Discoidin domain-containing receptor 2

Overview
NameDiscoidin domain-containing receptor 2
Smed IDSMED30033242
Length (bp)2951
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Discoidin domain-containing receptor 2 (SMED30033242) t-SNE clustered cells

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30033242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Discoidin domain-containing receptor 2 (SMED30033242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Discoidin domain-containing receptor 2 (SMED30033242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30033242SMESG000067889.1 PL08001A2A09_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30033242SMESG000067889.1 PL06004B2D07_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 161.384 bits (407), Expect = 6.002e-40
Identity = 110/371 (29.65%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   VE   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   G+ W ++R    K   ++L+G ++ +    + L+PPI+ R +R  P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   + F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGQIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GTRWISWRNRHGK---QVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 161.384 bits (407), Expect = 6.002e-40
Identity = 110/371 (29.65%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   VE   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   G+ W ++R    K   ++L+G ++ +    + L+PPI+ R +R  P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   + F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGQIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GTRWISWRNRHGK---QVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR2 (discoidin domain receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:2731])

HSP 1 Score: 161.384 bits (407), Expect = 6.002e-40
Identity = 110/371 (29.65%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   VE   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   G+ W ++R    K   ++L+G ++ +    + L+PPI+ R +R  P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   + F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGQIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GTRWISWRNRHGK---QVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 153.295 bits (386), Expect = 1.527e-37
Identity = 107/366 (29.23%), Postives = 177/366 (48.36%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVE--FDNLMRNFNQS-DHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  SA+S +      +      +  E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR      D + +  +K++  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G   +  + +            Y  D+ YDG        GGLG L D  +GLD   K  E      Y Y+GW+     S  + ++F F   R F ++  +  +  +L       ++  F          E    NL  N       ++ + +GG+  +F+     FA  WLL SEI F+S
Sbjct:   27 DPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR-----HSRLESSDGDG---AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR------DGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV------------YLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFIS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Match: DDR1 (discoidin domain receptor tyrosine kinase 1 [Source:HGNC Symbol;Acc:HGNC:2730])

HSP 1 Score: 153.295 bits (386), Expect = 1.527e-37
Identity = 107/366 (29.23%), Postives = 177/366 (48.36%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVE--FDNLMRNFNQS-DHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  SA+S +      +      +  E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR      D + +  +K++  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G   +  + +            Y  D+ YDG        GGLG L D  +GLD   K  E      Y Y+GW+     S  + ++F F   R F ++  +  +  +L       ++  F          E    NL  N       ++ + +GG+  +F+     FA  WLL SEI F+S
Sbjct:   27 DPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR-----HSRLESSDGDG---AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR------DGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV------------YLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFIS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-1 (Discoidin domain-containing receptor A [Source:UniProtKB/Swiss-Prot;Acc:Q18163])

HSP 1 Score: 116.701 bits (291), Expect = 2.108e-26
Identity = 92/350 (26.29%), Postives = 152/350 (43.43%), Query Frame = 1
Query:  202 VPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYR-YIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQES------LKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            + DS  +A+S F      K     + AR     E    AWCP  Q+     E+LQ+ L    +I  V T+GR+  G+G+EF   Y I Y R    GS W  Y   K +     ++G  D        LDPPI+   IR  P S   + VC++ ++ GC          +P G+    + D +  ++S   + + + ++G         +  GLGLLTD  +      ++ +    +IGW +     + I I F F    NF+ +   +F       N    ID+ FS D ++      + + E  +L     + D  + L    + G+ V +++ F+S W+ L+E+ F S
Sbjct:   36 IADSQITASSSF-----DKQSVGPQNAR--LHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDYLR---PGSQWIRY---KNRTGHVYMDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCKHEGVTYYSTVPDGS----RLDTLDFKDSMFEDSQIYTESG---------IKRGLGLLTDGFVAQASPFEKNQMNNSWIGWNRDTTDGR-ITILFEFEEVHNFTDVVLATFG------NRIDGIDVIFSQDGKTFPLFSQISSSERQSLNNTSRRYDFRVPLH--NRAGRKVRISIKFSSDWMFLTEVHFTS 350          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 108.997 bits (271), Expect = 5.227e-24
Identity = 104/361 (28.81%), Postives = 168/361 (46.54%), Query Frame = 1
Query:  166 KCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKI-LNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFND-NLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFA--SQWLLLSEIRFVS 1230
            +C  +L    + + D   SA+S F            + AR +  +E+   AWCP NQ+     E+LQI     T+I  V T+GRF  G G E+   ++I+Y R   S + W +Y+   E   + I  N  T+  I     LD  II R IRI P SN  + VC+++++FGC F + ++ Y + QG                +  + Y  D  YDG L N  +L GG+G L D E+G +        ++++GW +   ++  + + F F   RN S I  ++ ++       FS   + FS + +  S   V F+N     ++    I++ V  +  K   + L+F   S WL +SE+ F S
Sbjct:   24 ECSHQLGMSNRKIRDEQISASSSF-----DLQSTGPQHARAH--QESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWR--PSLNAWASYKDDFE--LETIPANNDTEHAIR--RHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQG--------------DLQSGISYH-DFSYDGNLANSPHLTGGIGKLYDGEVGKNNVF--VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 352          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 108.612 bits (270), Expect = 6.800e-24
Identity = 95/317 (29.97%), Postives = 152/317 (47.95%), Query Frame = 1
Query:  298 KENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKI-LNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFND-NLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFA--SQWLLLSEIRFVS 1230
            +E+   AWCP NQ+     E+LQI     T+I  V T+GRF  G G E+   ++I+Y R   S + W +Y+   E   + I  N  T+  I     LD  II R IRI P SN  + VC+++++FGC F + ++ Y + QG                +  + Y  D  YDG L N  +L GG+G L D E+G +        ++++GW +   ++  + + F F   RN S I  ++ ++       FS   + FS + +  S   V F+N     ++    I++ V  +  K   + L+F   S WL +SE+ F S
Sbjct:   31 QESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWR--PSLNAWASYKDDFE--LETIPANNDTEHAIR--RHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQG--------------DLQSGISYH-DFSYDGNLANSPHLTGGIGKLYDGEVGKNNVF--VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Match: ddr-2 (Discoidin domain-containing receptor tyrosine kinase B [Source:UniProtKB/Swiss-Prot;Acc:Q95ZV7])

HSP 1 Score: 108.612 bits (270), Expect = 6.800e-24
Identity = 95/317 (29.97%), Postives = 152/317 (47.95%), Query Frame = 1
Query:  298 KENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKI-LNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFND-NLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFA--SQWLLLSEIRFVS 1230
            +E+   AWCP NQ+     E+LQI     T+I  V T+GRF  G G E+   ++I+Y R   S + W +Y+   E   + I  N  T+  I     LD  II R IRI P SN  + VC+++++FGC F + ++ Y + QG                +  + Y  D  YDG L N  +L GG+G L D E+G +        ++++GW +   ++  + + F F   RN S I  ++ ++       FS   + FS + +  S   V F+N     ++    I++ V  +  K   + L+F   S WL +SE+ F S
Sbjct:   31 QESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQYWR--PSLNAWASYKDDFE--LETIPANNDTEHAIR--RHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQG--------------DLQSGISYH-DFSYDGNLANSPHLTGGIGKLYDGEVGKNNVF--VNHHKWVGWRRK--RNGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES 322          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329980)

HSP 1 Score: 162.925 bits (411), Expect = 6.488e-41
Identity = 112/370 (30.27%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSD-WKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKET----EAYRYIGW-TQSP-LKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            D + C V L  +   + D+  +A+S         A    + AR   D  N+  AWCP + V  +L EYLQ+DL +  +I  + T+GR+ +G G+E+T  Y + Y R    G D W+ ++  + K   +IL G  + + +    L P I    IRI+PY    + VCL+ ++ GC +   I+ Y IP+G                +R +E  L D  YDG    D  V GLG L D + G D    +     + Y +IGW   +P L  KP+ I F F   RNFS+I  ++ +  + D+  F    + FS      S + V+F  +          + + +  + GK++ + L+FA +W++LSEI F+S P
Sbjct:   74 DIATCNVPLGMESLLITDAQITASS-----AHDMAFVGPQHARLKTD--NDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWR---PGFDKWQRWKNIQGK---EILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKGV---------------QRGMEVDLSDKTYDGNEQGDRYVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVP 415          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0112617)

HSP 1 Score: 162.925 bits (411), Expect = 6.488e-41
Identity = 112/370 (30.27%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSD-WKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKET----EAYRYIGW-TQSP-LKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            D + C V L  +   + D+  +A+S         A    + AR   D  N+  AWCP + V  +L EYLQ+DL +  +I  + T+GR+ +G G+E+T  Y + Y R    G D W+ ++  + K   +IL G  + + +    L P I    IRI+PY    + VCL+ ++ GC +   I+ Y IP+G                +R +E  L D  YDG    D  V GLG L D + G D    +     + Y +IGW   +P L  KP+ I F F   RNFS+I  ++ +  + D+  F    + FS      S + V+F  +          + + +  + GK++ + L+FA +W++LSEI F+S P
Sbjct:   74 DIATCNVPLGMESLLITDAQITASS-----AHDMAFVGPQHARLKTD--NDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWR---PGFDKWQRWKNIQGK---EILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKGV---------------QRGMEVDLSDKTYDGNEQGDRYVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVP 415          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344771)

HSP 1 Score: 163.31 bits (412), Expect = 1.218e-40
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 1
Query:  169 CRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKET----EAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPL 1239
            C+  L  +  ++ D   +A+S          +   + AR   D  N   AWCP + V + L+EYLQ+DL  + ++  + T+GRF +G G+E+T  Y I Y R       W  +R  + K   ++L G  + + +    L P +    +R++PYS   + VCL+ ++ GC +   I+ Y IP+G                +R ++  L D  YDG    D+ V GLG L D + G D    +     + Y +IGW    L  +P+ I F F   RN S++  ++ +  S D+  F    + FS      S + V+F  +          + + +  + G++V L L+FA++W+++SEI F+S P+
Sbjct:  106 CKQALGMESGAIADFQITASS-----AHDMGNVGPQHARLKID--NNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPG--LKKWIRWRSLQGK---EVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKG---------------MQRGMDIDLSDKTYDGYEEGDHYVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: Ddr (gene:FBgn0053531 transcript:FBtr0344770)

HSP 1 Score: 163.31 bits (412), Expect = 1.218e-40
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 1
Query:  169 CRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKET----EAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPL 1239
            C+  L  +  ++ D   +A+S          +   + AR   D  N   AWCP + V + L+EYLQ+DL  + ++  + T+GRF +G G+E+T  Y I Y R       W  +R  + K   ++L G  + + +    L P +    +R++PYS   + VCL+ ++ GC +   I+ Y IP+G                +R ++  L D  YDG    D+ V GLG L D + G D    +     + Y +IGW    L  +P+ I F F   RN S++  ++ +  S D+  F    + FS      S + V+F  +          + + +  + G++V L L+FA++W+++SEI F+S P+
Sbjct:  106 CKQALGMESGAIADFQITASS-----AHDMGNVGPQHARLKID--NNGGAWCPKHMVSRGLTEYLQVDLLGVHLVSAIRTQGRFGKGQGQEYTEAYVIEYWRPG--LKKWIRWRSLQGK---EVLPGNINTYSEVENVLQPSVFASKVRLYPYSQYDRTVCLRAEIVGCAWEEGIVSYSIPKG---------------MQRGMDIDLSDKTYDGYEEGDHYVNGLGQLVDGQRGKDNFRADINGLGKGYEWIGWRNDTLLGRPVEIIFEFETVRNLSAVIIHTNNMFSKDVQVFVHAKVFFSIGGRHFSGEPVQFSYMPDLVLDHARDVTIKLHHRLGRYVQLHLYFAARWMMISEITFISAPV 442          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Match: smal (gene:FBgn0085409 transcript:FBtr0329979)

HSP 1 Score: 162.155 bits (409), Expect = 2.174e-40
Identity = 112/370 (30.27%), Postives = 178/370 (48.11%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSD-WKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKET----EAYRYIGW-TQSP-LKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE--SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            D + C V L  +   + D+  +A+S         A    + AR   D  N+  AWCP + V  +L EYLQ+DL +  +I  + T+GR+ +G G+E+T  Y + Y R    G D W+ ++  + K   +IL G  + + +    L P I    IRI+PY    + VCL+ ++ GC +   I+ Y IP+G                +R +E  L D  YDG    D  V GLG L D + G D    +     + Y +IGW   +P L  KP+ I F F   RNFS+I  ++ +  + D+  F    + FS      S + V+F  +          + + +  + GK++ + L+FA +W++LSEI F+S P
Sbjct:   74 DIATCNVPLGMESLLITDAQITASS-----AHDMAFVGPQHARLKTD--NDGGAWCPKHMVSNALKEYLQVDLLQTHVITAIRTQGRYGKGQGQEYTEAYVLEYWR---PGFDKWQRWKNIQGK---EILPGNINTYSEVENALQPIIFASKIRIYPYGQYDRTVCLRAEIVGCPWEEGIVSYSIPKG---------------VQRGMEVDLSDKTYDGNEQGDRYVDGLGQLVDGQKGKDNFRTDIHGFGKGYEWIGWRNDTPGLLGKPVEIVFEFDTVRNFSAIVLHTNNMFTKDVQVFVHAKVFFSIGGRYFSGEPVQFSYMPDTIMDHARDVTIKLHHRVGKYLKINLYFAVKWIMLSEISFISVP 415          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 174.096 bits (440), Expect = 3.997e-44
Identity = 105/375 (28.00%), Postives = 185/375 (49.33%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD--------QESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            + +KCR  L  +   +PDS  +A+S +    E K    +    +         AWCP+  V  S SE+LQ+DL +L  + +V T+GR A G G+EF   Y++RYSR      D +++  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++ + +  Y  P G        ++            F D+ YDG+     + GGLG L D  +G +  ++  E      Y Y+GW +  L    ++I+F F   R F ++  +S ++ +  +  FS +   F +         + SL+  +  +L      S  +I L +GG+  + +     FA  WLL+SEI F S P +
Sbjct:   31 ETAKCRYALGMEDGVIPDSDITASSAWSDSTEAKHGRLSNGEGDG--------AWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSR------DGRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSLVN-----------FNDSVYDGSKEGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASLLSPWAEPELSLQVSDLHDL------SSRTISLPLGGRPAQILRCHFAFADNWLLISEISFYSMPFE 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 174.481 bits (441), Expect = 4.645e-44
Identity = 105/375 (28.00%), Postives = 185/375 (49.33%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD--------QESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            + +KCR  L  +   +PDS  +A+S +    E K    +    +         AWCP+  V  S SE+LQ+DL +L  + +V T+GR A G G+EF   Y++RYSR      D +++  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++ + +  Y  P G        ++            F D+ YDG+     + GGLG L D  +G +  ++  E      Y Y+GW +  L    ++I+F F   R F ++  +S ++ +  +  FS +   F +         + SL+  +  +L      S  +I L +GG+  + +     FA  WLL+SEI F S P +
Sbjct:   31 ETAKCRYALGMEDGVIPDSDITASSAWSDSTEAKHGRLSNGEGDG--------AWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSR------DGRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSLVN-----------FNDSVYDGSKEGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASLLSPWAEPELSLQVSDLHDL------SSRTISLPLGGRPAQILRCHFAFADNWLLISEISFYSMPFE 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 174.481 bits (441), Expect = 4.645e-44
Identity = 105/375 (28.00%), Postives = 185/375 (49.33%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD--------QESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            + +KCR  L  +   +PDS  +A+S +    E K    +    +         AWCP+  V  S SE+LQ+DL +L  + +V T+GR A G G+EF   Y++RYSR      D +++  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++ + +  Y  P G        ++            F D+ YDG+     + GGLG L D  +G +  ++  E      Y Y+GW +  L    ++I+F F   R F ++  +S ++ +  +  FS +   F +         + SL+  +  +L      S  +I L +GG+  + +     FA  WLL+SEI F S P +
Sbjct:   31 ETAKCRYALGMEDGVIPDSDITASSAWSDSTEAKHGRLSNGEGDG--------AWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSR------DGRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSLVN-----------FNDSVYDGSKEGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASLLSPWAEPELSLQVSDLHDL------SSRTISLPLGGRPAQILRCHFAFADNWLLISEISFYSMPFE 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:ZFIN;Acc:ZDB-GENE-060323-2])

HSP 1 Score: 174.096 bits (440), Expect = 5.315e-44
Identity = 105/375 (28.00%), Postives = 185/375 (49.33%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD--------QESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            + +KCR  L  +   +PDS  +A+S +    E K    +    +         AWCP+  V  S SE+LQ+DL +L  + +V T+GR A G G+EF   Y++RYSR      D +++  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++ + +  Y  P G        ++            F D+ YDG+     + GGLG L D  +G +  ++  E      Y Y+GW +  L    ++I+F F   R F ++  +S ++ +  +  FS +   F +         + SL+  +  +L      S  +I L +GG+  + +     FA  WLL+SEI F S P +
Sbjct:   31 ETAKCRYALGMEDGVIPDSDITASSAWSDSTEAKHGRLSNGEGDG--------AWCPAGPVFPSASEFLQVDLRKLHFLSLVGTQGRHADGLGREFARSYRLRYSR------DGRHWMTWKDRWGQEVVSGNENTYDIVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWKDGLKAYTAPLGHVMDLSGSLVN-----------FNDSVYDGSKEGGVIFGGLGQLCDGVLGGNDFMESKELRVWPGYDYVGWNRETLGQPTVDIEFHFEKTRIFHTMQVHSNNRHTQGVRVFSEVVCKFKASLLSPWAEPELSLQVSDLHDL------SSRTISLPLGGRPAQILRCHFAFADNWLLISEISFYSMPFE 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Match: ddr2l (discoidin domain receptor family, member 2, like [Source:ZFIN;Acc:ZDB-GENE-041210-162])

HSP 1 Score: 167.548 bits (423), Expect = 4.878e-42
Identity = 110/367 (29.97%), Postives = 181/367 (49.32%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFS----SDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+ CR  L  +   + +   +A+S +  Y      +    AR N  +E    AWC + Q++ S  +YLQIDL +L  + VV T+GR+A+ SG EF   Y++ YSR+      W+N  +F      +I+ G  + +      L PPII R +R+ P ++ +  VC++++LFGC + + ++ Y  P+G         I   N          D+ YDG L    L GGLG L D  +GLD  V+  +      Y Y+GW    L    + ++F F  +RNF+S+  +S +  S+ +  FS +   F     S+ ES + VEF  ++ + N S   + + +  ++   +    +FA  W++ SEI F S
Sbjct:    7 DPAHCRYPLGMEDGRIKNDDITASSQW--YDSTGPQY----ARLN--REEGEGAWCAAGQLQPSDVQYLQIDLRQLIFLTVVATQGRYARNSGIEFARKYRLEYSRDGHRWISWRN--RFG----NEIIMGNVNTYDTVVRDLHPPIITRFLRLIPVTDAVHTVCMRVELFGCAWQDGLMAYSSPEGQIMMAPGFPITSLN----------DSTYDGPLERRKLSGGLGQLADGVVGLDDFVESRQYRLWPGYDYVGWRNDGLGPAYVEMEFQFDRQRNFTSMKVHSNNMFSMGVKIFSSVSCVFKLHLISEWES-EPVEFHTVIDDRNPSARYVTVPLKHRSATALRCRFYFADTWMMFSEISFQS 348          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 161.77 bits (408), Expect = 4.099e-40
Identity = 107/371 (28.84%), Postives = 170/371 (45.82%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLD-----FTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQES---LKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK    P+ CR  L    +++ D    A+S +  Y+     + A+  RE  D      AWCP+  ++    +YLQIDL  L  I ++ T+GR A+ +GKEF   Y++ YSRN G    W++++       Q+++ G  D +      L PPII R IR+ P + V   VC++++L+GC +S+ +  Y +P+G         I   N          D+ YDG L      GGLG LTD   GLD        +    Y YIGW         + ++F F   RNFS +  +  +  S  +  F + +  F    E     + V    ++ + N S   + + +  + G  +    +FA  W++ SEI F S
Sbjct:   15 AKCAVIPASCRYALGMHDRTIRDEDIIASSQW--YESTGPQY-ARLQREEGDG-----AWCPAGLLQPEDVQYLQIDLHELHFITLIGTQGRHARATGKEFARAYRVDYSRNGGRWLSWRDHQG------QQVMRGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIAFLN----------DSTYDGYLEKRRQFGGLGQLTDGIHGLDDFTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFES 361          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 157.918 bits (398), Expect = 6.283e-39
Identity = 104/364 (28.57%), Postives = 167/364 (45.88%), Query Frame = 1
Query:  163 SKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLD-----FTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQES---LKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            + CR  L    +++ D    A+S +  Y+     + A+  RE  D      AWCP+  ++    +YLQIDL  L  I ++ T+GR A+ +GKEF   Y++ YSRN G    W++++       Q+++ G  D +      L PPII R IR+ P + V   VC++++L+GC +S+ +  Y +P+G         I   N          D+ YDG L      GGLG LTD   GLD        +    Y YIGW         + ++F F   RNFS +  +  +  S  +  F + +  F    E     + V    ++ + N S   + + +  + G  +    +FA  W++ SEI F S
Sbjct:   12 ASCRYALGMHDRTIRDEDIIASSQW--YESTGPQY-ARLQREEGDG-----AWCPAGLLQPEDVQYLQIDLHELHFITLIGTQGRHARATGKEFARAYRVDYSRNGGRWLSWRDHQG------QQVMRGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIAFLN----------DSTYDGYLEKRRQFGGLGQLTDGIHGLDDFTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFES 351          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: ddr2l (discoidin domain receptor tyrosine kinase 2 like [Source:NCBI gene;Acc:779954])

HSP 1 Score: 157.918 bits (398), Expect = 6.340e-39
Identity = 104/364 (28.57%), Postives = 167/364 (45.88%), Query Frame = 1
Query:  163 SKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLD-----FTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQES---LKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            + CR  L    +++ D    A+S +  Y+     + A+  RE  D      AWCP+  ++    +YLQIDL  L  I ++ T+GR A+ +GKEF   Y++ YSRN G    W++++       Q+++ G  D +      L PPII R IR+ P + V   VC++++L+GC +S+ +  Y +P+G         I   N          D+ YDG L      GGLG LTD   GLD        +    Y YIGW         + ++F F   RNFS +  +  +  S  +  F + +  F    E     + V    ++ + N S   + + +  + G  +    +FA  W++ SEI F S
Sbjct:   12 ASCRYALGMHDRTIRDEDIIASSQW--YESTGPQY-ARLQREEGDG-----AWCPAGLLQPEDVQYLQIDLHELHFITLIGTQGRHARATGKEFARAYRVDYSRNGGRWLSWRDHQG------QQVMRGNVDEYEVVLADLRPPIIARYIRVIPVTKVPMTVCMRVELYGCKWSDGLTSYSVPEGETYIAPGQPIAFLN----------DSTYDGYLEKRRQFGGLGQLTDGIHGLDDFTQSLQYRVWPGYDYIGWRNDSAPRGYVEVEFHFDRPRNFSLMKVHCNNLFSKGVKIFQKAECLFKPRLEGEWEAEPVVVLMVVDDKNPSARFVTIPLRQRVGSAILCRFYFADAWMMFSEISFES 351          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 155.992 bits (393), Expect = 3.781e-38
Identity = 118/391 (30.18%), Postives = 184/391 (47.06%), Query Frame = 1
Query:  127 FW--IFIAKVIS------DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKT------VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            FW  + +A  I+      DPS CR  L    +++PD   +A+S +    E K      +  E+ D +    AWCP   V  +  E+LQ+DL  L  + +V T+GR   G GKEF   YQ+RYSR+   G  W  +R   ++   +++ G  +      + L PPII R +R +P ++ +  VCL+++L+GCI+ + +  Y  P G        +I +            D+ YDG        GGLG LTD  IG D  ++  E      Y Y+GW  S      + ++F F   R+F  +  +  +  S  I  F R+D  F   + SL T      V     +   + S  S+ + + G+  + +    +F+SQWLLLSEI F+S  LD
Sbjct:   11 FWFNLLLALCIAEPDAHFDPSSCRYALGMQDRTIPDEDITASSAWSDSTEAK-----HSRLESNDGDG---AWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSRD---GFKWSQWR---DRWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMADRVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLN-----------DSTYDGFTVGGLQYGGLGQLTDGVIGADDFLQHKEQGVWPGYDYVGWMTSNFPKGYLEMEFEFDALRSFIYMRVHCNNMGSGGIQIFRRVDCYF---KRSLHTPWDPQPVTLSLALDVRDPSARSVTIALQGRAARILRCHYYFSSQWLLLSEISFLSDILD 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Match: pitpnc1l (phosphatidylinositol transfer protein cytoplasmic 1 like [Source:Xenbase;Acc:XB-GENE-5779888])

HSP 1 Score: 155.606 bits (392), Expect = 4.345e-38
Identity = 118/391 (30.18%), Postives = 184/391 (47.06%), Query Frame = 1
Query:  127 FW--IFIAKVIS------DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKT------VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            FW  + +A  I+      DPS CR  L    +++PD   +A+S +    E K      +  E+ D +    AWCP   V  +  E+LQ+DL  L  + +V T+GR   G GKEF   YQ+RYSR+   G  W  +R   ++   +++ G  +      + L PPII R +R +P ++ +  VCL+++L+GCI+ + +  Y  P G        +I +            D+ YDG        GGLG LTD  IG D  ++  E      Y Y+GW  S      + ++F F   R+F  +  +  +  S  I  F R+D  F   + SL T      V     +   + S  S+ + + G+  + +    +F+SQWLLLSEI F+S  LD
Sbjct:   11 FWFNLLLALCIAEPDAHFDPSSCRYALGMQDRTIPDEDITASSAWSDSTEAK-----HSRLESNDGDG---AWCPLGPVFPNYEEFLQVDLRNLHFLTLVGTQGRDGGGLGKEFARHYQLRYSRD---GFKWSQWR---DRWGNEVIEGNENTHDSVLKDLGPPIIARYVRFYPMADRVMSVCLRVELYGCIWQDGLRSYTSPPGNVMSLPSMLINLN-----------DSTYDGFTVGGLQYGGLGQLTDGVIGADDFLQHKEQGVWPGYDYVGWMTSNFPKGYLEMEFEFDALRSFIYMRVHCNNMGSGGIQIFRRVDCYF---KRSLHTPWDPQPVTLSLALDVRDPSARSVTIALQGRAARILRCHYYFSSQWLLLSEISFLSDILD 373          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 160.614 bits (405), Expect = 6.375e-40
Identity = 111/371 (29.92%), Postives = 176/371 (47.44%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKS-LSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   V+   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   GS W ++R    K   ++L+G ++ +    + L+PPI+ R +R+ P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   V F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGHIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GSRWISWRNRHGK---QVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 160.614 bits (405), Expect = 6.375e-40
Identity = 111/371 (29.92%), Postives = 176/371 (47.44%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKS-LSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   V+   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   GS W ++R    K   ++L+G ++ +    + L+PPI+ R +R+ P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   V F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGHIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GSRWISWRNRHGK---QVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr2 (discoidin domain receptor family, member 2 [Source:MGI Symbol;Acc:MGI:1345277])

HSP 1 Score: 160.614 bits (405), Expect = 6.375e-40
Identity = 111/371 (29.92%), Postives = 176/371 (47.44%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKS-LSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   V+   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   GS W ++R    K   ++L+G ++ +    + L+PPI+ R +R+ P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   V F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGHIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GSRWISWRNRHGK---QVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 152.91 bits (385), Expect = 2.952e-38
Identity = 107/370 (28.92%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAAR-ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  S +S            +A+ +R E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR+     DWK+      +  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G      + M+ +            D+ YDG        GGLG L D  +GLD   +  E      Y Y+GW+     +  + ++F F   R F ++  +  +  +L       ++  F      + + E ++     +L    +    +I + +GG  G+F+     FA  WLL SEI F+S
Sbjct:   28 DPAKCRYALGMQDRTIPDSDISVSS------SWSDSTAARHSRLESSDGDG---AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKD------RWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLN-----------DSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSLG---DPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFIS 368          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Match: Ddr1 (discoidin domain receptor family, member 1 [Source:MGI Symbol;Acc:MGI:99216])

HSP 1 Score: 152.525 bits (384), Expect = 2.656e-37
Identity = 107/370 (28.92%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAAR-ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  S +S            +A+ +R E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR+     DWK+      +  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G      + M+ +            D+ YDG        GGLG L D  +GLD   +  E      Y Y+GW+     +  + ++F F   R F ++  +  +  +L       ++  F      + + E ++     +L    +    +I + +GG  G+F+     FA  WLL SEI F+S
Sbjct:   28 DPAKCRYALGMQDRTIPDSDISVSS------SWSDSTAARHSRLESSDGDG---AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKD------RWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLN-----------DSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSL---GDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFIS 368          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q16832|DDR2_HUMAN (Discoidin domain-containing receptor 2 OS=Homo sapiens OX=9606 GN=DDR2 PE=1 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 2.883e-39
Identity = 110/371 (29.65%), Postives = 175/371 (47.17%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   VE   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   G+ W ++R    K   ++L+G ++ +    + L+PPI+ R +R  P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   + F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGQIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVEPDDLKEFLQIDLHTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GTRWISWRNRHGK---QVLDGNSNPYDIFLKDLEPPIVARFVRFIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGYIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q62371|DDR2_MOUSE (Discoidin domain-containing receptor 2 OS=Mus musculus OX=10090 GN=Ddr2 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 4.459e-39
Identity = 111/371 (29.92%), Postives = 176/371 (47.44%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKS-LSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK--TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +P+ CR  L      +PD   +A+S    + E  A   AK  R   D E    AWCP   V+   L E+LQIDL  L  I +V T+GR A G G EF P+Y+I YSR+   GS W ++R    K   ++L+G ++ +    + L+PPI+ R +R+ P ++    VC++++L+GC++ + ++ Y  P G         I           Y  D+ YDG +   ++  GLG LTD   GLD   +  E      Y Y+GW      +  I I F F   RNF+++  +  +  +  +  F  +   F S+    +   V F  ++ + N S   + + +  +    +    HFA  W++ SEI F S
Sbjct:   21 AKAQVNPAICRYPLGMSGGHIPDEDITASSQ---WSESTA---AKYGR--LDSEEGDGAWCPEIPVQPDDLKEFLQIDLRTLHFITLVGTQGRHAGGHGIEFAPMYKINYSRD---GSRWISWRNRHGK---QVLDGNSNPYDVFLKDLEPPIVARFVRLIPVTDHSMNVCMRVELYGCVWLDGLVSYNAPAGQQFVLPGGSII----------YLNDSVYDGAV-GYSMTEGLGQLTDGVSGLDDFTQTHEYHVWPGYDYVGWRNESATNGFIEIMFEFDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPTAVYFPLVLDDVNPSARFVTVPLHHRMASAIKCQYHFADTWMMFSEITFQS 366          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q7YR43|DDR1_PANTR (Epithelial discoidin domain-containing receptor 1 OS=Pan troglodytes OX=9598 GN=DDR1 PE=3 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 7.891e-37
Identity = 109/366 (29.78%), Postives = 178/366 (48.63%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVE--FDNLMRNFNQS-DHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  SA+S         +   + AAR + D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR      D + +  +K++  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G   +  + +            Y  D+ YDG        GGLG L D  +GLD   K  E      Y Y+GW+     S  + ++F F   R F ++  +  +  +L       ++  F          E    NL  N       ++ + +GG+  +F+     FA  WLL SEI F+S
Sbjct:   27 DPAKCRYALGMQDRTIPDSDISASS---------SWSDSTAARHSSDGDG---AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR------DGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV------------YLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFIS 362          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q08345|DDR1_HUMAN (Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1 PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 9.499e-37
Identity = 107/366 (29.23%), Postives = 177/366 (48.36%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVE--FDNLMRNFNQS-DHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  SA+S +      +      +  E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR      D + +  +K++  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G   +  + +            Y  D+ YDG        GGLG L D  +GLD   K  E      Y Y+GW+     S  + ++F F   R F ++  +  +  +L       ++  F          E    NL  N       ++ + +GG+  +F+     FA  WLL SEI F+S
Sbjct:   27 DPAKCRYALGMQDRTIPDSDISASSSWSDSTAAR-----HSRLESSDGDG---AWCPAGSVFPKEEEYLQVDLQRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSR------DGRRWMGWKDRWGQEVISGNEDPEGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMYLSEAV------------YLNDSTYDGHTVGGLQYGGLGQLADGVVGLDDFRKSQELRVWPGYDYVGWSNHSFSSGYVEMEFEFDRLRAFQAMQVHCNNMHTLGARLPGGVECRFRRGPAMAWEGEPMRHNLGGNLGDPRARAVSVPLGGRVARFLQCRFLFAGPWLLFSEISFIS 366          
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Match: sp|Q03146|DDR1_MOUSE (Epithelial discoidin domain-containing receptor 1 OS=Mus musculus OX=10090 GN=Ddr1 PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 2.090e-36
Identity = 107/370 (28.92%), Postives = 181/370 (48.92%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAAR-ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+KCR  L    +++PDS  S +S            +A+ +R E+ D +    AWCP+  V     EYLQ+DL RL ++ +V T+GR A G GKEF+  Y++RYSR+     DWK+      +  Q++++G  D      + L PP++ R++R +P ++ +  VCL+++L+GC++ + +L Y  P G      + M+ +            D+ YDG        GGLG L D  +GLD   +  E      Y Y+GW+     +  + ++F F   R F ++  +  +  +L       ++  F      + + E ++     +L    +    +I + +GG  G+F+     FA  WLL SEI F+S
Sbjct:   28 DPAKCRYALGMQDRTIPDSDISVSS------SWSDSTAARHSRLESSDGDG---AWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYRLRYSRDGRRWMDWKD------RWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLRVELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLN-----------DSTYDGYTAGGLQYGGLGQLADGVVGLDDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLPGGVECRFKRGPAMAWEGEPVRHALGGSL---GDPRARAISVPLGGHVGRFLQCRFLFAGPWLLFSEISFIS 368          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A0X3NVU8 (Epithelial discoidin domain-containing receptor 1 OS=Schistocephalus solidus OX=70667 GN=DDR1 PE=4 SV=1)

HSP 1 Score: 183.726 bits (465), Expect = 2.529e-45
Identity = 135/403 (33.50%), Postives = 197/403 (48.88%), Query Frame = 1
Query:  166 KCRVKLLNDYKSVPDSAFSATS----YFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDD--MIKIRNSFERNL---------------EYFLDNGYDGTL--FNDNLVGGLGLLTDNEIGLDFTVKET-EAYR---------YIGWT------QSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK-----TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            +C   LL +  ++PDSAFSATS       P  E   D SAKAAR   D       WCP+ +V +  SEY+QID+G L +I  +   GR    SG  +TP + IRY+R  G  +DW++Y+         I+ G          +L+PPII R IR++PYS V   VC K + +GC F++D+LEY+IPQG+     DD  ++  ++   RN+               +   D  YDG     ++ L GGLG L D  +     V    + YR          IGW       QS +  + +   F F   RNFS++     + PS  I    RI+ +FS +  +        VE  + + N      +IK+D+  K G+FV L   FA+QW+++SE+RFVS  +D
Sbjct:   39 ECDEPLLRE-STLPDSAFSATSNSEAMDQPAGEVSVDHSAKAARNLVDG-----GWCPAGKVGREFSEYIQIDMGALNVIVKIAFGGR----SGVGYTPSFLIRYTREVGD-NDWRDYKNCSSAS-TNIIAGSESNLDLKLLSLNPPIIARAIRLYPYSKVPMFVCAKFEFYGCRFTDDLLEYKIPQGS---LLDDPKILDSQSGLSRNVNDASFVPAAYPVVRTDALRDRCYDGQRDPHSEVLYGGLGCLCDTRVASQSNVLALFDPYREKASEPSECLIGWNRGRWDDQSSVGLEALEFVFRFSGLRNFSALYLQVVNLPSHQITLPHRIETTFSKNGLTFSRDPDLEVELASTV-NATSVIPTIKIDMRQKVGQFVQLRFFFATQWIVVSELRFVSTEVD 425          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A5N4AEF6 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_09755 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 3.756e-45
Identity = 111/365 (30.41%), Postives = 180/365 (49.32%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLD---FTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESL--KTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            D   C   L  +  ++PD A SA+S ++P      +   K  R   +K     AWCP  QVEK + EYLQ+D+  + ++  V T+GR+ +G G+E+   Y I Y R  G G DWK Y+++  K   +IL G +D        L PPI    +R+ PYS   + +CL+L+L GCI    +L Y  P+G++                  +   D+ YDG L    L GGLG+L D E G D     +   +   ++GW      +  + + F F   RNFS++  ++ +  S ++  FS+  I FS        +T+ +  +   F ++  ++ + +  +  +F+ + L FASQW++LSE+ F S P
Sbjct:   43 DIRTCNEPLGMESGAIPDEAISASSSYVP------NVGPKNGRLRVEKAGG--AWCPKQQVEKGIREYLQVDMEEVFVVTGVQTQGRYDRGRGQEYAEEYTIEYWR-PGLG-DWKEYKRWDGK---QILRGNSDTATVESHRLMPPIFASRVRVLPYSVHRRTICLRLELLGCINEGGVLSYVAPEGSSP----------------AQGLADSSYDGQLSEGELRGGLGMLVDGETGADNFRLDIGYGKGNGWVGWKNDSTANGYVELLFEFDQIRNFSAVHLFANNYFSREVQVFSKAKIMFSIGGRYFNGRTLSYSYMPDKFLENARNVSIHLHSRLARFIKIRLFFASQWIMLSEVTFDSVP 378          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A0X3PFD1 (F5/8 type C domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR153173 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.994e-45
Identity = 136/403 (33.75%), Postives = 198/403 (49.13%), Query Frame = 1
Query:  166 KCRVKLLNDYKSVPDSAFSATS----YFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDD--MIKIRNSFERNL---------------EYFLDNGYDGTL--FNDNLVGGLGLLTDNEIGLDFTVKET-EAYR---------YIGWT------QSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLK-----TVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            +C   LL +  ++PDSAFSATS       P  E   D SAKAAR   D       WCP+ +V +  SEY+QID+G L +I  +   GR    SG  +TP + IRY+R  G  +DW++Y+         I+ G          +L+PPII R IR++PYS V   VC K + +GC F++D+LEY+IPQG+     DD  ++  ++   RN+               +   D  YDG     ++ L GGLG L D  +     V    + YR          IGW       QS +  + +   F F   RNFS++     + PS  I    RI+ +FS +  +        VE  + + N      +IK+D+  KTG+FV L   FA+QW+++SE+RFVS  +D
Sbjct:   39 ECDEPLLRE-STLPDSAFSATSNSEAMDQPAGEVSVDHSAKAARNLVDG-----GWCPAGKVGREFSEYIQIDMGALNVIVKIAFGGR----SGVGYTPSFLIRYTREVGD-NDWRDYKNCSSAS-TNIIAGSESNLDLKLLSLNPPIIARAIRLYPYSKVPMFVCAKFEFYGCRFTDDLLEYKIPQGS---LLDDPKILDSQSGLSRNVNDASFVPAAYPVVRTDALRDRCYDGQRDPHSEVLYGGLGCLCDTRVASQSNVLALFDPYREKASEPSECLIGWNRGRWDDQSSVGLEALEFVFRFSGLRNFSALYLQVVNLPSHQITLPHRIETTFSKNGLTFSRDPDLEVELASTV-NATSVIPTIKIDMRQKTGQFVQLRFFFATQWIVVSELRFVSTEVD 425          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A183QKB0 (F5/8 type C domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.383e-44
Identity = 127/403 (31.51%), Postives = 195/403 (48.39%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFI-PYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAA---------FFKDDMIKIRNSFERNLEY------FLDNGYDGTLFNDN--LVGGLGLLTD-------------NEIGLDFTVKETEAYRYIGWTQSPLKSKP------INIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDN---LMRNFNQSDH-----SIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            D +KC   LL +   +PDSAF+ATS  + P   K+  ++A + R     EN  FAWCP  ++     EY++ID+G L +I  V+  G  A+G G  +TP + IRY R      +W+ YR+ +     ++L G  DA +  F  LDPP+I R IRI+PY +    VC++L+ +GC FS+D++EY+IP+G+ A          +K    ++ N+ + N         F D  YDG        L GGLG L D               +G+      +  ++++GW +   KS        +++ F F + RNF+ +  Y  +     I    R+++ F     S+  V F     + R F   +      SI LD+  + G+ V L   FA  WLL SEIRF S
Sbjct:   54 DKTKCIQSLLVNRHQIPDSAFNATSEVVDPSGAKR--YNAHSIR----NENTDFAWCPGKRISTECDEYVEIDMGELNIITKVVISGLLAEGGGSRYTPYFYIRYKREINE-ENWRTYRQLRPTIISRLLGG-LDALVPKFVVLDPPLIARWIRIYPYRDTPGFVCIRLEAYGCRFSDDLVEYRIPEGSLAHPPYQAETNLYKSQGSEVFNTEKLNSSQAGGGLPFSDTCYDGHRIEPGSLLDGGLGCLIDLNSANRDTIPSIRQTVGVSSKADSSMNHQFVGWHRDRWKSSQDKDNDVVDMLFRFASVRNFTRLRLYISNNYLEKIRLPRRLEVKF-----SVGGVHFSGQLPISREFKLENRSLGVFSIILDLSHRIGQVVQLKAFFADDWLLFSEIRFES 443          
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Match: A0A4W5RR02 (Discoidin domain receptor family, member 2, like OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.936e-44
Identity = 118/371 (31.81%), Postives = 189/371 (50.94%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL----DNGYDGTLFNDNLVGGLGLLTDNEIGL-DFTVKET----EAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFS----SDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            DP+ CR  L  +   + D   +A+S +  Y+     + A+  RE  D      AWCP+  ++ S ++YLQ+DLG+LT + VV T+GR+A+ SGKEF  +Y++ YS       D + +R +K +   K +    +A++   + L PPII R +R+ P + +   VC++L+L+GC + + +  Y  P+G                   L YFL    D+ YDG      L GGLG LTD  IG  DF V         Y Y+GW    L S  + ++F+F  +RNF+S+  +S +  S  +  FS +  SF     ++ E+ + VEF  ++ + N S   + + +G +  K +    HFA  W++ SEI F S
Sbjct:   18 DPAHCRYPLGMEDGRIKDHDITASSQW--YETTGPQY-ARLNREEGDG-----AWCPAGLLQPSDTQYLQVDLGQLTFLTVVGTQGRYARNSGKEFARMYRLNYSH------DGQLWRTWKNRFGNKTMEANDNAYVSVIKDLHPPIISRYVRLIPVTKMPTTVCMRLELYGCPWHDGLTSYSSPEGQLMM--------------PLGYFLASLNDSTYDGAHERRKLSGGLGQLTDGVIGQDDFRVTRQYHVWPGYDYVGWRNGSLGSGYVEMEFVFDKQRNFTSMKVHSNNMFSRGVKIFSSVSCSFKPRLIANWEA-EPVEFRTVLDDRNPSARYVTVPLGRRNAKALRCRFHFADVWMMFSEISFQS 359          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 170.629 bits (431), Expect = 5.555e-43
Identity = 112/374 (29.95%), Postives = 192/374 (51.34%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD------QESLKT-VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            D +KCR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP+  V  S SE+LQ++L +L  + +V T+GR A G G+EF   Y++RYSR      D + +  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         I           Y  D+ YDG++    L GGLG L D  +G D  ++  E      Y Y+GW++  L    ++I+F F   R F  +  +S ++ +  +  FS +   F +       + +LK  V  ++L    + S  S+ L +GG+  + +     FA +WLL+SEI F S P +
Sbjct:   50 DSAKCRYALGMEDGTIPDSDISASSSWSDSTE------AKHGRLSTGEGDG--AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR------DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPI-----------YLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLK---DPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEPFE 395          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 170.629 bits (431), Expect = 5.895e-43
Identity = 112/374 (29.95%), Postives = 192/374 (51.34%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD------QESLKT-VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            D +KCR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP+  V  S SE+LQ++L +L  + +V T+GR A G G+EF   Y++RYSR      D + +  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         I           Y  D+ YDG++    L GGLG L D  +G D  ++  E      Y Y+GW++  L    ++I+F F   R F  +  +S ++ +  +  FS +   F +       + +LK  V  ++L    + S  S+ L +GG+  + +     FA +WLL+SEI F S P +
Sbjct:   31 DSAKCRYALGMEDGTIPDSDISASSSWSDSTE------AKHGRLSTGEGDG--AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR------DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPI-----------YLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLK---DPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEPFE 376          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr1 (discoidin domain receptor tyrosine kinase 1 [Source:NCBI gene;Acc:103035361])

HSP 1 Score: 170.629 bits (431), Expect = 5.914e-43
Identity = 112/374 (29.95%), Postives = 192/374 (51.34%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETE-----AYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSD------QESLKT-VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            D +KCR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP+  V  S SE+LQ++L +L  + +V T+GR A G G+EF   Y++RYSR      D + +  +K++  Q++++G  + +    + L PPII R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         I           Y  D+ YDG++    L GGLG L D  +G D  ++  E      Y Y+GW++  L    ++I+F F   R F  +  +S ++ +  +  FS +   F +       + +LK  V  ++L    + S  S+ L +GG+  + +     FA +WLL+SEI F S P +
Sbjct:   31 DSAKCRYALGMEDGTIPDSDISASSSWSDSTE------AKHGRLSTGEGDG--AWCPAGAVFPSGSEFLQVNLHKLHFLSLVGTQGRHADGHGREFARSYRLRYSR------DGRQWITWKDRWGQEVISGNENTYDVVLKDLGPPIIARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYAAPMGHVMHLSGSPI-----------YLNDSIYDGSIEAGTLFGGLGQLCDGVLGGDDFMESKELRVWPGYDYVGWSREALGQPTVDIEFHFEKTRIFHVMQVHSNNRHTQGVRVFSEVVCEFKASLLDHWTEPALKLRVPLEDLK---DPSSRSVDLPLGGRPAQILRCHFAFADRWLLISEISFNSEPFE 376          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000019857.2 (discoidin domain-containing receptor 2-like [Source:NCBI gene;Acc:103025914])

HSP 1 Score: 157.918 bits (398), Expect = 4.101e-39
Identity = 110/366 (30.05%), Postives = 177/366 (48.36%), Query Frame = 1
Query:  157 DPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFL-DNGYDGTLFNDNLVGGLGLLTDNEIGLD-FTVKET----EAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQE-SLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            +P  CR  L      + D   SA+S    + E  A   A+  R ++D  +   AWCP    E KSL E+LQIDL  L  + +V T+GR A G G EF   Y+I+YSR+   G  W ++    ++   ++++G  + +    + L+PPII R +R  P S+    VC++++L+GC + + ++ Y  P G    F+            NL  +L D  YDGT+ + ++  GLG LTD   GLD FT  +       Y Y+GWT +   S  + + F F   RNF+S+  +  +  +  +  F +    F S+ +   + V F     N N S   + + +G +    +     F+  W++ SEI F S
Sbjct:   22 NPGVCRYPLGMTGGKIQDEDISASSQ---WSESTA---ARYGRLDFDDGDG--AWCPDVVAEAKSLKEFLQIDLRTLHFVTLVGTQGRHADGMGNEFAQSYRIKYSRD---GVRWVSWH---DRNGGQVIDGNKNPYEVVLKDLEPPIIARFVRFMPVSDPSMTVCMRVELYGCEWLDGLVSYSAPVGQEMTFQ------------NLHVYLNDTVYDGTV-DHSMTEGLGQLTDGSWGLDNFTQSQVYGVWPGYDYVGWTNASFPSGSVEMVFEFDRVRNFTSMKVHCNNMYTSGVRAFQQAVCYFRSESDWEARPVSFKPEADNTNTSARFVTVALGHRMASAIKCRFAFSDAWMMFSEIAFQS 360          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Match: ddr2a (discoidin domain receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103037878])

HSP 1 Score: 152.525 bits (384), Expect = 2.028e-37
Identity = 110/370 (29.73%), Postives = 172/370 (46.49%), Query Frame = 1
Query:  142 AKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVE-KSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFTVKET----EAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKT-VEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            AK   +PS CR  L      + D   SA+S +          +AK  R   D E    AWCP    E +++ E+LQIDL  L  I +V T+GR A G G EF   Y+I+YSR+   GS W ++R    K   +++ G  +A+    + L PPII R +R  P  +    VC++++L+GC + + ++ Y  P G         I           Y  D+ YDG + + ++  GLG LTD   GL DFT          Y Y+GWT     +  + I F F   RNF+++  +  +  S  +  F ++   F S+ +   T V F  ++ + N S   + + +       +    +F+  W++ SEI F S
Sbjct:   29 AKSQVNPSVCRSPLGMSGGQILDEDISASSQW------SDSTAAKYGR--LDCEEGDGAWCPEIPGEPENMKEFLQIDLRSLHFITLVGTQGRHAGGIGNEFAQTYKIKYSRD---GSRWISWRNRHGK---QVIEGNRNAYDVVLQDLQPPIIARFVRFMPVIDHSMNVCMRVELYGCEWLDGLVSYNAPLGQKMILHSQPI-----------YLNDSVYDGAM-SYSMTEGLGQLTDGMCGLDDFTFSHVYNVWPGYDYVGWTNESFPNGYVEIMFEFDRTRNFTTMKVHCNNMFSQRVKTFQKVVCYFRSESDWEPTPVSFSPVVDDVNPSARFVTVSLNNHMASAIKCQYYFSDMWMMFSEITFQS 372          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007840.1 (pep scaffold:Pmarinus_7.0:GL477602:191978:197608:1 gene:ENSPMAG00000007091.1 transcript:ENSPMAT00000007840.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.188e-13
Identity = 37/117 (31.62%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  160 PSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYR 510
            P  CR  L      +PD   +A+S +  Y+   A ++        D E    AWCP   +     E+LQ+DL  L  I +V T+GR A+G+G E+   Y++ YSR+      W + R
Sbjct:    1 PGLCRYALGMQEGRIPDEDITASSQW--YETTAAHYA------RLDSEEGDGAWCPLGSISPQSMEFLQVDLRELHFITLVGTQGRHAEGTGNEYATAYRLEYSRDGSRWVMWHDRR 109          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004027.1 (pep scaffold:Pmarinus_7.0:GL481210:3001:5030:1 gene:ENSPMAG00000003685.1 transcript:ENSPMAT00000004027.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.511e-10
Identity = 48/160 (30.00%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  202 VPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIF 681
            V D+  SA+S F         +    AR   D++  + AW   +  +   +++LQIDLG    I  ++T+G    G   +F   Y++  S +   G+ W  Y K  E    KI  G  D         +PPII R +R+ PYS   +R+ L+++L GC F
Sbjct:   13 VGDTQISASSVFQTLGLPCWTWEPHLAR--LDRQGRINAW---SAAKGDPNQWLQIDLGEARKITGIVTQGARDLGH-MQFVRSYRVASSED---GAAWTVY-KDDETRRDKIFAGNYDNNSHKKNMFNPPIIARYVRVLPYS-WYRRITLRVELIGCDF 161          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001939.1 (pep scaffold:Pmarinus_7.0:GL476444:333387:405756:1 gene:ENSPMAG00000001736.1 transcript:ENSPMAT00000001939.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 1.042e-7
Identity = 53/191 (27.75%), Postives = 87/191 (45.55%), Query Frame = 1
Query:  118 FASFWIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKE-FTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSN 687
            F++ +  I + I +  KC   L  +   + D   +A+S + P +E    +  K AR N    N V AW P+    K   E++Q DLG L ++  + T+G  ++ S K  +   Y++  S N   G DW      KE     IL   +DA          P++ R +R+ P S     + L+ +L+GC  S+
Sbjct:  176 FSATYRMIQRKIIETVKCNQPLGMESLEIRDEQITASSMY-PNKE----WMPKQARLN----NPVHAWTPAADSNK---EWIQADLGYLKILSGIATQGAISKDSKKSYYVTSYKMEVSSN---GDDWM---MLKEGITIIILRNNSDASSLVENKFSEPVLTRFVRVRPRS-WENGIALRFELYGCHISD 347          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: EDIL3 (EGF like repeats and discoidin domains 3 [Source:HGNC Symbol;Acc:HGNC:3173])

HSP 1 Score: 51.6026 bits (122), Expect = 2.634e-7
Identity = 36/122 (29.51%), Postives = 56/122 (45.90%), Query Frame = 1
Query:  310 VFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGC 675
            V AW P +Q     S ++Q+DLGR   +  V T+G    GS  E+   + + +S +   G  W  YR+ +     +I  G  D        L P I  R +R+ P +    R  L+++L GC
Sbjct:  132 VNAWTPDDQ---DRSAWIQVDLGRAMRVSGVTTQGARRMGS-AEYIKKFTLAFSDD---GKTWSGYREARST-KNRIFPGNWDNSTPRVTALSPSITSRYVRLLP-TICHNRCTLRMELLGC 244          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007561.1 (pep scaffold:Pmarinus_7.0:GL479407:10781:33713:1 gene:ENSPMAG00000006808.1 transcript:ENSPMAT00000007561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 6.405e-7
Identity = 47/175 (26.86%), Postives = 76/175 (43.43%), Query Frame = 1
Query:  169 CRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKG-RFAQGS-----GKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGC 675
            C   L      VPD+A SA+S + P       + A AAR    +      W P      S  E+LQ+DLG L  ++ V+ +G R   G+     G  F   +++ +S +   G  W       E    KI NG ++  +      + P+  R++R++P       + L+L+L GC
Sbjct:  359 CLETLGVGQGHVPDNALSASSQWSP------PWGAHAARLLAPQRG----WAPHMAGLFSFDEWLQVDLGSLFTVRGVILQGVRGDLGTQDKPEGPLFVKKFRVGFSED---GDTWHMVTD-DESSQPKIFNGSSNVDLPEMRKFE-PVEARLVRVYPERWSPHGIGLRLELLGC 518          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO46425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ36])

HSP 1 Score: 68.5514 bits (166), Expect = 1.437e-13
Identity = 50/160 (31.25%), Postives = 79/160 (49.38%), Query Frame = 1
Query:  199 SVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCI 678
            ++ DSA +A+SY         +  +     ++ + N    W  ++Q   S  EY+QIDLGR+T +  V T+G     +  E+   Y+I YS +    S WK YR   E G +K+  G TD     +  L  PI+ R IRIF       R  L+++++GC+
Sbjct:    7 AISDSAITASSYH--------NVESFQLPPSHGRLNHGSVWASASQ---SPGEYIQIDLGRVTTVTKVATQG---NSNYDEWMTSYKIGYSTDL---STWKLYR---EGGQEKVFPGNTDGTTLVYGVLPQPIVTRGIRIFA-ETFQHRPALRMEIYGCM 145          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO46886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN6])

HSP 1 Score: 70.4774 bits (171), Expect = 1.120e-12
Identity = 57/188 (30.32%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  130 WIF----IAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFA-WCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRV-CLKLQLFGC 675
            WIF    +  V S    C   L      + DS  +A+S F  + + +A       R     E   F  WC     +     YLQID  R T+++V+ T+G   Q SG   T  Y + YS       D K +R++KE+  +KI +G  DA       L  PII R+IR+ P       + C++L+++GC
Sbjct:    8 WIFALLLLVIVRSTNGACSGTLGMTSGDIADSQITASSTFSDFTKPEA----ARLRNTGSIEQLTFGGWCAK---DGDTEPYLQIDFARETVLRVIATQG-LEQPSGNWVT-RYAVNYS------CDGKTWREYKEENKRKIFSGNDDAQSIVRNALRVPIIARLIRVLPLDKKQHGLACMRLEMYGC 180          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO37760 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SET3])

HSP 1 Score: 66.6254 bits (161), Expect = 1.161e-12
Identity = 50/176 (28.41%), Postives = 84/176 (47.73%), Query Frame = 1
Query:  169 CRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAAR--ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFK--EKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFP--YSNVLQRVCLKLQLFGCI 678
            C   L  + K +PDS  SA+S      E+    +A+  R  + + +   V AW P   V   L EYLQ+DL R T I  V T+GR   G    F   YQ+++S +   G+ W   +K      G +++L G T+ +      L      R +R  P  + ++   +C++++++GC+
Sbjct:   10 CTTALGMEDKGIPDSQISASS------ERTVYHAARFGRLHQEWAEGLTVGAWSP---VSDQLGEYLQVDLMRATRITGVATQGR---GGSYLFVRRYQLKHSLD---GTSWNTIKKVSNVSGGGKEMLVGNTEEYAVVRNFLSEVFTARFVRFCPTIWEHI---ICMRVEVYGCV 167          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO46426 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ38])

HSP 1 Score: 65.0846 bits (157), Expect = 2.165e-12
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  199 SVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCI 678
            ++ DSA +A+SY   Y            R N++       W  ++Q   S  EY+QIDLGR+T +  V T+G        E+   Y+I YS      S W+ Y    E G +K+  G TD+    +  L  PI  R IRI   + V  R   +++++GC+
Sbjct:    7 TINDSAITASSY---YHAGSLQLPPSHGRLNHES-----VWASASQ---SPGEYIQIDLGRVTTVTKVATQGNSNH---DEWMTSYKIGYSSYR---STWQIYH---EGGQEKVFPGKTDSNTIVYGVLAQPIATRGIRIIAVTFV-HRPAARVEIYGCM 145          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Match: EDO41138 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S537])

HSP 1 Score: 63.929 bits (154), Expect = 5.524e-12
Identity = 47/162 (29.01%), Postives = 77/162 (47.53%), Query Frame = 1
Query:  199 SVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGR--FAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCI 678
            ++ DSA +A+SY+     K                N   AW  ++Q   S  EY Q+DLGR+  +  V T+G   FA     E+   Y+I YS      SD   ++ ++E G +K+  G TD +   +  L  P++ R IRI   +    R  ++L+++GC+
Sbjct:    9 AISDSAITASSYWNSLPPKNGRL------------NNATAWGSASQ---SPGEYFQVDLGRVITVTKVATQGNRNFA-----EWMTSYKIGYS------SDLSIWKVYREGGQEKVFPGNTDRYTVVYGVLAQPVVTRGIRIIAVT-FEWRPVIRLEIYGCM 143          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 170.244 bits (430), Expect = 6.864e-43
Identity = 120/403 (29.78%), Postives = 200/403 (49.63%), Query Frame = 1
Query:   88 KTFRVVIVFSFASF-------WIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFT----VKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF--------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            + F V +V + A         W F       P +CR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP   V  S SEYLQIDL +L  + +V T+GR A G G+EFT  Y++RYSR+   G  W  +   K++  Q++++G T+      + L PPI+ R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         +           Y  D+ YDG+       GGLG L D  +G  DFT    ++    Y Y+GW++  L    ++I+F F   R F ++  +S ++ +  +  FS+++  F        SS   +L  V  ++L    + S   I + +G +  + +    +FA +WLL+SEI F+S P
Sbjct:    7 RLFPVTVVTALAVLVSAEEHEWHF------KPDQCRYALGMEAGTIPDSDISASSAWSDSTE------AKHGRLSTGEGDG--AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD---GVKWITW---KDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPV-----------YLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLP-VPLEDLK---DPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEP 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 170.244 bits (430), Expect = 8.265e-43
Identity = 120/403 (29.78%), Postives = 200/403 (49.63%), Query Frame = 1
Query:   88 KTFRVVIVFSFASF-------WIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFT----VKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF--------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            + F V +V + A         W F       P +CR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP   V  S SEYLQIDL +L  + +V T+GR A G G+EFT  Y++RYSR+   G  W  +   K++  Q++++G T+      + L PPI+ R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         +           Y  D+ YDG+       GGLG L D  +G  DFT    ++    Y Y+GW++  L    ++I+F F   R F ++  +S ++ +  +  FS+++  F        SS   +L  V  ++L    + S   I + +G +  + +    +FA +WLL+SEI F+S P
Sbjct:    7 RLFPVTVVTALAVLVSAEEHEWHF------KPDQCRYALGMEAGTIPDSDISASSAWSDSTE------AKHGRLSTGEGDG--AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD---GVKWITW---KDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPV-----------YLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLP-VPLEDLK---DPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEP 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 170.244 bits (430), Expect = 8.281e-43
Identity = 120/403 (29.78%), Postives = 200/403 (49.63%), Query Frame = 1
Query:   88 KTFRVVIVFSFASF-------WIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFT----VKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF--------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            + F V +V + A         W F       P +CR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP   V  S SEYLQIDL +L  + +V T+GR A G G+EFT  Y++RYSR+   G  W  +   K++  Q++++G T+      + L PPI+ R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         +           Y  D+ YDG+       GGLG L D  +G  DFT    ++    Y Y+GW++  L    ++I+F F   R F ++  +S ++ +  +  FS+++  F        SS   +L  V  ++L    + S   I + +G +  + +    +FA +WLL+SEI F+S P
Sbjct:    7 RLFPVTVVTALAVLVSAEEHEWHF------KPDQCRYALGMEAGTIPDSDISASSAWSDSTE------AKHGRLSTGEGDG--AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD---GVKWITW---KDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPV-----------YLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLP-VPLEDLK---DPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEP 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 170.244 bits (430), Expect = 8.281e-43
Identity = 120/403 (29.78%), Postives = 200/403 (49.63%), Query Frame = 1
Query:   88 KTFRVVIVFSFASF-------WIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFT----VKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF--------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYP 1236
            + F V +V + A         W F       P +CR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP   V  S SEYLQIDL +L  + +V T+GR A G G+EFT  Y++RYSR+   G  W  +   K++  Q++++G T+      + L PPI+ R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         +           Y  D+ YDG+       GGLG L D  +G  DFT    ++    Y Y+GW++  L    ++I+F F   R F ++  +S ++ +  +  FS+++  F        SS   +L  V  ++L    + S   I + +G +  + +    +FA +WLL+SEI F+S P
Sbjct:    7 RLFPVTVVTALAVLVSAEEHEWHF------KPDQCRYALGMEAGTIPDSDISASSAWSDSTE------AKHGRLSTGEGDG--AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD---GVKWITW---KDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPV-----------YLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLP-VPLEDLK---DPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLSEP 374          
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Match: ddr1 (epithelial discoidin domain-containing receptor 1 [Source:NCBI gene;Acc:101172605])

HSP 1 Score: 163.696 bits (413), Expect = 2.981e-41
Identity = 112/368 (30.43%), Postives = 189/368 (51.36%), Query Frame = 1
Query:  166 KCRVKLLNDYKSVPDSAFSATSYFIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGL-DFT----VKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISF--------SSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
            +CR  L  +  ++PDS  SA+S +    E      AK  R +  + +   AWCP   V  S SEYLQIDL +L  + +V T+GR A G G+EFT  Y++RYSR+   G  W  +   K++  Q++++G T+      + L PPI+ R++R +P ++ +  VCL+++L+GC++++ +  Y  P G         +           Y  D+ YDG+       GGLG L D  +G  DFT    ++    Y Y+GW++  L    ++I+F F   R F ++  +S ++ +  +  FS+++  F        SS   +L  V  ++L    + S   I + +G +  + +    +FA +WLL+SEI F+S
Sbjct:   24 QCRYALGMEAGTIPDSDISASSAWSDSTE------AKHGRLSTGEGDG--AWCPLGPVFPSGSEYLQIDLHKLHFLALVGTQGRHADGHGQEFTRSYRLRYSRD---GVKWITW---KDRWGQEVVSGNTNTHEVVLKDLGPPIVARMVRFYPLADRVMSVCLRVELYGCVWNDGLKAYTSPVGHVMNLPGLPV-----------YLNDSIYDGSTEQRMQFGGLGQLCDGVLGGDDFTQTKELRVWPGYDYVGWSREALGQGSVDIEFHFEKPRLFINMQVHSNNRHTQGVRVFSKVECLFKLGILLPWSSPPLTLP-VPLEDLK---DPSSRPISIPLGRRPAQILLCKFYFADRWLLISEISFLS 362          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000067889.1 (SMESG000067889.1)

HSP 1 Score: 883.634 bits (2282), Expect = 0.000e+0
Identity = 480/480 (100.00%), Postives = 480/480 (100.00%), Query Frame = 1
Query: 1348 AEDMREMKMKKLAENNSKISKQIDRSADSWKSSMEQIRKIAKKSQDSSQILDNVFTENENDRSEMDSDVQKDYQSPMMKEGNFRPVPHYYGPFRPLSQHANQTSVMLNQRYSIKTPDINYRMFSSYAPYAXXXXXXXXXXXXXXXXQSNAYAFNQPPIPKYFYPENRLANPWNGLFNPLSPPIMPPYSQLPNYVPPYQRPYNFYPPQQYSNMLPTNPNYFQPPSVFNPSVNSFRQYHQMRDDTSGIESMKKYVNSLLDKLELLNDTVAQLKNQNQNNDHPVRACSHHFRPRPSFNQEPRENHAFRSPSCCSCVKQTSRNYKSCSCWDVPNVNRRPASSLSETYSQGSGYNCQCNRPERKYSNNVQQNQHSHYQRSQIPPRPHRESPLPIRQQHKHXXXXXXXXXXXXSQPQQNITPNHCFRYSNPPRPPTSSLPIEQNTPGIAVVIXXXXXXXXXXXXXXXSDKSNDLLSMSELADMTDM 2787
            AEDMREMKMKKLAENNSKISKQIDRSADSWKSSMEQIRKIAKKSQDSSQILDNVFTENENDRSEMDSDVQKDYQSPMMKEGNFRPVPHYYGPFRPLSQHANQTSVMLNQRYSIKTPDINYRMFSSYAPYAMENNNMKNMNSMINANQSNAYAFNQPPIPKYFYPENRLANPWNGLFNPLSPPIMPPYSQLPNYVPPYQRPYNFYPPQQYSNMLPTNPNYFQPPSVFNPSVNSFRQYHQMRDDTSGIESMKKYVNSLLDKLELLNDTVAQLKNQNQNNDHPVRACSHHFRPRPSFNQEPRENHAFRSPSCCSCVKQTSRNYKSCSCWDVPNVNRRPASSLSETYSQGSGYNCQCNRPERKYSNNVQQNQHSHYQRSQIPPRPHRESPLPIRQQHKHNNFPTNPNYYYTSQPQQNITPNHCFRYSNPPRPPTSSLPIEQNTPGIAVVIDNSNNNNLTNVLVDSSDKSNDLLSMSELADMTDM
Sbjct:   20 AEDMREMKMKKLAENNSKISKQIDRSADSWKSSMEQIRKIAKKSQDSSQILDNVFTENENDRSEMDSDVQKDYQSPMMKEGNFRPVPHYYGPFRPLSQHANQTSVMLNQRYSIKTPDINYRMFSSYAPYAMENNNMKNMNSMINANQSNAYAFNQPPIPKYFYPENRLANPWNGLFNPLSPPIMPPYSQLPNYVPPYQRPYNFYPPQQYSNMLPTNPNYFQPPSVFNPSVNSFRQYHQMRDDTSGIESMKKYVNSLLDKLELLNDTVAQLKNQNQNNDHPVRACSHHFRPRPSFNQEPRENHAFRSPSCCSCVKQTSRNYKSCSCWDVPNVNRRPASSLSETYSQGSGYNCQCNRPERKYSNNVQQNQHSHYQRSQIPPRPHRESPLPIRQQHKHNNFPTNPNYYYTSQPQQNITPNHCFRYSNPPRPPTSSLPIEQNTPGIAVVIDNSNNNNLTNVLVDSSDKSNDLLSMSELADMTDM 499          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 323/326 (99.08%), Postives = 324/326 (99.39%), Query Frame = 1
Query:  274 KAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLDPVI 1251
            K  +ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLDPVI
Sbjct:    3 KFTKENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLDPVI 328          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 318/323 (98.45%), Postives = 320/323 (99.07%), Query Frame = 1
Query:  274 KAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            K  +ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSY L+
Sbjct:    3 KFTKENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYHLN 325          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000014159.1 (SMESG000014159.1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 317/320 (99.06%), Postives = 319/320 (99.69%), Query Frame = 1
Query:  283 RENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLD 1242
            +ENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSY L+
Sbjct:   20 KENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSIKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYHLN 339          
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Match: SMESG000000860.1 (SMESG000000860.1)

HSP 1 Score: 308.145 bits (788), Expect = 3.684e-92
Identity = 170/393 (43.26%), Postives = 250/393 (63.61%), Query Frame = 1
Query:   94 FRVVIVFSFASFWIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSYFIPYQ---EKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRLTMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEK-GFQKILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFSNDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVGGLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKS---KPINIKFIFLNRRNFSSITFYSFSKPSLDINYFSRIDISFSS-----DQESLKTVEFDNLMRN-FNQSDHS-IKLDVGGKTGKFVNLTLHFASQWLLLSEIRFVS 1230
             +++++FS   ++  I   I   SKC  KLL+D+  VPDSAF+A+SYFIP     EK  DFS KAARE YDK+N+ +AWCP N+V +SL +YL+IDLGRLT+I    T+GRFAQG+GKEF+P Y+I+Y R     S+WK Y++F    G++++L GP D F+DA+ETLDPPI+ R +RI+P+S  L RVCLKLQLFGCIF + ++EY+I +G+    K+  +++   +      F D+ +DGT     L+ GLG L DN+ G +F++   EA  Y+GW ++ + S   K + + F F + RNFSS   Y F   +L I+   +++  FS       Q++    E   LM + F+ S    I  ++  K G+++ L L+F S+W+LLSEI F+S
Sbjct:    3 LQILVLFSI--YFKQIYSKIDSRSKCGSKLLDDFNLVPDSAFTASSYFIPTSRTTEKMMDFSPKAAREIYDKDNQDYAWCPRNKVAQSLEDYLEIDLGRLTVINYAQTRGRFAQGAGKEFSPFYKIQYRRE--ETSNWKLYKRFDVNLGYREVLKGPNDPFLDAYETLDPPIVTRWVRIYPFSYELMRVCLKLQLFGCIFEDHVMEYRIHEGSIP--KNSFLQLSGIYPAVYNVFQDSSFDGTNDQGLLINGLGRLIDNKTGGNFSLDPNEAMHYVGWNRNEIGSSNEKSVTLWFRFDSVRNFSSAKLYIFENHTLKISQPVKMEAKFSLYGDKFSQKNTIIAENPELMSDSFSDSKSPWIYFNMQEKIGQYLQLKLYFKSEWILLSEIDFIS 389          
The following BLAST results are available for this feature:
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDR26.002e-4029.65discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR26.002e-4029.65discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR26.002e-4029.65discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
DDR11.527e-3729.23discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
DDR11.527e-3729.23discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ddr-12.108e-2626.29Discoidin domain-containing receptor A [Source:Un... [more]
ddr-25.227e-2428.81Discoidin domain-containing receptor tyrosine kina... [more]
ddr-26.800e-2429.97Discoidin domain-containing receptor tyrosine kina... [more]
ddr-26.800e-2429.97Discoidin domain-containing receptor tyrosine kina... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smal6.488e-4130.27gene:FBgn0085409 transcript:FBtr0329980[more]
smal6.488e-4130.27gene:FBgn0085409 transcript:FBtr0112617[more]
Ddr1.218e-4028.02gene:FBgn0053531 transcript:FBtr0344771[more]
Ddr1.218e-4028.02gene:FBgn0053531 transcript:FBtr0344770[more]
smal2.174e-4030.27gene:FBgn0085409 transcript:FBtr0329979[more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr13.997e-4428.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr14.645e-4428.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr14.645e-4428.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr15.315e-4428.00discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr2l4.878e-4229.97discoidin domain receptor family, member 2, like [... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr2l4.099e-4028.84discoidin domain receptor tyrosine kinase 2 like [... [more]
ddr2l6.283e-3928.57discoidin domain receptor tyrosine kinase 2 like [... [more]
ddr2l6.340e-3928.57discoidin domain receptor tyrosine kinase 2 like [... [more]
pitpnc1l3.781e-3830.18phosphatidylinositol transfer protein cytoplasmic ... [more]
pitpnc1l4.345e-3830.18phosphatidylinositol transfer protein cytoplasmic ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddr26.375e-4029.92discoidin domain receptor family, member 2 [Source... [more]
Ddr26.375e-4029.92discoidin domain receptor family, member 2 [Source... [more]
Ddr26.375e-4029.92discoidin domain receptor family, member 2 [Source... [more]
Ddr12.952e-3828.92discoidin domain receptor family, member 1 [Source... [more]
Ddr12.656e-3728.92discoidin domain receptor family, member 1 [Source... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16832|DDR2_HUMAN2.883e-3929.65Discoidin domain-containing receptor 2 OS=Homo sap... [more]
sp|Q62371|DDR2_MOUSE4.459e-3929.92Discoidin domain-containing receptor 2 OS=Mus musc... [more]
sp|Q7YR43|DDR1_PANTR7.891e-3729.78Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q08345|DDR1_HUMAN9.499e-3729.23Epithelial discoidin domain-containing receptor 1 ... [more]
sp|Q03146|DDR1_MOUSE2.090e-3628.92Epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NVU82.529e-4533.50Epithelial discoidin domain-containing receptor 1 ... [more]
A0A5N4AEF63.756e-4530.41Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A0X3PFD16.994e-4533.75F5/8 type C domain-containing protein OS=Schistoce... [more]
A0A183QKB01.383e-4431.51F5/8 type C domain-containing protein OS=Schistoso... [more]
A0A4W5RR021.936e-4431.81Discoidin domain receptor family, member 2, like O... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr15.555e-4329.95discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr15.895e-4329.95discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ddr15.914e-4329.95discoidin domain receptor tyrosine kinase 1 [Sourc... [more]
ENSAMXT00000019857.24.101e-3930.05discoidin domain-containing receptor 2-like [Sourc... [more]
ddr2a2.028e-3729.73discoidin domain receptor tyrosine kinase 2 [Sourc... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007840.11.188e-1331.62pep scaffold:Pmarinus_7.0:GL477602:191978:197608:1... [more]
ENSPMAT00000004027.11.511e-1030.00pep scaffold:Pmarinus_7.0:GL481210:3001:5030:1 gen... [more]
ENSPMAT00000001939.11.042e-727.75pep scaffold:Pmarinus_7.0:GL476444:333387:405756:1... [more]
EDIL32.634e-729.51EGF like repeats and discoidin domains 3 [Source:H... [more]
ENSPMAT00000007561.16.405e-726.86pep scaffold:Pmarinus_7.0:GL479407:10781:33713:1 g... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO464251.437e-1331.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468861.120e-1230.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377601.161e-1228.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464262.165e-1230.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411385.524e-1229.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddr16.864e-4329.78epithelial discoidin domain-containing receptor 1 ... [more]
ddr18.265e-4329.78epithelial discoidin domain-containing receptor 1 ... [more]
ddr18.281e-4329.78epithelial discoidin domain-containing receptor 1 ... [more]
ddr18.281e-4329.78epithelial discoidin domain-containing receptor 1 ... [more]
ddr12.981e-4130.43epithelial discoidin domain-containing receptor 1 ... [more]
back to top
BLAST of Discoidin domain-containing receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067889.10.000e+0100.00SMESG000067889.1[more]
SMESG000014159.10.000e+099.08SMESG000014159.1[more]
SMESG000014159.10.000e+098.45SMESG000014159.1[more]
SMESG000014159.10.000e+099.06SMESG000014159.1[more]
SMESG000000860.13.684e-9243.26SMESG000000860.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033242 ID=SMED30033242|Name=Discoidin domain-containing receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2951bp
AATGAGAACTCAATGAATTCAATATGATAATAACAATGCTAAGCATTTTG
ATTTTATATCCATCAGTCAATACAAAAAAATTGCATGAAAACGTTTCGGG
TTGTAATTGTTTTTTCTTTTGCTTCATTCTGGATTTTTATCGCCAAAGTT
ATTAGCGACCCCAGTAAATGCAGAGTGAAACTACTCAATGATTATAAAAG
TGTTCCAGATTCAGCGTTCAGTGCCACGAGCTATTTCATACCATATCAAG
AGAAAAAGGCAGATTTTTCCGCTAAAGCTGCTAGGGAAAATTACGATAAA
GAAAATGAAGTGTTCGCCTGGTGTCCGTCAAATCAAGTGGAAAAATCATT
ATCGGAATATTTGCAGATAGATCTCGGAAGACTGACGATGATAAAAGTCG
TTTTAACAAAAGGCCGATTTGCTCAAGGATCGGGGAAAGAATTCACACCG
TTATATCAGATTCGCTATTCTCGAAACAATGGATCAGGATCAGACTGGAA
AAATTATCGAAAATTCAAAGAAAAAGGTTTTCAAAAAATTTTAAATGGTC
CGACCGATGCTTTTATTGATGCGTTTGAGACCTTAGACCCCCCAATTATT
GGCAGGGTCATTCGGATATTTCCTTATAGCAATGTCCTTCAGAGAGTGTG
TTTGAAATTGCAACTATTTGGATGTATATTTTCAAACGATATTCTTGAAT
ATCAGATTCCACAAGGAACGGCAGCATTTTTTAAAGATGACATGATTAAA
ATCAGAAATTCATTCGAAAGGAATCTGGAATATTTTCTTGACAATGGTTA
CGATGGAACATTATTCAATGACAATCTTGTTGGTGGTTTGGGTCTGCTTA
CCGACAATGAGATCGGACTCGATTTTACAGTTAAGGAAACCGAAGCATAT
CGATATATTGGTTGGACTCAAAGTCCTTTAAAGTCCAAACCAATAAACAT
CAAATTCATTTTTTTAAACAGACGGAATTTTTCATCAATAACTTTTTACA
GCTTCTCCAAACCCTCACTTGATATTAATTATTTCTCGAGAATCGACATC
TCCTTCAGCAGTGATCAGGAATCATTGAAAACTGTGGAATTTGATAACTT
AATGCGGAATTTCAACCAATCCGACCATTCAATCAAGCTCGATGTCGGCG
GCAAAACGGGCAAATTCGTTAATTTGACTCTTCATTTCGCCTCTCAATGG
TTGTTATTGAGTGAAATTAGATTCGTCAGCTATCCGCTCGATCCAGTAAT
CAATGGAAACAAATTTTCGCTCGGGAAAAATAATAATAATAATAATATTA
ATAATAATATTAATAATAATAAAAATAAATCAGAAAATAAAAATAAAGCT
GAAGACATGAGAGAGATGAAAATGAAAAAGTTGGCGGAAAATAATTCCAA
AATATCAAAACAAATAGATAGGTCAGCGGATTCTTGGAAATCCTCGATGG
AACAAATACGAAAGATCGCCAAGAAATCACAAGATTCCTCACAAATATTG
GACAATGTTTTCACAGAAAATGAAAATGATCGTTCTGAAATGGACAGTGA
TGTACAAAAGGATTATCAAAGTCCTATGATGAAAGAAGGAAATTTCCGTC
CTGTTCCTCATTATTACGGACCATTTCGACCTTTAAGTCAACATGCTAAC
CAAACTTCTGTTATGCTTAACCAAAGGTATTCAATAAAAACCCCTGACAT
CAATTACAGGATGTTTAGTTCTTACGCTCCCTATGCAATGGAGAATAACA
ATATGAAGAATATGAATAGTATGATAAATGCCAACCAATCAAATGCTTAC
GCCTTCAACCAACCGCCGATTCCTAAATATTTTTATCCCGAAAATAGATT
AGCAAATCCTTGGAATGGTCTGTTTAATCCACTTAGCCCACCAATAATGC
CACCATATTCACAGCTTCCAAACTATGTTCCACCTTATCAAAGACCATAT
AATTTTTATCCTCCACAACAATATTCTAACATGCTGCCAACTAATCCCAA
CTATTTCCAACCTCCATCGGTCTTTAACCCATCAGTGAACTCGTTCCGTC
AGTATCATCAGATGCGAGACGACACAAGCGGGATTGAGTCAATGAAAAAA
TACGTAAATTCTCTGTTAGATAAGTTAGAATTGTTGAATGACACTGTTGC
ACAGTTAAAAAATCAAAACCAAAACAACGATCACCCAGTTAGAGCATGTT
CGCATCATTTTCGGCCTCGTCCTTCATTTAACCAGGAACCGCGTGAGAAT
CATGCATTTCGTTCACCCAGTTGTTGTTCTTGTGTGAAACAAACTTCAAG
AAATTATAAATCCTGTAGTTGTTGGGATGTTCCAAATGTAAACAGGCGAC
CAGCGAGTTCTTTAAGTGAAACCTATTCCCAAGGATCGGGATATAATTGT
CAATGTAACCGTCCAGAAAGAAAATACAGTAATAATGTCCAACAGAATCA
ACACTCACATTATCAACGTTCCCAAATTCCTCCTCGGCCACATCGGGAAT
CTCCTCTTCCAATTCGTCAGCAACATAAACATAATAACTTTCCTACAAAT
CCAAATTATTATTATACCAGCCAACCTCAACAGAATATAACCCCCAATCA
CTGTTTCAGGTATTCGAATCCGCCCCGGCCGCCGACCTCCTCCCTCCCCA
TCGAGCAAAATACCCCAGGGATCGCGGTAGTCATTGATAATAGTAATAAC
AATAATTTAACGAATGTTCTTGTTGATTCGAGTGATAAAAGCAATGATTT
ATTGTCGATGTCCGAACTGGCTGATATGACTGATATGTAGATTATACTAA
AAATATATTTTATAACCCCCCATGATTTATTAATTAATTCAATATTTTTT
TTATTCCGTATATTTCAATATGGATTATTTTGCAATTCTAGCATATTTTG
CACTTTTCGTTTGCTGTTAATTTCTTTCAAATGTACATTTTCACTTTCTT
T
back to top

protein sequence of SMED30033242-orf-1

>SMED30033242-orf-1 ID=SMED30033242-orf-1|Name=SMED30033242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=902bp
MKTFRVVIVFSFASFWIFIAKVISDPSKCRVKLLNDYKSVPDSAFSATSY
FIPYQEKKADFSAKAARENYDKENEVFAWCPSNQVEKSLSEYLQIDLGRL
TMIKVVLTKGRFAQGSGKEFTPLYQIRYSRNNGSGSDWKNYRKFKEKGFQ
KILNGPTDAFIDAFETLDPPIIGRVIRIFPYSNVLQRVCLKLQLFGCIFS
NDILEYQIPQGTAAFFKDDMIKIRNSFERNLEYFLDNGYDGTLFNDNLVG
GLGLLTDNEIGLDFTVKETEAYRYIGWTQSPLKSKPINIKFIFLNRRNFS
SITFYSFSKPSLDINYFSRIDISFSSDQESLKTVEFDNLMRNFNQSDHSI
KLDVGGKTGKFVNLTLHFASQWLLLSEIRFVSYPLDPVINGNKFSLGKNN
NNNNINNNINNNKNKSENKNKAEDMREMKMKKLAENNSKISKQIDRSADS
WKSSMEQIRKIAKKSQDSSQILDNVFTENENDRSEMDSDVQKDYQSPMMK
EGNFRPVPHYYGPFRPLSQHANQTSVMLNQRYSIKTPDINYRMFSSYAPY
AMENNNMKNMNSMINANQSNAYAFNQPPIPKYFYPENRLANPWNGLFNPL
SPPIMPPYSQLPNYVPPYQRPYNFYPPQQYSNMLPTNPNYFQPPSVFNPS
VNSFRQYHQMRDDTSGIESMKKYVNSLLDKLELLNDTVAQLKNQNQNNDH
PVRACSHHFRPRPSFNQEPRENHAFRSPSCCSCVKQTSRNYKSCSCWDVP
NVNRRPASSLSETYSQGSGYNCQCNRPERKYSNNVQQNQHSHYQRSQIPP
RPHRESPLPIRQQHKHNNFPTNPNYYYTSQPQQNITPNHCFRYSNPPRPP
TSSLPIEQNTPGIAVVIDNSNNNNLTNVLVDSSDKSNDLLSMSELADMTD
M*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR029553DDR1
IPR000421FA58C
IPR008979Galactose-bd-like_sf
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043235receptor complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007565female pregnancy
GO:0007566embryo implantation
GO:0007595lactation
GO:0008285negative regulation of cell proliferation
GO:0010715regulation of extracellular matrix disassembly
GO:0014909smooth muscle cell migration
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0038063collagen-activated tyrosine kinase receptor signaling pathway
GO:0038083peptidyl-tyrosine autophosphorylation
GO:0043583ear development
GO:0044319wound healing, spreading of cells
GO:0046777protein autophosphorylation
GO:0060444branching involved in mammary gland duct morphogenesis
GO:0060749mammary gland alveolus development
GO:0061302smooth muscle cell-matrix adhesion
GO:0061564axon development
GO:1990138neuron projection extension
GO:0001558regulation of cell growth
GO:0001952regulation of cell-matrix adhesion
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0016740transferase activity
GO:0038062protein tyrosine kinase collagen receptor activity
GO:0046872metal ion binding
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005518collagen binding
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000421Coagulation factor 5/8 C-terminal domainSMARTSM00231disc_4coord: 44..197
e-value: 0.005
score: 24.2
IPR000421Coagulation factor 5/8 C-terminal domainPFAMPF00754F5_F8_type_Ccoord: 71..182
e-value: 1.5E-11
score: 44.5
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS01285FA58C_1coord: 78..110
IPR000421Coagulation factor 5/8 C-terminal domainPROSITEPS50022FA58C_3coord: 29..197
score: 25.241
NoneNo IPR availableGENE3DG3DSA:2.60.120.1190coord: 202..386
e-value: 1.5E-35
score: 124.4
NoneNo IPR availablePANTHERPTHR24416TYROSINE-PROTEIN KINASE RECEPTORcoord: 24..390
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.711
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
IPR008979Galactose-binding-like domain superfamilyGENE3DG3DSA:2.60.120.260coord: 18..201
e-value: 7.0E-31
score: 109.2
IPR008979Galactose-binding-like domain superfamilySUPERFAMILYSSF49785Galactose-binding domain-likecoord: 29..197
IPR029553Epithelial discoidin domain-containing receptor 1PANTHERPTHR24416:SF333EPITHELIAL DISCOIDIN DOMAIN-CONTAINING RECEPTOR 1coord: 24..390