Innexin

Overview
NameInnexin
Smed IDSMED30033245
Length (bp)1843
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30033245) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30033245) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30033245) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30033245) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033245

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
renal systemSMED30033245SMESG000061679.1 AY068260smed_ncbi_20200123PMID:17670787
Oviedo et al., 2007
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30033245SMESG000061679.1 dd_Smed_v4_8390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30033245SMESG000061679.1 dd_Smed_v4_8390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30033245SMESG000061679.1 dd_Smed_v4_8390_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033245SMESG000061679.1 Contig39599newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033245SMESG000061679.1 Contig39599uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30033245SMESG000061679.1 dd_Smed_v6_8390_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30033245SMESG000061679.1 SMED30033245smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30033245SMESG000061679.1 SMED30033245smed_20140614PMID:24523458
Lin et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30033245SMESG000061679.1 dd_Smed_v6_8390_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
proximal tubuleSMED30033245SMESG000061679.1 SMED30033245smed_20140614PMID:21828097
Rink et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
proximal tubuleSMED30033245SMESG000061679.1 SMED30033245smed_20140614PMID:21828097
Rink et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 192.971 bits (489), Expect = 1.916e-55
Identity = 133/383 (34.73%), Postives = 222/383 (57.96%), Query Frame = 2
Query:  371 YATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIY 1513
            +A+  K   F   +D  DKL++  +T+I+ +  ++++ K Y+   I C++P   + +  + + ++YCWV  T  +P+   +P +    E      +I YYQWVPFVLAL+ +LFY+P I+W+++++  SG  ++ LV+MA  +     ++++  +  IA N+E  L  H K  + S    ++L      +C+ + SG  +   Y+ +K+LY +N  GQ+FL+  FL  G++   +G  VL +++ GREW ++  FPRVT C  + ++ +   + +  QCVL INM NEKI++FLWFW  ++   T  SLF WIY     S Q++F+ K+L   E Y   D   L+ F   FLR+DGVF+LRM + +AG+L   ++   LWN Y
Sbjct:    8 FASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN----RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEAL--HVKHQVMSG---NRLKLLNLIICT-RSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 192.586 bits (488), Expect = 4.260e-55
Identity = 126/372 (33.87%), Postives = 213/372 (57.26%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLEN-LLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDE---DCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWN 1507
            +DF DKL++  +T+IL    L+++ K Y+   I C++P   +    + + ++YCWV  T  +P++ ++P +I S        +I YYQWVPF+LA++ +LFY+P I+W+ + Y  SG +L+GLV+MA  A     + K+ TV  +A ++++ +  ++     HS+   S L    +     +  G  +   Y+ IKVLY  N   Q FL+ + L  G    ++G+ +LK+++   EW  T +FPRVT C  + ++ +   + +  QCVL INM NEKI++FLWFW +     T  +   WI  +   S  + F++K+LR+   +  +   D   L+ F   FLRKDGVF+LRM S +AG+L++++++  LW 
Sbjct:   19 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSRRN----RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 379          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 191.815 bits (486), Expect = 5.691e-55
Identity = 130/388 (33.51%), Postives = 215/388 (55.41%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNR-INYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYC-----YLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKS 1549
            +DF DKL++  +++I+    ++++ K Y+   I C++P   +   ++ + ++YCWV  T  +P+    P      E  D   R I+YYQWVPFVLAL+ + FY+P I+W+ + +  SG +++ L +MA  A      A++ TV  IA ++E+ L   R++            T  S +C  KR    +   Y+FIK+LY+ N   Q+F++  FL  G     +G+ +L+++L GREW  +  FPRVT C      L N+ H      +  QCVL INM NEKI++FLWFW  +V F + +S+F WI         + F++K+LR  +  TD     +K F   FL  DGVF +RM S +AGD++  +++  LW+ + ++ ++  F+ +
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPL-----EYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREV------------TDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL--GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH------HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNST 378          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 191.815 bits (486), Expect = 5.691e-55
Identity = 130/388 (33.51%), Postives = 215/388 (55.41%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNR-INYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYC-----YLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKS 1549
            +DF DKL++  +++I+    ++++ K Y+   I C++P   +   ++ + ++YCWV  T  +P+    P      E  D   R I+YYQWVPFVLAL+ + FY+P I+W+ + +  SG +++ L +MA  A      A++ TV  IA ++E+ L   R++            T  S +C  KR    +   Y+FIK+LY+ N   Q+F++  FL  G     +G+ +L+++L GREW  +  FPRVT C      L N+ H      +  QCVL INM NEKI++FLWFW  +V F + +S+F WI         + F++K+LR  +  TD     +K F   FL  DGVF +RM S +AGD++  +++  LW+ + ++ ++  F+ +
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPL-----EYGDRRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREV------------TDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL--GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH------HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATDRQS--VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNST 378          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 193.356 bits (490), Expect = 8.392e-55
Identity = 127/371 (34.23%), Postives = 213/371 (57.41%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDE---DCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWN 1507
            +DF DKL++  +T+IL    L+++ K Y+   I C++P   +    + + ++YCWV  T  +P++ ++P +I S        +I YYQWVPF+LA++ +LFY+P I+W+ + Y  SG +L+GLV+MA  A     + K+ TV  +A ++++ L +  +   HS+   S L    +     +  G  +   Y+ IKVLY  N   Q FL+ + L  G    ++G+ +LK+++   EW  T +FPRVT C  + ++ +   + +  QCVL INM NEKI++FLWFW +     T  +   WI  +   S  + F++K+LR+   +  +   D   L+ F   FLRKDGVF+LRM S +AG+L++++++  LW 
Sbjct:   80 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSRRN----RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQG-HSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 438          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 78.1814 bits (191), Expect = 3.129e-15
Identity = 73/264 (27.65%), Postives = 111/264 (42.05%), Query Frame = 2
Query:  485 KSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP---------PDIESW-EKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLK-NILEGREWNDTM--IFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIY 1237
            + Y+   I C +   P G      + +YCW++ T  +   L          P + S  E  DE     YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV   NS             D+   + + +L  +   NL+                         A ++   + L  +N  GQ++ + +FLD   + +++G  VLK   LE  E  D M  +FP+VT C             +   CVLP+N++NEKIY
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN---------DECKNDRKKILVDYFIGNLNRHNFY--------------------AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIY 268          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 78.1814 bits (191), Expect = 3.129e-15
Identity = 73/264 (27.65%), Postives = 111/264 (42.05%), Query Frame = 2
Query:  485 KSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP---------PDIESW-EKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLK-NILEGREWNDTM--IFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIY 1237
            + Y+   I C +   P G      + +YCW++ T  +   L          P + S  E  DE     YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV   NS             D+   + + +L  +   NL+                         A ++   + L  +N  GQ++ + +FLD   + +++G  VLK   LE  E  D M  +FP+VT C             +   CVLP+N++NEKIY
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN---------DECKNDRKKILVDYFIGNLNRHNFY--------------------AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIY 268          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 78.1814 bits (191), Expect = 3.129e-15
Identity = 73/264 (27.65%), Postives = 111/264 (42.05%), Query Frame = 2
Query:  485 KSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP---------PDIESW-EKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLK-NILEGREWNDTM--IFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIY 1237
            + Y+   I C +   P G      + +YCW++ T  +   L          P + S  E  DE     YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV   NS             D+   + + +L  +   NL+                         A ++   + L  +N  GQ++ + +FLD   + +++G  VLK   LE  E  D M  +FP+VT C             +   CVLP+N++NEKIY
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN---------DECKNDRKKILVDYFIGNLNRHNFY--------------------AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIY 268          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 78.1814 bits (191), Expect = 3.129e-15
Identity = 73/264 (27.65%), Postives = 111/264 (42.05%), Query Frame = 2
Query:  485 KSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLP---------PDIESW-EKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLK-NILEGREWNDTM--IFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIY 1237
            + Y+   I C +   P G      + +YCW++ T  +   L          P + S  E  DE     YYQWV FVL  Q ILFY+PR +W+    +  G  L+ LV   NS             D+   + + +L  +   NL+                         A ++   + L  +N  GQ++ + +FLD   + +++G  VLK   LE  E  D M  +FP+VT C             +   CVLP+N++NEKIY
Sbjct:   45 RQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLNSPIVN---------DECKNDRKKILVDYFIGNLNRHNFY--------------------AFRFFVCEALNFVNVIGQIYFVDFFLD--GEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIY 268          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0309369)

HSP 1 Score: 72.0182 bits (175), Expect = 3.827e-13
Identity = 67/246 (27.24%), Postives = 102/246 (41.46%), Query Frame = 2
Query:  548 DDFLKSYCWVHGTIPI--------KGNLP-PDIESWEKMDEFN--RINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTM-----IFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIY 1237
            +D L +YCW+H T  +           +P P + + +           YYQWV F L  Q ILFY PR +W+                     S + GK     +  + M+L+  + S  +          K      +L  + R     A +Y   ++L +IN  GQ+FLM  F D   +  +FG  V+  +   +E  D M     IFPR+T C             + A C+LP+N++NEKIY
Sbjct:   66 EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK---------------------SWEGGK-----IHALIMDLDIGICSEAEK-------KQKKKLLLDYLWENLRYHNWWAYRYYVCELLALINVIGQMFLMNRFFD--GEFITFGLKVIDYMETDQE--DRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIY 274          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.437e-54
Identity = 133/383 (34.73%), Postives = 222/383 (57.96%), Query Frame = 2
Query:  371 YATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIY 1513
            +A+  K   F   +D  DKL++  +T+I+ +  ++++ K Y+   I C++P   + +  + + ++YCWV  T  +P+   +P +    E      +I YYQWVPFVLAL+ +LFY+P I+W+++++  SG  ++ LV+MA  +     ++++  +  IA N+E  L  H K  + S    ++L      +C+ + SG  +   Y+ +K+LY +N  GQ+FL+  FL  G++   +G  VL +++ GREW ++  FPRVT C  + ++ +   + +  QCVL INM NEKI++FLWFW  ++   T  SLF WIY     S Q++F+ K+L   E Y   D   L+ F   FLR+DGVF+LRM + +AG+L   ++   LWN Y
Sbjct:    8 FASAVKSIQFHVDDDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFT-EPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN----RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEAL--HVKHQVMSG---NRLKLLNLIICT-RSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL--GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 2.245e-52
Identity = 126/372 (33.87%), Postives = 213/372 (57.26%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLEN-LLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDE---DCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWN 1507
            +DF DKL++  +T+IL    L+++ K Y+   I C++P   +    + + ++YCWV  T  +P++ ++P +I S        +I YYQWVPF+LA++ +LFY+P I+W+ + Y  SG +L+GLV+MA  A     + K+ TV  +A ++++ +  ++     HS+   S L    +     +  G  +   Y+ IKVLY  N   Q FL+ + L  G    ++G+ +LK+++   EW  T +FPRVT C  + ++ +   + +  QCVL INM NEKI++FLWFW +     T  +   WI  +   S  + F++K+LR+   +  +   D   L+ F   FLRKDGVF+LRM S +AG+L++++++  LW 
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSRRN----RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQ 499          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 170.629 bits (431), Expect = 1.622e-45
Identity = 127/401 (31.67%), Postives = 214/401 (53.37%), Query Frame = 2
Query:  404 GMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKA-KSETVDQIAMN-LENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIRE-------QYTDEDCSV-------------LKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE 1534
            G +D  D+L++  +  IL +  LVI+ K Y  T I C++  H S +  +++++SYCW+  T  IP+  N+P D  + E+     +I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+  A  A      + + + V+ I  N ++NL        + ++  ++++  ++        SG+ ++  Y F K+LY +N   Q F++   L    +   FG+ VL +I  GR W +T  FPRVT C  + ++++A  N Y  QC L IN++NEK++ FLW W +I+   T  S   WI      S +V ++ KF++I E       Q  ++D +V             L SF   FL+ DG+ +LRM S +AGD+I   +V  LW  Y+E++  E
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIKFSRF------LSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWRE 405          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 7.893e-43
Identity = 121/406 (29.80%), Postives = 221/406 (54.43%), Query Frame = 2
Query:  410 EDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKE--KHKEE----NFSKSGVPGDETHYSDASTLPLK 1603
            +D  D+LS+  + ++L   +++++ K Y+ ++I C++P+   G  ++ + + YC++  T  IP +  +P D+E  +K +    I YYQWVP VLA+Q  +FYLP  IW  + Y   G D   ++  A +  +Q  + +++ V+++   + ++L +  K N + +    +           K  G   +  Y+ IK++Y+ N F Q  ++  FL  G++   +G+    ++  GREW D+ +FPRVT C   +++ +A  + Y  QCVL INM NEKIY+F+WFW V V+  TFI+    IYRL+  SS+ ++++  L        ++ +++ SF    L++DGV ++R    +AG ++T +I   L+  + E  +H  +    + +KS  PG E  + +    P K
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSK-NEYGRFYCYRFG---------KGLGSMTSMLYICIKLMYLANVFVQFIILNKFL--GNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDF-SVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQHNRDFHHGHSTKSTSPGLEEGHHEHLYTPEK 407          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 1.199e-42
Identity = 124/401 (30.92%), Postives = 212/401 (52.87%), Query Frame = 2
Query:  404 GMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGT--IPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMA-NSASNQTGKAKSETVDQIAMN-LENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIRE-------QYTDEDCSV-------------LKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE 1534
            G +D  D+L++  +  IL +  LVI+ K Y  T I C++  H S +  +++++SYCW+  T  IP+  N+P D  + E+     +I YYQWVPF+L  + ++F LP I W++ ++  SG +++ L+  A +  +      + + V+ I  N ++NL        + ++  ++++  ++        SG+ L+  + F K+LY +N   Q  ++   L        FG+ VL +I  GR W +T  FPRVT C  + ++++A  N Y  QC L IN++NEK++ FLW W +I+   T  S   WI      S +V ++ KF++I E       Q  ++D +V             L +F   FL+ DGV +LRM S +AGD+I   +V  LW  ++E++  E
Sbjct:   35 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNPH-SRESMEEYIESYCWIQNTYWIPMYENVPDDHTAREE----KQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQ-SGLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRF------LSGQCLSILHSFTKLLYSMNVVAQFLILNACLK-SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFE-VRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWRE 421          
BLAST of Innexin vs. TrEMBL
Match: W6UMB0 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 387.882 bits (995), Expect = 3.593e-125
Identity = 209/401 (52.12%), Postives = 278/401 (69.33%), Query Frame = 2
Query:  344 KMVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAK--SWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE 1534
            KMV  EFIDY TK   +DF+G+EDFADK+SF  S  ILLL T +I VK YLL SIACYIP  PSGKDF+ FL+++CWVHGTIPI    ++P +   W   DE  RINYYQWVPF+L LQ ILFY+PR++WQ+I YN +GTDLE L+ +AN ASN     +   V  +A  +  +LF HR      K   ++    K      + KR G  L   Y+FIK +Y+ NA GQL+LMQ FL F    ++FGY V + ++ GR+W++T IFPRV++CYL++++H+   N Y+AQCVLP+NMLNEK+YIFLWFWT IV   T +S+  WI RL +  ++VHF+KKFLR+++ YT E   +L++F   FLR DGVF+LRM S+NAGD++TAD+V  +W+IYK K+K  
Sbjct:   60 KMVGIEFIDYLTKLHVSDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFEKFLQNFCWVHGTIPILEGEHIPQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYR-RGKVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRLQDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNR 459          
BLAST of Innexin vs. TrEMBL
Match: A0A068Y4N3 (Innexin OS=Echinococcus multilocularis OX=6211 GN=inx PE=3 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 2.103e-124
Identity = 208/400 (52.00%), Postives = 277/400 (69.25%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAK--SWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE 1534
            MV  EFIDY TK   +DF+G+EDFADK+SF  S  ILLL T +I VK YLL SIACYIP  PSGKDF+ FL+++CWVHGTIPI    ++P +   W   DE  RINYYQWVPF+L LQ ILFY+PR++WQ+I YN +GTDLE L+ +AN ASN     +   V  +A  +  +LF HR      K   ++    K      + KR G  L   Y+FIK +Y+ NA GQL+LMQ FL F    ++FGY V + ++ GR+W++T IFPRV++CYL++++H+   N Y+AQCVLP+NMLNEK+YIFLWFWT IV   T +S+  WI RL +  ++VHF+KKFLR+++ YT E   +L++F   FLR DGVF+LRM S+NAGD++TAD+V  +W+IYK K+K  
Sbjct:    1 MVGIEFIDYLTKLHVSDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFEKFLQNFCWVHGTIPILEGEHIPQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYR-RGKVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRLQDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNR 399          
BLAST of Innexin vs. TrEMBL
Match: A0A068WGF5 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 385.185 bits (988), Expect = 2.695e-124
Identity = 208/398 (52.26%), Postives = 277/398 (69.60%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAK--SWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHK 1528
            MV  EFIDY TK   +DF+G+EDFADK+SF  S  ILLL T +I VK YLL SIACYIP  PSGKDF+ FL+++CWVHGTIPI    ++P +   W   DE  RINYYQWVPF+L LQ ILFY+PR++WQ+I YN +GTDLE L+ +AN ASN     +   V  +A  +  +LF HR      K   ++    K      + KR G  L   Y+FIK +Y+ NA GQL+LMQ FL F    ++FGY V + ++ GR+W++T IFPRV++CYL++++H+   N Y+AQCVLP+NMLNEK+YIFLWFWT IV   T +S+  WI RL +  ++VHF+KKFLR+++ YT E   +L++F   FLR DGVF+LRM S+NAGD++TAD+V  +W+IYK K+K
Sbjct:    1 MVGIEFIDYLTKLHVSDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFEKFLQNFCWVHGTIPILEGEHIPQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYR-RGKVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRLQDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYK 397          
BLAST of Innexin vs. TrEMBL
Match: A0A564YPR7 (Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 1.325e-123
Identity = 206/399 (51.63%), Postives = 275/399 (68.92%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINL-HSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEE 1534
            MV  EFIDY TK +  DF+G+EDFADK+SF  S  ILLL T +I VK YLL SIACYIP  PSGKDFD FL+++CWVHGTIP+    ++P +   W++ D+  RINYYQWVPF+L LQ ILFY+PR+IWQ+I YN +GTDLE L+ +AN ASN     +   V  +A  +  +LF HR   +        K         + KR G  L   Y+FIK +Y+ NA GQL+LMQ FL F    T+FGY V K ++ G++W++T IFPRV++CY+++++H+   N Y+AQCVLP+NMLNEK+YIFLWFWT IV F T +S+  WI RL +  ++ HF+KKFLR++E Y  +D  +L +F   FLR DGVF+LRM S+NAGD++TAD++  +W+IYK K K  
Sbjct:    1 MVGVEFIDYLTKLRVNDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFDKFLQNFCWVHGTIPLLEGEHIPQNFSEWDEADKNLRINYYQWVPFMLGLQCILFYIPRVIWQIICYNRTGTDLENLISIANKASNTIEGDRQSLVKHVAGTMAEMLFQHRDYRVGRVADARRKAFKFCGVFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMTNFGYEVAKYMINGKDWDETRIFPRVSFCYVEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAFCTAVSIPLWIMRLGRQKNKEHFIKKFLRLQEIYNTKDREILHNFTSDFLRHDGVFLLRMISMNAGDVVTADVIVKMWDIYKTKFKNR 399          
BLAST of Innexin vs. TrEMBL
Match: A0A183SWW7 (Innexin OS=Schistocephalus solidus OX=70667 GN=inx PE=3 SV=1)

HSP 1 Score: 395.586 bits (1015), Expect = 2.791e-123
Identity = 208/397 (52.39%), Postives = 282/397 (71.03%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLS-TAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHK 1528
            MV  EFIDY  K + ++F+G+EDFADK+SF  S  ILLL T +I VK YLL+SI+CYIP  PSG DFD FL++YCWVHGTIP+     +P   E W  +D  +RINYYQWVPF+L LQ ILFY+PR++WQ+I YN +GTDLE LV +ANSASN     +   V  +A  LE +LF HR+ ++       + + T      + KR G  L   Y+ IK++Y+ NA GQL+LMQ FL F    +SFGYV+   ++EGR+W++T IFPRV++CYL++++H+   N Y+AQCVLP+NMLNEK+YIFLWFWT++V   T +S+  WI R+    ++ HF+KKFLR++E YTDED  +L +F   FLR DG+F+LRM S+NAGD++T+D+V  LWNIY+ K+K
Sbjct:    1 MVGVEFIDYLKKLQVSEFLGVEDFADKMSFMYSVVILLLCTTIIAVKQYLLSSISCYIPTTPSGSDFDKFLENYCWVHGTIPLLAGDQIPQKYEDWHMLDMNHRINYYQWVPFMLGLQTILFYMPRVVWQIICYNRTGTDLEHLVTVANSASNAVEGERKGLVKHVACTLEEMLFQHREYSVGKVATARRRAFTMCGMFVASKRLGTWLIFTYIAIKLVYLANAIGQLYLMQSFLGFNSSMSSFGYVLASYMVEGRDWDETRIFPRVSFCYLEHVRHLGTTNKYVAQCVLPVNMLNEKLYIFLWFWTLLVAICTALSIPLWILRMGLEKNRSHFVKKFLRLQEIYTDEDREILHNFICDFLRHDGIFLLRMISMNAGDVVTSDVVAALWNIYRTKYK 397          

HSP 2 Score: 243.817 bits (621), Expect = 1.550e-66
Identity = 154/436 (35.32%), Postives = 243/436 (55.73%), Query Frame = 2
Query:  368 DYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRIN-------------------------------YYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSET-VDQIAMNLENLLFSHRKINLHSKPIMSK-LSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNN-YLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRI--------------REQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKH 1525
            D +  Y+    VG++D+AD+LSF+ ST IL++ T +++ K+Y+L  +AC++P  P+G +F D++ SYCWVHGT+PI  N  +P D  SW+ +    ++                                YYQWVPFVL LQ ILFY+P +IWQ +T+N  GTDL  ++  A  A   T   K E  +  +A  LE LLF+HR         + + +S     L + KR G      Y+ IK+LY+ NA GQL+LM+ FL +    T F   + +++++G +W +++ FPRV +C +K ++H+   +N +L  C L +NMLNEKIYIFLW+WT++V   T +S+  W  RLT    +   ++K+L++               +    +D   +  F + FLR DGVFI+ M ++NAGD++T +++  LW  +  K+
Sbjct:  430 DKSALYQAIALVGVQDWADRLSFAHSTVILIICTAIVSAKTYILKPLACHVPTVPTGSNFKDYMASYCWVHGTVPIGINETIPEDETSWDALSAERKMGVSLSFMLLQIPQWMCIPYPFFLLTQSRFLAAYYQWVPFVLGLQTILFYVPHVIWQNVTFNRLGTDLTAIISKAMDALKTTAPEKREQKIANVAERLELLLFAHRDYRRGKMAAVGRQVSDTCGLLLASKRLGTWTVFSYLCIKLLYLANAIGQLYLMKEFLGYSESMTGFMIQLTQSLIQGSDWRESLYFPRVAFCSVK-LRHLGQSDNRFLGMCALAVNMLNEKIYIFLWYWTMLVAICTGVSIITWFLRLTIRRRKTRIIRKYLKLGPEPEPSESEKELDADTLDPDDPRTVDRFIKEFLRLDGVFIVHMLNLNAGDIVTGEVIRLLWKAWLTKY 864          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000061679.1 (SMESG000061679.1)

HSP 1 Score: 794.267 bits (2050), Expect = 0.000e+0
Identity = 423/423 (100.00%), Postives = 423/423 (100.00%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI 1615
            MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI
Sbjct:    1 MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI 423          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 351.673 bits (901), Expect = 2.189e-115
Identity = 188/401 (46.88%), Postives = 268/401 (66.83%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHS-KPIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENF 1540
            MV  EF++   ++K + +VG+EDFADKLSF  S ++L+L  +V+T+KSYL   +ACY    P G +F+++L++YCWVHGTI      ++P +   W + D+  RINYYQWVPF+L LQ  +FY+P+IIWQ+I YN SGT+LE +V  AN+A+N     + + +++IA  +E++LF HR     +   +  K+    ++    K  G  L   Y+ IK LY +N  GQLF+M+ FL F +  +SFGY VL N++ G+EW+ T IFPRVTYCY++NI+HV + N Y+AQC LP+NMLNEKIY+FLWFW V+V   T IS+  W YR+   S +  F+K+FL + + Y   D  ++ +F   FLR DGVF++RM  INAGD+ITADIV  L  IYKE +K  +F
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDF 401          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 349.362 bits (895), Expect = 8.478e-115
Identity = 192/403 (47.64%), Postives = 273/403 (67.74%), Query Frame = 2
Query:  353 LSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSK-PIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHK--GTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK 1546
            +  F+   T ++   +VG+ED ADK SF  S  IL++ +++++ K Y+   I+CYIP+  SG D D ++K+YCWVHGTIP   N  LP   + W   D   +INYYQWVPFVL LQG+LFYLPR+IW+ I YNLSG DLEGLV  A  ASNQ G+ + ET+ Q+A  LE+ LF  R++  H+K P++ +     S +C  +R+G    + Y+ IK+LY+ NA  Q+ LMQ FL +G      +FG+ +LK+IL G++WND ++FPRV++C++ +I  V  KN+++AQC LPINMLNEKIYIFLWFWTV V+F T IS+  W+YR+T    +  F+K+FL+I+  YT +  +++  F   FLR DG+FIL + S+NAGDLI  DIV+ LW IY + + + +F K
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLRQ---KMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 343.584 bits (880), Expect = 1.351e-112
Identity = 189/388 (48.71%), Postives = 270/388 (69.59%), Query Frame = 2
Query:  398 FVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSK-PIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHK--GTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK 1546
            +VG+ED ADK SF  S  IL++ T++++ K Y+   IACYIPI  +G+  +D++++YCW HGTIP + N  LP + + W + D   R+NYYQWVPFVL LQG+LFYLPR+IW+ I YNLSG DLEGLV  A  ASNQ G+ + ET+ Q+A  LE+ LF  R++  H+K P++ +     S +C  +R+G    + Y+ IK+LY+ NA  Q+ LMQ FL +G      +FG+ +LK+IL G++WND ++FPRV++C++ +I  V  KN+++AQC LPINMLNEKIYIFLWFWTV V+F T IS+  W+YR+T    +  F+K+FL+I+  YT +  +++  F   FLR DG+FIL + S+NAGDLI  DIV+ LW IY + + + +F K
Sbjct:   16 YVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLRQ---KMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 298.516 bits (763), Expect = 8.376e-95
Identity = 177/441 (40.14%), Postives = 275/441 (62.36%), Query Frame = 2
Query:  347 MVLSEFIDYATKYKWADFVGMEDFADKLSFXXXXXXXXXXXXXXXXKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPI--KGNLPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMS----KLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGH-KGTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYXXXXXXXXXXXXXXXXXXXQWIYRLTQSSSQVHFLKKFLRIREQYTDE--DCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSKSGVPGDETHYSDASTLPLKDDFI*KMIIEKTS 1642
            MV SEF+DY +K + +  VG+ED  D+L+F+ S  +L++  L++TVK Y+   I+CY+P +  G +   ++++ CWV GTI +  +   P   E W+ +++ +++ YYQWVPF+L LQ I+FY+P+++WQ+I YN +GTD++ LV  AN A + + +A+S+ V  ++  LE LL+ HR    H    ++    K+  +  +L   KR G  L + Y+ +K+ YV N F QL +MQ FL F      +FG  V  NI  G +W  T+IFPRV+YC++K + H+ + N+ +AQCVLP+NMLNE+IY FLW W +IV+  T +S+  WI R+     + HF+++FL I E+ T +  +  +L  F   FLR DG+F+L+M S+NAGD+IT++IV  LWNIYK  +   NF   G   D+    D S   +K  F+   + +KTS
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEK-HKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRD---HRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFVK-VTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLNDGSDEDD----DKSRTMIKLGFLNNKLADKTS 432          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-91.916e-5534.73Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-74.260e-5533.87Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
inx-15.691e-5533.51Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-15.691e-5533.51Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-78.392e-5534.23Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx23.129e-1527.65gene:FBgn0027108 transcript:FBtr0301860[more]
Inx23.129e-1527.65gene:FBgn0027108 transcript:FBtr0071005[more]
Inx23.129e-1527.65gene:FBgn0027108 transcript:FBtr0332314[more]
Inx23.129e-1527.65gene:FBgn0027108 transcript:FBtr0071006[more]
shakB3.827e-1327.24gene:FBgn0085387 transcript:FBtr0309369[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL2.437e-5434.73Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL2.245e-5233.87Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|A8WVX4|INX19_CAEBR1.622e-4531.67Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
sp|Q19746|INX3_CAEEL7.893e-4329.80Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|O61715|INX19_CAEEL1.199e-4230.92Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UMB03.593e-12552.12Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
A0A068Y4N32.103e-12452.00Innexin OS=Echinococcus multilocularis OX=6211 GN=... [more]
A0A068WGF52.695e-12452.26Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
A0A564YPR71.325e-12351.63Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=... [more]
A0A183SWW72.791e-12352.39Innexin OS=Schistocephalus solidus OX=70667 GN=inx... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000061679.10.000e+0100.00SMESG000061679.1[more]
SMESG000080788.12.189e-11546.88SMESG000080788.1[more]
SMESG000081749.18.478e-11547.64SMESG000081749.1[more]
SMESG000081749.11.351e-11248.71SMESG000081749.1[more]
SMESG000065083.18.376e-9540.14SMESG000065083.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033245 ID=SMED30033245|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1843bp
CTGAGATTCAAGTTTCACATTCAATCTCGAACTCGGTCGACGAGGCATCA
AATTAGCATCAATTTGTTAGTAAAATCGAAATTATCTATGAAATATTTGA
TAAACGTCTCACATTGTGTTTTGTAAATTATTCATTGGCAATCACAAATC
TAGTCATAAAAGTTTGCAATATTTGCAACATCATTAGCAGCGCTCAAGAC
CCGAATCAGCTCTGTTTTGACATTATTAAAGCCACTGCCATTTGGAATTG
TGAATAGATTTTAGCATTTGCGTACTCATAACTTATTTGTGAACGTCTAC
TGTGAAAAGTGAAATATTTTCGAATAAGAATTATTAATATTAGAAAATGG
TGCTTTCGGAATTCATAGATTATGCTACGAAATACAAATGGGCCGATTTT
GTTGGCATGGAGGATTTTGCAGACAAATTAAGTTTCAGTATTTCGACGTC
TATTTTGTTGTTATTAACTTTGGTTATTACTGTAAAAAGCTATTTATTGA
CTTCTATTGCTTGCTATATTCCTATCCACCCTTCCGGTAAAGATTTCGAC
GATTTTCTCAAGAGTTATTGCTGGGTACACGGAACAATTCCTATAAAAGG
TAACTTACCTCCAGATATCGAATCCTGGGAAAAAATGGATGAATTTAATA
GAATTAATTATTATCAATGGGTACCTTTTGTTCTAGCATTACAAGGCATT
TTGTTTTATTTACCGAGAATAATATGGCAAATGATTACTTACAATTTGTC
AGGAACTGATCTTGAAGGTCTTGTGGAAATGGCAAATTCTGCTAGTAATC
AAACAGGAAAAGCTAAATCAGAAACAGTCGACCAAATAGCAATGAATTTG
GAGAATCTTCTATTTTCTCACAGAAAAATAAATTTGCATAGTAAACCTAT
TATGTCTAAATTGTCAACGGCTAAATCATGGCTCTGTTCCGATAAAAGAA
GTGGCCGTCAATTGGCAGCTCAATACATGTTCATTAAAGTTTTATACGTC
ATCAATGCTTTTGGTCAGTTGTTTTTAATGCAGTACTTTTTAGATTTTGG
TCATAAAGGAACAAGTTTTGGGTATGTAGTGTTGAAAAACATTTTAGAAG
GTAGAGAGTGGAACGATACGATGATATTTCCAAGAGTTACATATTGTTAT
CTGAAGAATATTCAACATGTCGCAATTAAAAACAACTATCTAGCTCAATG
TGTCCTGCCTATCAATATGTTAAATGAGAAAATCTACATTTTTCTTTGGT
TTTGGACGGTAATCGTTGTTTTCTTTACTTTTATTAGTTTATTTCAATGG
ATCTATCGGCTTACGCAATCTAGTTCACAAGTACATTTTTTGAAAAAGTT
TCTCCGAATTCGAGAACAGTATACAGATGAAGACTGCTCTGTCTTGAAAT
CATTTTTCAGGGGCTTTCTCAGAAAAGATGGAGTTTTTATTTTGAGAATG
TTCTCGATAAATGCAGGAGATTTGATTACGGCTGATATAGTGACTGGGCT
GTGGAATATTTATAAAGAGAAGCACAAAGAAGAAAATTTCAGCAAATCGG
GTGTTCCAGGTGACGAGACTCATTATAGCGATGCTTCCACTTTACCACTG
AAAGATGATTTTATTTAAAAAATGATAATCGAAAAAACCTCAGTTAAAAT
AACTAGATTTACAATCAGAAAATGCTCACTCATATTTCTCCTAATTATTC
TGACTAATTTGTTAAACAAGGTTTTGTATTATTTCCTATAGATGTTATCC
ACGTTTCAGCTGATTCTGTTTGTTATTTCAAGTTATAGTTTTCCAATTTC
ATCTAAAACAAAATGAATTATAATTAATTTGTTTATAAAAAAA
back to top

protein sequence of SMED30033245-orf-1

>SMED30033245-orf-1 ID=SMED30033245-orf-1|Name=SMED30033245-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=424bp
MVLSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYL
LTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGNLPPDIESWEKMDEF
NRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSAS
NQTGKAKSETVDQIAMNLENLLFSHRKINLHSKPIMSKLSTAKSWLCSDK
RSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHKGTSFGYVVLKNIL
EGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFL
WFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVL
KSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK
SGVPGDETHYSDASTLPLKDDFI*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
inx10
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000087proximal tubule
PLANA:0000088renal system
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 45..56
score: 28.67
coord: 74..83
score: 42.4
coord: 260..269
score: 54.4
coord: 285..301
score: 67.53
coord: 210..224
score: 41.6
coord: 105..127
score: 62.09
IPR000990InnexinPFAMPF00876Innexincoord: 22..389
e-value: 3.0E-103
score: 345.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 14..398
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..395
score: 31.026
NoneNo IPR availableTMHMMTMhelixcoord: 210..232
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 105..127