEYISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSI 280          

HSP 3 Score: 57.7658 bits (138), Expect = 3.876e-8
Identity = 36/100 (36.00%), Postives = 49/100 (49.00%), Query Frame = 1
Query: 1516 NGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAI---PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            NG  PR  F S          I     + ++  +    PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN+LKKQ  LF
Sbjct:  453 NGCKPRTEFQS-------LCVIADSIENKWLCGSFLIYPYELLVVTTRGRNRLPKDVDRTRLERHLSAEEFYQVFGMTISEFDRLALWKRNELKKQARLF 545          
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Match: uck2 (uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-GENE-942591])

HSP 1 Score: 113.235 bits (282), Expect = 1.752e-25
Identity = 47/116 (40.52%), Postives = 72/116 (62.07%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K+  + C  DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+ +  + +C +CS
Sbjct:   16 GPIQCYRCGETCKGEVVRVQTNHFHIRCFTCQVCNCDLAQSGFFFKNGEYICTRDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSICRKPFPIGDKVTFRGKDCVCQNCS 131          

HSP 2 Score: 62.7734 bits (151), Expect = 1.384e-9
Identity = 39/136 (28.68%), Postives = 62/136 (45.59%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   EK +H  CF C+ C   L    + SKD   YC  DY       C +C++ I G V+ A    +H  C +C  CQ+ F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  144 GPSHCAGCKEEIKQGQSLLALEKQWHVSCFKCQTCGIVLTGE-YISKDGVPYCESDYHAQFGIKCETCNKYISGRVLEAGGKHYHPTCARCVRCQQMFSEGEEMYLTGSEVWHPICKQAARAEKKLKYRRASETSI 278          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 120.168 bits (300), Expect = 1.032e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 79.7221 bits (195), Expect = 6.084e-15
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  226 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 346          

HSP 3 Score: 60.8474 bits (146), Expect = 4.068e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  799 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 861          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 119.398 bits (298), Expect = 1.637e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 78.9518 bits (193), Expect = 9.822e-15
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  226 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 346          

HSP 3 Score: 61.2326 bits (147), Expect = 3.341e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  715 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 777          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 118.627 bits (296), Expect = 2.563e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   21 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 134          

HSP 2 Score: 78.1814 bits (191), Expect = 1.682e-14
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  150 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 270          

HSP 3 Score: 60.8474 bits (146), Expect = 3.619e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  639 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 701          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 118.627 bits (296), Expect = 2.629e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   34 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 147          

HSP 2 Score: 78.1814 bits (191), Expect = 1.546e-14
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  163 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 283          

HSP 3 Score: 60.8474 bits (146), Expect = 3.824e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  682 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 744          
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Match: Ablim1 (actin-binding LIM protein 1 [Source:MGI Symbol;Acc:MGI:1194500])

HSP 1 Score: 118.627 bits (296), Expect = 2.653e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   34 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 147          

HSP 2 Score: 78.1814 bits (191), Expect = 1.813e-14
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  163 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 283          

HSP 3 Score: 61.2326 bits (147), Expect = 3.410e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  652 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 714          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q8K4G5|ABLM1_MOUSE (Actin-binding LIM protein 1 OS=Mus musculus OX=10090 GN=Ablim1 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 7.031e-27
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGDYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 79.7221 bits (195), Expect = 4.147e-14
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD S YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  226 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGSPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 346          

HSP 3 Score: 60.8474 bits (146), Expect = 2.870e-8
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F ++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  799 FPYEMLMVTNRGRNKILRDVDRTRLERHLAPEVFWEIFGMSIQEFDKLPLWRRNDMKKKAKLF 861          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q6H8Q1|ABLM2_HUMAN (Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 1.357e-26
Identity = 52/114 (45.61%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V +KYFH +CF CK C   L + GFF +   + C  DY++     CFSC + I GEVV+AL  T+H DCF C+VC+  F PGDRV+      +C  CS
Sbjct:   22 ILCNTCGNVCKGEVLRVQDKYFHIKCFVCKACGCDLAEGGFFVRQGEYICTLDYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCS 135          

HSP 2 Score: 62.3882 bits (150), Expect = 8.739e-9
Identity = 38/128 (29.69%), Postives = 57/128 (44.53%), Query Frame = 1
Query:   16 KLSMTF*ISLRNNFFMGKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFL 396
            K S+   +    +   G  +C  C  + K G  L   +K++H  CF CK C K L+   + SKD   YC  DY       C SC + I G V+ A    +H  C  C  C + F  G+ + ++ S+  
Sbjct:  133 KCSLPVSVGSSAHLSQGLRSCGGCGTEIKNGQALVALDKHWHLGCFKCKSCGKLLN-AEYISKDGLPYCEADYHAKFGIRCDSCEKYITGRVLEAGEKHYHPSCALCVRCGQMFAEGEEMYLQGSSIW 259          

HSP 3 Score: 58.5362 bits (140), Expect = 1.293e-7
Identity = 28/62 (45.16%), Postives = 41/62 (66.13%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++NR   +  K +DR RLE +L  +EFQ++F ++ + F +L  WKRNDLKK+  LF
Sbjct:  550 PYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 611          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|O14639|ABLM1_HUMAN (Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3)

HSP 1 Score: 119.013 bits (297), Expect = 1.833e-26
Identity = 50/114 (43.86%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C  C E + GEVVTAL  T+H +CF C++C++ F PGDRV+    + LC  C+
Sbjct:   97 IHCHKCGEPCKGEVLRVQTKHFHIKCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPNCFACTICKRPFPPGDRVTFNGRDCLCQLCA 210          

HSP 2 Score: 77.411 bits (189), Expect = 2.346e-13
Identity = 43/123 (34.96%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            C  C R  K G  L   +K +H  CF CK C K L  TG + SKD + YC +DY+      C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC   +  +EK+
Sbjct:  226 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVL--TGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKL 346          

HSP 3 Score: 62.003 bits (149), Expect = 1.408e-8
Identity = 26/63 (41.27%), Postives = 42/63 (66.67%), Query Frame = 1
Query: 1618 IPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
             PY  L ++NR   + L+ +DR RLE +L  + F+++F ++ Q F +LP W+RND+KK+  LF
Sbjct:  716 FPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDRLPLWRRNDMKKKAKLF 778          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|Q8BL65|ABLM2_MOUSE (Actin-binding LIM protein 2 OS=Mus musculus OX=10090 GN=Ablim2 PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.866e-25
Identity = 52/114 (45.61%), Postives = 65/114 (57.02%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C  C   CKG+VL+V  KYFH  CF CK C   L + GFF +     C  DY++     CFSC   I GEVV+AL  T+H DCF C+VC+  F PGDRV+      +C  CS
Sbjct:   22 ILCNTCGNVCKGEVLRVQNKYFHIRCFVCKACGCDLAEGGFFVRQGEHICTRDYQRLYGTRCFSCDRFIEGEVVSALGKTYHPDCFVCAVCRLPFPPGDRVTFNGKECMCQKCS 135          

HSP 2 Score: 60.077 bits (144), Expect = 4.797e-8
Identity = 40/137 (29.20%), Postives = 62/137 (45.26%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV-EKKVVNETAV 468
            G  +C  C  + K G  L   +K++H  CF CK C K L+   + SKD   YC  DY       C  C + I G V+ A    +H  C  C  C + F  G+ + ++ S+     C   +  ++K  E +  +E+ V
Sbjct:  149 GLRSCGGCGLEIKNGQALVALDKHWHLGCFKCKTCGKLLN-AEYISKDGLPYCEADYHSKFGIRCDGCEKYITGRVLEAGEKHYHPSCALCVRCGQMFSEGEEMYLQGSSIWHPACRQAARTEDKSKETRTSSESIV 284          

HSP 3 Score: 58.5362 bits (140), Expect = 1.328e-7
Identity = 37/104 (35.58%), Postives = 54/104 (51.92%), Query Frame = 1
Query: 1498 PLTKMDNGTLPRNNFPSNNDKNLY-YSAIPSRESDSFIASAIPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            P +K D    PR +     + NL    A P     +      PY  L ++NR   +  K +DR RLE +L  +EFQ++F ++ + F +L  WKRNDLKK+  LF
Sbjct:  509 PYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTREYKIYPYDSLIVTNRIRVKLPKDVDRTRLERHLSPEEFQEVFGMSIEEFDRLALWKRNDLKKKALLF 612          
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Match: sp|O94929|ABLM3_HUMAN (Actin-binding LIM protein 3 OS=Homo sapiens OX=9606 GN=ABLIM3 PE=1 SV=3)

HSP 1 Score: 112.849 bits (281), Expect = 1.438e-24
Identity = 46/114 (40.35%), Postives = 70/114 (61.40%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C+ C   CKG+V++V   +FH  CFTC++C   L  +GFF K++ + C +DY++     C SC + I GEV++AL  T+H  CF CS+C+K F  GD+V+      +C  CS
Sbjct:   21 IQCYRCGDTCKGEVVRVHNNHFHIRCFTCQVCGCGLAQSGFFFKNQEYICTQDYQQLYGTRCDSCRDFITGEVISALGRTYHPKCFVCSLCRKPFPIGDKVTFSGKECVCQTCS 134          

HSP 2 Score: 62.3882 bits (150), Expect = 1.055e-8
Identity = 39/137 (28.47%), Postives = 61/137 (44.53%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            G   C  C  + K G  L   +K +H  CF C+ C   L  TG + SKD   YC  DY       C +C   I G V+ A    +H  C +C  C + F  G+ + +  S      C   +  ++K++ +  +ET++
Sbjct:  147 GPSHCAGCKEEIKHGQSLLALDKQWHVSCFKCQTCSVIL--TGEYISKDGVPYCESDYHAQFGIKCETCDRYISGRVLEAGGKHYHPTCARCVRCHQMFTEGEEMYLTGSEVWHPICKQAARAEKKLKHRRTSETSI 281          

HSP 3 Score: 58.151 bits (139), Expect = 2.187e-7
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   R  K +DR RLE +L  +EF Q+F +T   F +L  WKRN+LKKQ  LF
Sbjct:  622 PYELLLVTTRGRNRLPKDVDRTRLERHLSQEEFYQVFGMTISEFDRLALWKRNELKKQARLF 683          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A4E0RUC4 (Actin-binding LIM protein 1 OS=Fasciola hepatica OX=6192 GN=D915_004549 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.652e-36
Identity = 63/116 (54.31%), Postives = 82/116 (70.69%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            MGK++C  C RKC+GDVLKV EKYFHK CFTC  C+  L+  GFF KD+ FYC EDY++Y  A C  C + +IGE+VT ++ +FH++CFKC+ C   F PGDRV++    F C DC
Sbjct:    1 MGKISCESCKRKCRGDVLKVAEKYFHKGCFTCSKCKISLEKGGFFMKDDGFYCQEDYQRYFVAKCKICAKDLIGEIVTVMSFSFHRECFKCTGCAIPFHPGDRVTVWQERFFCPDC 116          

HSP 2 Score: 73.9442 bits (180), Expect = 9.107e-10
Identity = 31/58 (53.45%), Postives = 43/58 (74.14%), Query Frame = 1
Query: 1624 YSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            YS+L+    +  K +DR  LE YL + EF+Q+F L+R AFY+LPEWKRNDLK++ +LF
Sbjct:  795 YSELQSFGNKVPKGVDRMALEAYLSEDEFEQVFRLSRTAFYRLPEWKRNDLKRRANLF 852          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A504YZZ8 (Actin-binding LIM protein 1 (Fragment) OS=Fasciola gigantica OX=46835 GN=FGIG_07197 PE=4 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 2.980e-36
Identity = 65/126 (51.59%), Postives = 87/126 (69.05%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            +GK++C  C RKC+GDVLKV EKYFHK CFTC  C+  L+  GFF KD+ FYC EDY++Y  A C  C + +IGE+VT ++ +FH++CFKC+ C   F PGDRV++    F C DC    I Q+K+
Sbjct:    1 IGKISCESCKRKCRGDVLKVAEKYFHKGCFTCSKCKISLEKGGFFMKDDGFYCQEDYQRYFVAKCKICAKDLIGEIVTVMSFSFHRECFKCTGCAIPFHPGDRVTVWQERFFCPDC----IAQQKI 122          

HSP 2 Score: 77.7962 bits (190), Expect = 5.421e-11
Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = 1
Query: 1618 IPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            IPYS+L+    +  K +DR  LE YL + EF+Q+F L+R AFY+LPEWKRNDLK++ +LF
Sbjct:  789 IPYSELQSFRNKVPKGVDRMALEGYLSEDEFEQVFRLSRTAFYRLPEWKRNDLKRRANLF 848          

HSP 3 Score: 61.2326 bits (147), Expect = 7.436e-6
Identity = 47/145 (32.41%), Postives = 69/145 (47.59%), Query Frame = 1
Query:  898 QIKKLSSYPSGHVEENQEPS-IERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKI-----RKARSASQSGDIRANETPS---RMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLH 1305
            ++++L+ YP+G   +   P+ IER DWP PPA +V L E +R +           G T  +     ++A S   + D   NET +     GI + + R         H  R   ++     DPISASRSP+A  EP+  PRY  H
Sbjct:  469 EVRRLACYPAGQQRDQSLPAPIERYDWPGPPASAVILAELMRERRYRRRDHGQVNGGTDDVDDMESQEALSIDCAFDGAVNETSTPRQSSGIGQAILRE-----EMQHKQRSQSQQF---LDPISASRSPNAAHEPVFKPRYSTH 605          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A2H1CDK4 (LIM domain protein OS=Fasciola hepatica OX=6192 GN=D915_07299 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.038e-35
Identity = 63/116 (54.31%), Postives = 82/116 (70.69%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            MGK++C  C RKC+GDVLKV EKYFHK CFTC  C+  L+  GFF KD+ FYC EDY++Y  A C  C + +IGE+VT ++ +FH++CFKC+ C   F PGDRV++    F C DC
Sbjct:    1 MGKISCESCKRKCRGDVLKVAEKYFHKGCFTCSKCKISLEKGGFFMKDDGFYCQEDYQRYFVAKCKICAKDLIGEIVTVMSFSFHRECFKCTGCAIPFHPGDRVTVWQERFFCPDC 116          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A5J4P3L7 (Actin-binding LIM protein OS=Paragonimus westermani OX=34504 GN=DEA37_0014899 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.337e-34
Identity = 60/119 (50.42%), Postives = 83/119 (69.75%), Query Frame = 1
Query:   58 FMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSG 414
             M K+ C  C RKC+GDVL+V +KYFHK+CF C  C K L+  GFF KD+ FYC EDY++Y  A C  C   ++GE+VT L+++FH++CFKC++C   F PGDRV++ +  F C +C G
Sbjct:    1 MMVKILCEKCKRKCRGDVLRVSDKYFHKDCFKCSKCSKSLETGGFFIKDDGFYCQEDYQRYFIAKCKICSFDLVGEIVTVLDYSFHRECFKCTICATTFNPGDRVTVWHERFFCPNCIG 119          
BLAST of Actin-binding LIM protein vs. TrEMBL
Match: A0A5K4F807 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.779e-34
Identity = 64/116 (55.17%), Postives = 77/116 (66.38%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            MGK+ C  C RKC+GDVLKV  KYFHK+CF C  C K L+  GFF KD  FYC +DY++Y  A C  C E + GEVVTALN +FH+ CFKC+ C   F PGDRV++    F C  C
Sbjct:    1 MGKIYCDKCRRKCRGDVLKVSNKYFHKDCFKCTECNKSLEHGGFFVKDGGFYCQDDYRRYFVAKCKICSEDLTGEVVTALNFSFHRGCFKCNKCSITFRPGDRVTVWQEKFYCPHC 116          

HSP 2 Score: 76.6406 bits (187), Expect = 1.312e-10
Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = 1
Query: 1618 IPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            IPY +L+     + K +DR  +ET+L D+EFQQ+F L+R AFY+LPEWKRNDLK++  LF
Sbjct:  869 IPYEKLKEYRGIYPKGIDRTAVETHLSDEEFQQVFALSRTAFYRLPEWKRNDLKRRAQLF 928          

HSP 3 Score: 64.3142 bits (155), Expect = 9.166e-7
Identity = 58/184 (31.52%), Postives = 85/184 (46.20%), Query Frame = 1
Query:  898 QIKKLSSYPSGHVEENQEPS-IERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRM-------GIAEVLKRSTTDCSSYDHIDRVNVE-----ETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERH-LGYSMDFVNSTSRSFT 1407
            + +KL+  P+G   +   P  IER DWP+PPA  V L E +R + Q    +A  +GT            SGDI   E+   +       GI + +  S         I R   E      +    DP+SASR+P+A  EP   PRY  H   S SR+        +H +GYSM+F++  +R++T
Sbjct:  461 ETRKLACLPAGQERDKSTPRPIERYDWPAPPASGVVLAELMRERRQRRREQARLSGT----------QFSGDIDDLESQEALSIDYSFDGIPDTIDHSVEHIGIGQAILREEAESKRRSRSQTYLDPVSASRTPNASVEPSFKPRYATHQFASASRHRSSSPARYKHPIGYSMEFIHLGNRNWT 634          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 117.472 bits (293), Expect = 4.157e-27
Identity = 58/138 (42.03%), Postives = 80/138 (57.97%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSG-ISIDQEKVEKKVVNETAVPNQN 480
            + C+ C   CKG+VL+V  K+FH +CFTCK+C   L   GFF K+  + C  DY++     C SC E + GEVVTAL  T+H  CF C++C++ F  GDRV+    + LC  C+  +S    KV    +N   VPN N
Sbjct:   44 IQCYKCGEPCKGEVLRVQNKHFHIKCFTCKVCGCDLAQGGFFMKNGDYLCTLDYQRIHGTRCNSCGEFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQYCAEPMSPGPAKVP---INIYVVPNNN 178          

HSP 2 Score: 73.9442 bits (180), Expect = 2.954e-13
Identity = 41/123 (33.33%), Postives = 64/123 (52.03%), Query Frame = 1
Query:   73 TCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEK 435
            +C  C R  K G  L   E+ +H  CF CK C K L  TG + SKD + YC +DY+ +    C +CH+ I G+V+ A +  +H  C +CS C + F  G+ + ++ S      C   +  +E+
Sbjct:  180 SCAGCGRDIKNGQALLALERQWHLGCFKCKACGKVL--TGEYISKDGAPYCEKDYQIHFGVKCEACHQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPGCKSSTRTEER 300          

HSP 3 Score: 55.0694 bits (131), Expect = 1.827e-7
Identity = 25/62 (40.32%), Postives = 38/62 (61.29%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   +  + +DR RLE +L  + F  +F +  + F +LP WKRND+KK+V LF
Sbjct:  601 PYEMLMVTGRGRSKLPRDVDRTRLERHLAPETFFDIFGMEMKEFDRLPLWKRNDMKKKVRLF 662          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ENSAMXT00000017735.2 (pep primary_assembly:Astyanax_mexicanus-2.0:14:15960730:16057987:-1 gene:ENSAMXG00000017208.2 transcript:ENSAMXT00000017735.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 4.449e-26
Identity = 50/114 (43.86%), Postives = 69/114 (60.53%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + CF C   CKG+V++V   +FH +CFTC++C   L  +GFF K   + C EDY++     C SC + I GEVV+AL  T+H  CF CS+C+K F  GDRV+      +C  CS
Sbjct:   49 IACFRCREMCKGEVVRVQNVHFHVKCFTCQVCGCDLARSGFFQKGGEYICTEDYQRLYGTKCDSCGDFITGEVVSALGRTYHPRCFVCSICRKPFPIGDRVTFCGKKCVCQQCS 162          

HSP 2 Score: 57.7658 bits (138), Expect = 3.114e-8
Identity = 35/124 (28.23%), Postives = 56/124 (45.16%), Query Frame = 1
Query:  100 KGDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            +G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C +C + I G V+ A    +H  C +C+ C   F  G+ + +  S+     C   +  + K+  +  +E ++
Sbjct:  189 QGQSLLALEKQWHVSCFKCQTCGTVL--TGEYISKDGIPYCESDYHSQFGIRCETCSKYISGRVLEAGGKHYHPTCARCARCHMMFAEGEEMYLTGSDVWHPMCKQAAKIERKLRLRRTSEASI 310          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 113.62 bits (283), Expect = 9.331e-26
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            + C+ C   CKG+VL+V  ++FH +CFTCK+C   L   GFF K+  + C  DY++     C  C + + GEVVTAL  T+H  CF C++C++ F  GDRV+    + LC  C
Sbjct:   23 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRC 135          

HSP 2 Score: 74.3294 bits (181), Expect = 2.121e-13
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEK 435
            C  C R  K G  L   ++ +H  CF CK C K L    + SKD + YC  DY+ +    C +C + I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC G +   EK
Sbjct:  152 CAGCGRDIKNGQALLALDRQWHLGCFKCKACGKVLSGE-YISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEK 271          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 113.62 bits (283), Expect = 9.959e-26
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            + C+ C   CKG+VL+V  ++FH +CFTCK+C   L   GFF K+  + C  DY++     C  C + + GEVVTAL  T+H  CF C++C++ F  GDRV+    + LC  C
Sbjct:   20 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRC 132          

HSP 2 Score: 74.3294 bits (181), Expect = 2.097e-13
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEK 435
            C  C R  K G  L   ++ +H  CF CK C K L    + SKD + YC  DY+ +    C +C + I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC G +   EK
Sbjct:  149 CAGCGRDIKNGQALLALDRQWHLGCFKCKACGKVLSGE-YISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEK 268          
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Match: ablim1b (actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-GENE-050327-91])

HSP 1 Score: 112.464 bits (280), Expect = 1.770e-25
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            + C+ C   CKG+VL+V  ++FH +CFTCK+C   L   GFF K+  + C  DY++     C  C + + GEVVTAL  T+H  CF C++C++ F  GDRV+    + LC  C
Sbjct:   20 IQCYKCGEPCKGEVLRVQSRHFHIKCFTCKVCGCDLAQGGFFMKNGEYLCTLDYQRLHGTRCNGCGDFVEGEVVTALGKTYHPACFVCTICKRPFPAGDRVTFNGKDCLCQRC 132          

HSP 2 Score: 73.1738 bits (178), Expect = 4.336e-13
Identity = 40/121 (33.06%), Postives = 60/121 (49.59%), Query Frame = 1
Query:   76 CFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEK 435
            C  C R  K G  L   ++ +H  CF CK C K L    + SKD + YC  DY+ +    C +C + I G+V+ A +  +H  C +CS C + F  G+ + ++ S     DC G +   EK
Sbjct:  149 CAGCGRDIKNGQALLALDRQWHLGCFKCKACGKVLSGE-YISKDGAPYCERDYQIHFGVQCEACQQFITGKVLEAGDKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKGNARVDEK 268          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ablim1a (actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-GENE-080219-41])

HSP 1 Score: 108.227 bits (269), Expect = 9.649e-25
Identity = 46/113 (40.71%), Postives = 65/113 (57.52%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            + C  C+  CKG+ L+V +++FH +CF CK+C   L   GFF K   + C  DY++     C  C + + GEVVTAL  T+H  CF C+VC+  F  GDRV+    + LC  C
Sbjct:   12 ILCHKCSEPCKGEALRVQDRHFHIKCFICKVCGCDLAQNGFFMKSGEYLCTHDYQQQHGTRCTGCGDFVEGEVVTALGKTYHPQCFVCAVCRCPFPAGDRVTFNGKDCLCQRC 124          

HSP 2 Score: 64.6994 bits (156), Expect = 3.911e-11
Identity = 37/112 (33.04%), Postives = 55/112 (49.11%), Query Frame = 1
Query:  103 GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEK 435
            G  L   +K +H  CF CK C K L  TG + SKD   YC +DY+      C  C + I G+V+ A    +H  C +C  C++ F  G+ + M+ S+    +C      +EK
Sbjct:  151 GQALLALDKQWHLGCFKCKTCGKVL--TGEYISKDGVPYCEQDYQSQFGIKCEECGKFITGKVLEAGEKHYHPSCARCVRCKQMFSEGEEMFMQGSSIWHPECKRAERAEEK 260          

HSP 3 Score: 58.5362 bits (140), Expect = 3.619e-9
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 1
Query: 1603 FIASAIPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            F     PY  L ++NR   +  + +DR RLE +L  +EF  +F +T Q F +L  WK+NDLKK+  LF
Sbjct:  729 FAHKVYPYEALLVTNRVRSKLPRDVDRARLERHLSPEEFDNIFGMTIQEFDRLALWKKNDLKKKARLF 796          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006267.1 (pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 gene:ENSPMAG00000005668.1 transcript:ENSPMAT00000006267.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 1.936e-24
Identity = 47/114 (41.23%), Postives = 68/114 (59.65%), Query Frame = 1
Query:   70 VTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            + C+ C   C+G+VL+V  ++FH  CFTCK+C   L   GFF K+  + C  DY++     C +C + + GEVVTAL  T+H  CF CSVC++ F  G RV+      LC +C+
Sbjct:   23 IHCYKCRDLCRGEVLRVENRHFHVSCFTCKVCGCDLAQCGFFVKNGEYVCTLDYQRLYGTRCQACGDFVEGEVVTALGRTYHPRCFVCSVCRQPFPSGARVTFNGRECLCHECT 136          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007081.1 (pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-1 gene:ENSPMAG00000006392.1 transcript:ENSPMAT00000007081.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 1.243e-14
Identity = 35/93 (37.63%), Postives = 48/93 (51.61%), Query Frame = 1
Query:   76 CFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKF 354
            C  C +  +G  L    K +H   F C  C   L +TGF  +  + YC   Y+KY A  C  C +KI+GE++ AL  T+H  CF C+ C K F
Sbjct:  419 CGQCNQIIRGPFLVALGKSWHPAEFNCAQCHTTLTETGFVEEQGNVYCETCYEKYFAPDCAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPF 511          

HSP 2 Score: 62.003 bits (149), Expect = 2.304e-10
Identity = 28/91 (30.77%), Postives = 44/91 (48.35%), Query Frame = 1
Query:   76 CFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIG--EVVTALNHTFHKDCFKCSVC 342
            C  C +K  G+++    + +H  CF C  C K   ++ F  +D   YC +DY    +  C  C   +    + + AL HT+H  CF C+VC
Sbjct:  478 CAKCRKKIMGEIMHALRQTWHTTCFVCASCGKPFGNSLFHMEDGEPYCEKDYVVLFSTKCHGCDFPVEAGDKFIEALGHTWHDTCFICAVC 568          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 60.4622 bits (145), Expect = 3.993e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  109 VLKVGEKYFHKECFTCKICQKKLDDTG--FFSKDESFYCPEDYKKYCA--AVCFSCHEKIIGEVVT--ALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLC 399
            +LK  E+++H++C +C +C  +L + G   + K     C  DY +       C SC ++I    +T    +  +H +CFKC+ CQK F  GDR  + NS+ +C
Sbjct:   42 LLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIIC 144          
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Match: lmo2 (LIM domain only 2 (rhombotin-like 1) [Source:NCBI gene;Acc:30332])

HSP 1 Score: 59.6918 bits (143), Expect = 8.124e-11
Identity = 33/103 (32.04%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  109 VLKVGEKYFHKECFTCKICQKKLDDTG--FFSKDESFYCPEDYKKYCA--AVCFSCHEKIIGEVVT--ALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLC 399
            +LK  E+++H++C +C +C  +L + G   + K     C  DY +       C SC ++I    +T    +  +H +CFKC+ CQK F  GDR  + NS+ +C
Sbjct:   41 LLKAIEQFWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGHCASCGKRIRAFEMTMRVRDKVYHLECFKCAACQKHFCVGDRYLLVNSDIIC 143          
BLAST of Actin-binding LIM protein vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 46.9802 bits (110), Expect = 8.073e-6
Identity = 26/82 (31.71%), Postives = 41/82 (50.00%), Query Frame = 1
Query:  112 LKVGEKYFHKECFTCKICQKKLDDTGF-FSKDES----FYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVC 342
            LK   KY+H+ CFTC+ CQK L    F +  D++      C  DY +    +C  C   + G   TA  + + ++ F C++C
Sbjct:   46 LKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYFRRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSCTIC 127          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO43201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ98])

HSP 1 Score: 82.8037 bits (203), Expect = 1.548e-17
Identity = 36/117 (30.77%), Postives = 61/117 (52.14%), Query Frame = 1
Query:   58 FMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
             + +V C  CT+ C G+ L     Y+H+ C  C +C + L    F+   E +YC +DY+      C SC   + GE+++     FH+ CF C+ C++ F P D++    +++LC  C
Sbjct:    1 MIAEVLCRKCTKPCSGEALLHENAYYHENCLCCSVCGQGLRSKPFYVMGEQYYCKDDYQNQYGKKCDSCQLYLEGEIISIHGKNFHEACFACNSCRQPFPPSDKIIFTGTDYLCQTC 117          

HSP 2 Score: 56.225 bits (134), Expect = 1.181e-8
Identity = 37/127 (29.13%), Postives = 58/127 (45.67%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKG-DVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKV 438
            M  V C  C    KG   L   EK +H  CF+C  C   L    +   D   YC +DY++     C +C+  I G+V+ A N  +H  C +C+ C   F  G+ + ++ +      CS  +  +EK+
Sbjct:  145 MANVACAGCGEAIKGSQALLALEKQWHLWCFSCTKCHCLLS-LEYMGMDGKPYCEKDYQELFGVTCAACNGYITGKVLQAGNKHYHPKCSRCARCNNIFGEGEEMFLQGNEIWHPKCSDEAALEEKM 270          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO44183 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWK9])

HSP 1 Score: 67.3958 bits (163), Expect = 1.043e-11
Identity = 33/95 (34.74%), Postives = 48/95 (50.53%), Query Frame = 1
Query:  127 KYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDR-VSMKNSNFLCGDC 408
            K FH  CF C +C+++L  T F+++    YC +DY     +VC  C   I G V+   +H FH +CF C  C       D  V ++    LCG+C
Sbjct:   29 KRFHNACFRCVVCEERLS-TDFYARGSELYCKKDYLSKFNSVCHICAHNIAGLVMVIGDHKFHTECFHCQHCDSFLAVDDNYVMVERHRLLCGNC 122          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO41100 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5D2])

HSP 1 Score: 66.6254 bits (161), Expect = 1.452e-11
Identity = 39/105 (37.14%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  100 KGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKII-GEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            +G VL  GE + HK CF+C  C + L    F  +D   YC E Y K+ A  C  C + I+ GE  T     FHK+CF CS C +  +  +    +    LCGDC+
Sbjct:  425 EGGVLYNGETW-HKACFSCYFCHRSLASAAFSVRDGCRYCMECYGKFYAKQCEICLKAIVGGEYYTLEESNFHKECFMCSRCGRS-LASEGFVREGDELLCGDCA 527          

HSP 2 Score: 58.5362 bits (140), Expect = 5.020e-9
Identity = 30/101 (29.70%), Postives = 51/101 (50.50%), Query Frame = 1
Query:  112 LKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSG 414
            L+    ++H+ CF C  C + +  +GF  KD++F+CP  Y+   +  C SC E ++   V     T+HK CF C  C +  +     S+++    C +C G
Sbjct:  369 LEYSGNFWHENCFRCANCGEAIGTSGFVPKDDTFFCPGCYQSKFSKRCASCGEPLLEGGVLYNGETWHKACFSCYFCHRS-LASAAFSVRDGCRYCMECYG 468          

HSP 3 Score: 49.2914 bits (116), Expect = 3.663e-6
Identity = 29/97 (29.90%), Postives = 44/97 (45.36%), Query Frame = 1
Query:  121 GEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKII-GEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
             E  FH  CFTC+ C + L +  +F   +  YC   + +   + C  C E I  GE   A+N  +H   F+C  C    I G +  ++    +C DC
Sbjct:  188 AEASFHPGCFTCETCNELLVELTYFQHADKVYCGRHFAELQKSRCGGCDELIFTGEYTVAMNKNWHLGHFQCQTCDHS-ITGRQFIVRGDKPVCTDC 283          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: EDO37872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEJ4])

HSP 1 Score: 58.9214 bits (141), Expect = 1.319e-10
Identity = 31/105 (29.52%), Postives = 53/105 (50.48%), Query Frame = 1
Query:  109 VLKVGEKYFHKECFTCKICQKKLDDTG--FFSKDESFYCPEDYKKYCA--AVCFSCHEKI--IGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGD 405
            +L+  ++++H+EC  C  C   L + G  F+ + +   C  DY +      +C  C + I  +  V+ A  H +H DCF C VC+ +F  GD+  +  +  LC D
Sbjct:   14 LLRALDQFWHEECLKCSYCCGMLSEMGPKFYFRGDLILCKRDYIRIFGTTGICSFCFKTIPPLEMVMRARQHVYHLDCFACQVCRHRFCVGDKFYLHQNTVLCED 118          
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Match: LDB3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY2])

HSP 1 Score: 58.9214 bits (141), Expect = 3.430e-10
Identity = 31/84 (36.90%), Postives = 44/84 (52.38%), Query Frame = 1
Query:  100 KGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKK 351
            +G  +    K +H + FTC  C   L + GF  +    YC +DY K+ A  C SC + I+G  V A+  TFH + F CS C K+
Sbjct:    1 RGPFVSAIGKSWHPDHFTCAGCGDSLQNQGFIEEGGKLYCEKDYNKFFAPHCESCKQPIVGPCVQAIGKTFHPEHFTCSSCSKQ 84          

HSP 2 Score: 49.2914 bits (116), Expect = 6.860e-7
Identity = 33/93 (35.48%), Postives = 43/93 (46.24%), Query Frame = 1
Query:   76 CFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIG--EVVTALNHTFHKDCFKCSVCQK 348
            C  C +   G  ++   K FH E FTC  C K++   GF       YC   YKK     C  C+  I G    V A++ ++H  CFKCS C K
Sbjct:   52 CESCKQPIVGPCVQAIGKTFHPEHFTCSSCSKQIGSEGFNVDRGMPYCEMCYKKLFCVKCAGCNRAIGGGDRWVEAIDVSWHATCFKCSTCNK 144          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 111.694 bits (278), Expect = 2.994e-25
Identity = 50/116 (43.10%), Postives = 67/116 (57.76%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C  C   CKG+V++V E +FH +CFTC +C   L  +GFF K   + C  DY++     C  C+  I GEVV+AL  T+H  CF CSVC K F  GDRV+    + +C  CS
Sbjct:   18 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCS 133          

HSP 2 Score: 57.3806 bits (137), Expect = 3.623e-8
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   +  K +DR RLE +L  +EF Q+F +T + F +L  WKRN+LKKQ  LF
Sbjct:  634 PYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 695          

HSP 3 Score: 55.4546 bits (132), Expect = 1.510e-7
Identity = 35/107 (32.71%), Postives = 46/107 (42.99%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSM 378
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C  C   I G V+ A    +H  C +C+ C   F  G+ + +
Sbjct:  147 GPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL--TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 251          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 111.309 bits (277), Expect = 3.678e-25
Identity = 50/116 (43.10%), Postives = 67/116 (57.76%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C  C   CKG+V++V E +FH +CFTC +C   L  +GFF K   + C  DY++     C  C+  I GEVV+AL  T+H  CF CSVC K F  GDRV+    + +C  CS
Sbjct:   19 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCS 134          

HSP 2 Score: 59.6918 bits (143), Expect = 6.759e-9
Identity = 29/68 (42.65%), Postives = 41/68 (60.29%), Query Frame = 1
Query: 1603 FIASAIPYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            F +   PY  L ++ R   +  K +DR RLE +L  +EF Q+F +T + F +L  WKRN+LKKQ  LF
Sbjct:  593 FFSQIYPYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 660          

HSP 3 Score: 54.6842 bits (130), Expect = 2.287e-7
Identity = 35/107 (32.71%), Postives = 46/107 (42.99%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSM 378
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C  C   I G V+ A    +H  C +C+ C   F  G+ + +
Sbjct:  148 GPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL--TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 252          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 111.694 bits (278), Expect = 3.736e-25
Identity = 50/116 (43.10%), Postives = 67/116 (57.76%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C  C   CKG+V++V E +FH +CFTC +C   L  +GFF K   + C  DY++     C  C+  I GEVV+AL  T+H  CF CSVC K F  GDRV+    + +C  CS
Sbjct:   18 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCS 133          

HSP 2 Score: 57.3806 bits (137), Expect = 3.520e-8
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   +  K +DR RLE +L  +EF Q+F +T + F +L  WKRN+LKKQ  LF
Sbjct:  617 PYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 678          

HSP 3 Score: 55.0694 bits (131), Expect = 1.900e-7
Identity = 35/107 (32.71%), Postives = 46/107 (42.99%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSM 378
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C  C   I G V+ A    +H  C +C+ C   F  G+ + +
Sbjct:  147 GPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL--TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 251          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 111.309 bits (277), Expect = 3.887e-25
Identity = 50/116 (43.10%), Postives = 67/116 (57.76%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C  C   CKG+V++V E +FH +CFTC +C   L  +GFF K   + C  DY++     C  C+  I GEVV+AL  T+H  CF CSVC K F  GDRV+    + +C  CS
Sbjct:   18 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCS 133          

HSP 2 Score: 57.7658 bits (138), Expect = 2.711e-8
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   +  K +DR RLE +L  +EF Q+F +T + F +L  WKRN+LKKQ  LF
Sbjct:  580 PYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 641          

HSP 3 Score: 55.0694 bits (131), Expect = 2.124e-7
Identity = 33/106 (31.13%), Postives = 44/106 (41.51%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSM 378
            G   C  C  + K G  L   EK +H  CF C+ C   L    + SKD   YC  DY       C  C   I G V+ A    +H  C +C+ C   F  G+ + +
Sbjct:  147 GPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVLTGE-YISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 251          
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Match: ablim3 (actin binding LIM protein family member 3 [Source:NCBI gene;Acc:101163501])

HSP 1 Score: 110.923 bits (276), Expect = 5.342e-25
Identity = 50/116 (43.10%), Postives = 67/116 (57.76%), Query Frame = 1
Query:   64 GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCS 411
            G + C  C   CKG+V++V E +FH +CFTC +C   L  +GFF K   + C  DY++     C  C+  I GEVV+AL  T+H  CF CSVC K F  GDRV+    + +C  CS
Sbjct:   18 GPIRCQRCREICKGEVVRVQETHFHVKCFTCTVCNCDLARSGFFQKKGEYICTADYQRLYGTRCDRCNSFITGEVVSALGRTYHPKCFVCSVCSKPFPIGDRVTFSGKDCVCQQCS 133          

HSP 2 Score: 57.3806 bits (137), Expect = 3.809e-8
Identity = 28/62 (45.16%), Postives = 39/62 (62.90%), Query Frame = 1
Query: 1621 PYSQLRISNR---RFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            PY  L ++ R   +  K +DR RLE +L  +EF Q+F +T + F +L  WKRN+LKKQ  LF
Sbjct:  585 PYEALIVTTRGRNKLPKDVDRARLERHLSPEEFVQVFGMTVEEFDRLALWKRNELKKQARLF 646          

HSP 3 Score: 54.299 bits (129), Expect = 2.957e-7
Identity = 35/107 (32.71%), Postives = 46/107 (42.99%), Query Frame = 1
Query:   64 GKVTCFHCTRKCK-GDVLKVGEKYFHKECFTCKICQKKLDDTG-FFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSM 378
            G   C  C  + K G  L   EK +H  CF C+ C   L  TG + SKD   YC  DY       C  C   I G V+ A    +H  C +C+ C   F  G+ + +
Sbjct:  147 GPSHCAGCGAEIKQGQSLLALEKQWHVSCFRCQTCSMVL--TGEYISKDGVPYCEADYHAQFGVKCEGCSRYISGRVLEAGGKHYHPSCARCARCNMMFKEGEEMYL 251          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000019042.1 (SMESG000019042.1)

HSP 1 Score: 1143.26 bits (2956), Expect = 0.000e+0
Identity = 577/580 (99.48%), Postives = 579/580 (99.83%), Query Frame = 1
Query:   58 FMGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKPTLNGKSNAYHNQXXXXXXXXXXXXXXXPIRRKVVSNRSTVNHQPLSNSLNRPISSQSSKLRPISRENSNTDPDHGPGSSFTTPRHFHIPQGNNRYWMYNSMVVGSKNHPLALSACNINKLXXXXXXXXXXXXLHKDQIKKLSSYPSGHVEENQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTSDSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            ++GKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKPTLNGKSNAYHNQVDSSSQVKDSDSYSVPIRRKVVSNRSTVNHQPLSNSLNRPISSQSSKLRPISRENSNTDPDHGPGSSFTTPRHFHIPQGNNRYWMYNSMVVGSKNHPLALSACNINKLSSSSQRVSDNDSLHKDQIKKLSSYPSGHVEENQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTSDSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAIPYSQLRISNRR LKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF
Sbjct:    6 YLGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKPTLNGKSNAYHNQVDSSSQVKDSDSYSVPIRRKVVSNRSTVNHQPLSNSLNRPISSQSSKLRPISRENSNTDPDHGPGSSFTTPRHFHIPQGNNRYWMYNSMVVGSKNHPLALSACNINKLSSSSQRVSDNDSLHKDQIKKLSSYPSGHVEENQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTSDSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDKNLYYSAIPSRESDSFIASAIPYSQLRISNRRVLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 585          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000037349.1 (SMESG000037349.1)

HSP 1 Score: 142.124 bits (357), Expect = 3.552e-35
Identity = 61/116 (52.59%), Postives = 76/116 (65.52%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            MGK+ C  C++KC GDVLKVGEKYFH+ CF CK C K LD   F+ +++++YC  DY       CF C   I  EVV+ALN  FH++CFKC  C   F PG+RV+MKN  FLC  C
Sbjct:    1 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 116          

HSP 2 Score: 86.2705 bits (212), Expect = 2.706e-17
Identity = 62/174 (35.63%), Postives = 89/174 (51.15%), Query Frame = 1
Query:  892 KDQIKKLSSYPSGHVEENQEPS-IERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPS--RMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSF 1404
            KD + KL+SYP+G    +  P  IER+DWP+P + +V L E+  RK     +   S         A   +QS D  A  +    +  + EV++ S    +S     +VN        D ISASRSPSA  EP+  PR+  H + S SR+  +     RH GYS+DF++ T+RSF
Sbjct:  290 KDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSC----KVNC-------DVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSF 452          

HSP 3 Score: 70.8626 bits (172), Expect = 1.617e-12
Identity = 37/82 (45.12%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 1573 SAIPSRESDSFIAS-------AIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            S I S E+ SF +         I YS L   + + L+ LD  +LETYL  +EF +LF L R  FY+LPEWK+NDLK++++LF
Sbjct:  598 SKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 679          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000037349.1 (SMESG000037349.1)

HSP 1 Score: 141.739 bits (356), Expect = 3.711e-35
Identity = 61/116 (52.59%), Postives = 76/116 (65.52%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDC 408
            MGK+ C  C++KC GDVLKVGEKYFH+ CF CK C K LD   F+ +++++YC  DY       CF C   I  EVV+ALN  FH++CFKC  C   F PG+RV+MKN  FLC  C
Sbjct:    1 MGKIYCHSCSKKCVGDVLKVGEKYFHQICFNCKDCGKTLDAGAFYFRNDNYYCLNDYTNRFTNKCFICSNAISSEVVSALNRHFHRECFKCGSCNIVFAPGNRVTMKNETFLCISC 116          

HSP 2 Score: 86.2705 bits (212), Expect = 2.504e-17
Identity = 62/174 (35.63%), Postives = 89/174 (51.15%), Query Frame = 1
Query:  892 KDQIKKLSSYPSGHVEENQEPS-IERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGDIRANETPS--RMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSF 1404
            KD + KL+SYP+G    +  P  IER+DWP+P + +V L E+  RK     +   S         A   +QS D  A  +    +  + EV++ S    +S     +VN        D ISASRSPSA  EP+  PR+  H + S SR+  +     RH GYS+DF++ T+RSF
Sbjct:  290 KDNVIKLASYPAGEKHPDNIPYPIERDDWPAPLSSAVLLQEKKNRKQNFFGISVQSELDKMPSSNAIDFTQSLDHLAINSSQNHQKNLLEVIQTSPKHRNSC----KVNC-------DVISASRSPSASTEPMTKPRFSDHTDKSRSRDSTYFNDPNRHFGYSLDFISFTNRSF 452          

HSP 3 Score: 70.8626 bits (172), Expect = 1.563e-12
Identity = 37/82 (45.12%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 1573 SAIPSRESDSFIAS-------AIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            S I S E+ SF +         I YS L   + + L+ LD  +LETYL  +EF +LF L R  FY+LPEWK+NDLK++++LF
Sbjct:  582 SKIESLETWSFWSHKPSIKPPIISYSDLVSKDPKILRSLDAHKLETYLSSEEFLRLFKLNRSEFYRLPEWKQNDLKRRINLF 663          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 127.487 bits (319), Expect = 2.734e-30
Identity = 53/136 (38.97%), Postives = 81/136 (59.56%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            MGK+ C  C +KCKGDVLK+ +K+ HK CF C  C K L+  GFF +D  ++C EDY+K     C  C++   GEVVT L  TFH  CF+C  C   F  GD+ ++ +  +LC  C+ +  ++E +   + ++ ++
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI 136          

HSP 2 Score: 76.6406 bits (187), Expect = 2.939e-14
Identity = 55/188 (29.26%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  895 DQIKKLSSYPSG-HVEENQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKAR--SASQSGDIRANE-TPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPK---------DPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTSDSA 1419
            +++K+L+ YP G   + +  P I+R D+P+PP++SV L +  + K        +S G      ++   +A++ GD   +E   SR    E+  +   +   Y  + +  +++ +  +         DPISASRSP A  EP   PRYD H  TSPSR++ +  +   HL Y + + N+  R+ T   A
Sbjct:  332 EEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGA 519          

HSP 3 Score: 76.2554 bits (186), Expect = 4.189e-14
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
Query: 1588 RESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            R  +   A   PY +L+I+N    K +DR RLE +L D +F+ +F ++R AF +LPEWKRNDLK++VDL+
Sbjct:  684 RTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 753          
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Match: SMESG000080177.1 (SMESG000080177.1)

HSP 1 Score: 127.102 bits (318), Expect = 3.111e-30
Identity = 53/136 (38.97%), Postives = 81/136 (59.56%), Query Frame = 1
Query:   61 MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDESFYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIPGDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAV 468
            MGK+ C  C +KCKGDVLK+ +K+ HK CF C  C K L+  GFF +D  ++C EDY+K     C  C++   GEVVT L  TFH  CF+C  C   F  GD+ ++ +  +LC  C+ +  ++E +   + ++ ++
Sbjct:    1 MGKIQCEICRKKCKGDVLKLDQKFIHKGCFNCYKCNKNLEKGGFFCRDNRYFCSEDYQKLYGVKCGFCNKYADGEVVTILGGTFHIQCFQCQNCNSPFCCGDKATLWDGKYLCHRCASVKQEKENIVPPLSSQKSI 136          

HSP 2 Score: 77.0258 bits (188), Expect = 2.429e-14
Identity = 55/188 (29.26%), Postives = 94/188 (50.00%), Query Frame = 1
Query:  895 DQIKKLSSYPSG-HVEENQEPSIERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKAR--SASQSGDIRANE-TPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPK---------DPISASRSPSAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTSDSA 1419
            +++K+L+ YP G   + +  P I+R D+P+PP++SV L +  + K        +S G      ++   +A++ GD   +E   SR    E+  +   +   Y  + +  +++ +  +         DPISASRSP A  EP   PRYD H  TSPSR++ +  +   HL Y + + N+  R+ T   A
Sbjct:  332 EEVKRLAHYPDGKRPDPDSAPPIDRYDFPAPPSLSVVLQDMKKEKEYKKQRSIVSTGDIFYDTQSGIDTAAELGDFPESEDEKSRKKKVELTLKVLRETGKYSGLSQTVLDQLENNENRLRNENYFDPISASRSPDASMEPSQKPRYDRHTFTSPSRDNRYEGRPAHHLSYRVQYSNTGGRTGTLPGA 519          

HSP 3 Score: 76.2554 bits (186), Expect = 4.188e-14
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
Query: 1588 RESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEFQQLFNLTRQAFYQLPEWKRNDLKKQVDLF 1797
            R  +   A   PY +L+I+N    K +DR RLE +L D +F+ +F ++R AF +LPEWKRNDLK++VDL+
Sbjct:  665 RTKEKIPAETFPYEKLKINNFSLPKGMDRSRLEDHLTDNDFELVFQMSRSAFSRLPEWKRNDLKRKVDLY 734          
The following BLAST results are available for this feature:
BLAST of Actin-binding LIM protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABLIM12.570e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM12.581e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM12.786e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
ABLIM22.825e-2745.61actin binding LIM protein family member 2 [Source:... [more]
ABLIM12.988e-2743.86actin binding LIM protein 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-1151.261e-1424.69pep chromosome:WBcel235:X:10147492:10153085:1 gene... [more]
unc-1151.267e-1424.69pep chromosome:WBcel235:X:10146889:10153142:1 gene... [more]
ceh-142.506e-1129.22Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
lim-71.252e-1028.93CeLIM-7; LIM domain family [Source:UniProtKB/TrEM... [more]
pxl-11.413e-1035.48Paxillin homolog 1 [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc-115a1.417e-2739.37gene:FBgn0051352 transcript:FBtr0300565[more]
Unc-115b1.442e-2739.37gene:FBgn0260463 transcript:FBtr0082097[more]
Unc-115b8.756e-2741.23gene:FBgn0260463 transcript:FBtr0082094[more]
Unc-115b9.006e-2741.23gene:FBgn0260463 transcript:FBtr0346713[more]
Unc-115a9.761e-2741.23gene:FBgn0051352 transcript:FBtr0346714[more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim31.839e-2643.97actin binding LIM protein family, member 3 [Source... [more]
ablim31.931e-2643.97actin binding LIM protein family, member 3 [Source... [more]
ablim31.976e-2643.97actin binding LIM protein family, member 3 [Source... [more]
ablim32.043e-2643.97actin binding LIM protein family, member 3 [Source... [more]
ablim32.097e-2643.97actin binding LIM protein family, member 3 [Source... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uck24.150e-2640.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck24.184e-2640.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck27.951e-2640.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck21.197e-2540.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
uck21.752e-2540.52uridine-cytidine kinase 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ablim11.032e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim11.637e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim12.563e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim12.629e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
Ablim12.653e-2743.86actin-binding LIM protein 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Actin-binding LIM protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K4G5|ABLM1_MOUSE7.031e-2743.86Actin-binding LIM protein 1 OS=Mus musculus OX=100... [more]
sp|Q6H8Q1|ABLM2_HUMAN1.357e-2645.61Actin-binding LIM protein 2 OS=Homo sapiens OX=960... [more]
sp|O14639|ABLM1_HUMAN1.833e-2643.86Actin-binding LIM protein 1 OS=Homo sapiens OX=960... [more]
sp|Q8BL65|ABLM2_MOUSE1.866e-2545.61Actin-binding LIM protein 2 OS=Mus musculus OX=100... [more]
sp|O94929|ABLM3_HUMAN1.438e-2440.35Actin-binding LIM protein 3 OS=Homo sapiens OX=960... [more]
back to top
BLAST of Actin-binding LIM protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RUC42.652e-3654.31Actin-binding LIM protein 1 OS=Fasciola hepatica O... [more]
A0A504YZZ82.980e-3651.59Actin-binding LIM protein 1 (Fragment) OS=Fasciola... [more]
A0A2H1CDK43.038e-3554.31LIM domain protein OS=Fasciola hepatica OX=6192 GN... [more]
A0A5J4P3L71.337e-3450.42Actin-binding LIM protein OS=Paragonimus westerman... [more]
A0A5K4F8072.779e-3455.17Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim1a4.157e-2742.03actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSAMXT00000017735.24.449e-2643.86pep primary_assembly:Astyanax_mexicanus-2.0:14:159... [more]
ablim1b9.331e-2641.59actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b9.959e-2641.59actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
ablim1b1.770e-2541.59actin binding LIM protein 1b [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim1a9.649e-2540.71actin binding LIM protein 1a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000006267.11.936e-2441.23pep scaffold:Pmarinus_7.0:GL478686:5064:37345:-1 g... [more]
ENSPMAT00000007081.11.243e-1437.63pep scaffold:Pmarinus_7.0:GL476780:360940:430661:-... [more]
lmo23.993e-1132.04LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
lmo28.124e-1132.04LIM domain only 2 (rhombotin-like 1) [Source:NCBI ... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LRG18.073e-631.71GTPase-activating protein (GAP); contains Rho1p-sp... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432011.548e-1730.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441831.043e-1134.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411001.452e-1137.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378721.319e-1029.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LDB33.430e-1036.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-binding LIM protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ablim32.994e-2543.10actin binding LIM protein family member 3 [Source:... [more]
ablim33.678e-2543.10actin binding LIM protein family member 3 [Source:... [more]
ablim33.736e-2543.10actin binding LIM protein family member 3 [Source:... [more]
ablim33.887e-2543.10actin binding LIM protein family member 3 [Source:... [more]
ablim35.342e-2543.10actin binding LIM protein family member 3 [Source:... [more]
back to top
BLAST of Actin-binding LIM protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019042.10.000e+099.48SMESG000019042.1[more]
SMESG000037349.13.552e-3552.59SMESG000037349.1[more]
SMESG000037349.13.711e-3552.59SMESG000037349.1[more]
SMESG000080177.12.734e-3038.97SMESG000080177.1[more]
SMESG000080177.13.111e-3038.97SMESG000080177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033251 ID=SMED30033251|Name=Actin-binding LIM protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1949bp
TGATATTTTAAGTTAAAGTTGTCAATGACTTTTTGAATAAGTCTTCGAAA
TAATTTTTTTATGGGTAAAGTTACTTGTTTTCACTGTACCAGAAAATGTA
AAGGGGATGTTTTGAAAGTTGGGGAGAAATACTTCCATAAAGAATGTTTT
ACATGCAAAATTTGCCAGAAGAAATTGGACGACACTGGATTCTTCTCGAA
GGATGAAAGTTTCTATTGCCCAGAAGATTATAAAAAATACTGTGCTGCTG
TTTGTTTTTCTTGTCATGAGAAAATTATCGGGGAGGTCGTAACAGCTCTC
AATCACACTTTTCATAAAGACTGCTTCAAATGTTCTGTTTGCCAAAAAAA
ATTTATTCCTGGCGATCGTGTATCTATGAAAAATTCGAATTTTCTCTGTG
GCGATTGTTCCGGTATTTCTATAGACCAGGAGAAGGTGGAGAAAAAAGTA
GTGAATGAAACAGCAGTACCAAATCAAAACAGCAAGCCAACATTAAATGG
AAAGTCAAATGCTTATCATAATCAAGTGGATTCTTCTAGTCAAGTCAAAG
ATTCTGATAGCTATTCGGTGCCAATCAGAAGAAAAGTTGTGTCAAATAGA
TCCACAGTGAACCATCAACCTTTATCAAATAGTTTAAATAGACCGATTTC
TTCACAAAGCTCCAAGTTGCGACCCATTTCAAGAGAAAACAGTAACACGG
ATCCAGATCACGGACCAGGAAGTTCATTTACAACTCCTAGACATTTTCAT
ATTCCACAAGGCAACAATAGATACTGGATGTACAATTCTATGGTTGTAGG
GTCAAAGAATCACCCCCTTGCATTAAGTGCTTGTAACATCAACAAATTGT
CGAGCTCATCTCAAAGAGTCAGTGACAATGATTCCTTGCACAAAGATCAA
ATAAAAAAATTATCAAGCTATCCATCGGGACATGTGGAGGAGAATCAAGA
ACCCTCTATTGAAAGAAATGACTGGCCAAGTCCACCAGCAGTGTCCGTTT
ATTTAACAGAGAGAATTCGACGTAAAGCACAAAATCCAACTGTTGAGGCC
TTGTCAGCAGGAACGACACCGAAAATCCGAAAAGCCAGGTCAGCTTCTCA
AAGTGGAGATATACGTGCAAACGAAACGCCTTCCAGAATGGGAATAGCTG
AAGTTTTAAAACGGTCAACAACAGACTGCTCTTCTTATGACCATATAGAC
AGAGTAAATGTGGAAGAAACTGATATACCTAAAGATCCTATATCGGCATC
TAGATCTCCAAGTGCTGTTTGTGAACCACTTGTTCCACCTCGTTACGATT
TACATATGGAAACATCACCGTCTAGAAACGATGACTTCATCAAGCAAAGC
GAAAGACATTTAGGTTATTCCATGGACTTTGTCAACTCCACTAGTAGATC
TTTTACTTCTGATAGTGCAATGCCAAAATATCGTAAAAGTCTTAGAAACT
CATACGTCGAGCTCCGACAATCAAGTAACGGGAACCTCAACGGACCTCCA
CTCACCAAAATGGATAATGGCACTCTGCCTAGAAATAATTTCCCATCTAA
TAATGATAAAAATCTATATTACAGTGCAATACCATCAAGGGAATCAGATT
CTTTTATTGCTTCTGCCATTCCATATAGCCAGCTGAGAATTTCAAATAGA
AGATTTTTAAAGCATCTTGACCGATTTCGATTGGAAACTTATCTTGGTGA
CCAAGAGTTTCAACAATTGTTTAATTTAACTCGGCAAGCCTTTTATCAGT
TGCCGGAATGGAAACGAAACGATCTCAAAAAACAAGTTGATCTTTTTTAA
CTCAATTTTCTACCGCATCAATGTGCAATTTTTTTGACTAATTGTTTGAA
GGATCAAGGTTTTCTTTGCATTGTTATGTTTTCTGTCATTTTCATCTGCT
GCTTCACTTAGATTTATATGTAATTTTTTTTCAACAGTATTTTCATTGG
back to top

protein sequence of SMED30033251-orf-1

>SMED30033251-orf-1 ID=SMED30033251-orf-1|Name=SMED30033251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=580bp
MGKVTCFHCTRKCKGDVLKVGEKYFHKECFTCKICQKKLDDTGFFSKDES
FYCPEDYKKYCAAVCFSCHEKIIGEVVTALNHTFHKDCFKCSVCQKKFIP
GDRVSMKNSNFLCGDCSGISIDQEKVEKKVVNETAVPNQNSKPTLNGKSN
AYHNQVDSSSQVKDSDSYSVPIRRKVVSNRSTVNHQPLSNSLNRPISSQS
SKLRPISRENSNTDPDHGPGSSFTTPRHFHIPQGNNRYWMYNSMVVGSKN
HPLALSACNINKLSSSSQRVSDNDSLHKDQIKKLSSYPSGHVEENQEPSI
ERNDWPSPPAVSVYLTERIRRKAQNPTVEALSAGTTPKIRKARSASQSGD
IRANETPSRMGIAEVLKRSTTDCSSYDHIDRVNVEETDIPKDPISASRSP
SAVCEPLVPPRYDLHMETSPSRNDDFIKQSERHLGYSMDFVNSTSRSFTS
DSAMPKYRKSLRNSYVELRQSSNGNLNGPPLTKMDNGTLPRNNFPSNNDK
NLYYSAIPSRESDSFIASAIPYSQLRISNRRFLKHLDRFRLETYLGDQEF
QQLFNLTRQAFYQLPEWKRNDLKKQVDLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003779actin binding
GO:0008270zinc ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036886Villin_headpiece_dom_sf
IPR003128Villin_headpiece
IPR001781Znf_LIM
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003128Villin headpieceSMARTSM00153VHP_1coord: 544..579
e-value: 3.1E-14
score: 63.3
IPR003128Villin headpiecePFAMPF02209VHPcoord: 544..579
e-value: 9.9E-15
score: 54.3
IPR003128Villin headpiecePROSITEPS51089HPcoord: 514..579
score: 18.213
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 64..116
e-value: 1.5E-14
score: 64.3
coord: 5..56
e-value: 4.2E-13
score: 59.5
IPR001781Zinc finger, LIM-typePFAMPF00412LIMcoord: 65..117
e-value: 3.7E-11
score: 43.1
coord: 6..58
e-value: 7.0E-10
score: 39.0
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 6..39
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 65..98
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 4..63
score: 12.068
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 64..123
score: 9.138
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 59..169
e-value: 4.4E-15
score: 58.0
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 2..58
e-value: 1.0E-12
score: 49.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..305
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 337..356
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 133..227
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 339..354
NoneNo IPR availablePANTHERPTHR24213FAMILY NOT NAMEDcoord: 3..118
coord: 165..579
NoneNo IPR availableCDDcd09327LIM1_abLIMcoord: 6..57
e-value: 1.65884E-22
score: 88.4671
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 32..94
IPR036886Villin headpiece domain superfamilyGENE3DG3DSA:1.10.950.10coord: 517..579
e-value: 2.6E-20
score: 74.0
IPR036886Villin headpiece domain superfamilySUPERFAMILYSSF47050VHP, Villin headpiece domaincoord: 513..579