TFIIB-type domain-containing protein

Overview
NameTFIIB-type domain-containing protein
Smed IDSMED30033223
Length (bp)1088
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of TFIIB-type domain-containing protein vs. Ensembl Human
Match: GTF2B (general transcription factor IIB [Source:HGNC Symbol;Acc:HGNC:4648])

HSP 1 Score: 69.3218 bits (168), Expect = 1.075e-20
Identity = 63/223 (28.25%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLCLPK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.447 bits (119), Expect = 1.075e-20
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Human
Match: GTF2B (general transcription factor IIB [Source:HGNC Symbol;Acc:HGNC:4648])

HSP 1 Score: 64.6994 bits (156), Expect = 4.019e-19
Identity = 48/160 (30.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVL 714
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L
Sbjct:   43 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL 201          

HSP 2 Score: 49.6766 bits (117), Expect = 4.019e-19
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:    9 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 43          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Human
Match: GTF2B (general transcription factor IIB [Source:HGNC Symbol;Acc:HGNC:4648])

HSP 1 Score: 65.0846 bits (157), Expect = 2.126e-16
Identity = 48/160 (30.00%), Postives = 80/160 (50.00%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVL 714
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L
Sbjct:   39 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL 197          

HSP 2 Score: 40.0466 bits (92), Expect = 2.126e-16
Identity = 15/32 (46.88%), Postives = 21/32 (65.62%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVV 181
            L ++ C  H  A+L+EDY AGD+IC  C  V+
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECDRVI 41          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Celegans
Match: ttb-1 (Transcription initiation factor IIB [Source:UniProtKB/Swiss-Prot;Acc:O16991])

HSP 1 Score: 73.559 bits (179), Expect = 4.221e-20
Identity = 69/223 (30.94%), Postives = 105/223 (47.09%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSF---DAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF---VFKKPSSIMAGTIYMG 885
            R++D   EWRSF+N+  G+D  RVGA E    S    S TI   F   D+ +   N ++K  N       ++ +      I  +++R+ L   I+ SA ++ K + +      KN EA +AACL+  C+++   R  KE  AV+ + K   I +  KIIV+ L  N +       + RF   L + N S++     IAK A        + P SI A  IYM 
Sbjct:   36 RLVDVGTEWRSFSNERSGNDPSRVGAPENPLLSGGDLSTTIAVGFGGSDSDNSLANAQRKSMNNT-----DRQMTAAMSLIREMSERIHLPRNIQDSASRIFKDVLESKALRGKNNEAQAAACLYIACRKDGVPRTFKEICAVSRVSKKE-IGRCFKIIVRSLETNLEQITSADFMSRFCGNLSLPN-SIQAAATRIAKCAVDMDLVAGRTPISIAAAAIYMA 251          

HSP 2 Score: 43.1282 bits (100), Expect = 4.221e-20
Identity = 18/30 (60.00%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            C  H    LIED+ AGDL+C  C LVVGDR
Sbjct:    7 CPIHPDVHLIEDHRAGDLVCPACGLVVGDR 36          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Celegans
Match: ttb-1 (Transcription initiation factor IIB [Source:UniProtKB/Swiss-Prot;Acc:O16991])

HSP 1 Score: 73.559 bits (179), Expect = 4.221e-20
Identity = 69/223 (30.94%), Postives = 105/223 (47.09%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSF---DAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF---VFKKPSSIMAGTIYMG 885
            R++D   EWRSF+N+  G+D  RVGA E    S    S TI   F   D+ +   N ++K  N       ++ +      I  +++R+ L   I+ SA ++ K + +      KN EA +AACL+  C+++   R  KE  AV+ + K   I +  KIIV+ L  N +       + RF   L + N S++     IAK A        + P SI A  IYM 
Sbjct:   36 RLVDVGTEWRSFSNERSGNDPSRVGAPENPLLSGGDLSTTIAVGFGGSDSDNSLANAQRKSMNNT-----DRQMTAAMSLIREMSERIHLPRNIQDSASRIFKDVLESKALRGKNNEAQAAACLYIACRKDGVPRTFKEICAVSRVSKKE-IGRCFKIIVRSLETNLEQITSADFMSRFCGNLSLPN-SIQAAATRIAKCAVDMDLVAGRTPISIAAAAIYMA 251          

HSP 2 Score: 43.1282 bits (100), Expect = 4.221e-20
Identity = 18/30 (60.00%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            C  H    LIED+ AGDL+C  C LVVGDR
Sbjct:    7 CPIHPDVHLIEDHRAGDLVCPACGLVVGDR 36          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Celegans
Match: ttb-1 (Transcription initiation factor IIB [Source:UniProtKB/Swiss-Prot;Acc:O16991])

HSP 1 Score: 73.559 bits (179), Expect = 4.221e-20
Identity = 69/223 (30.94%), Postives = 105/223 (47.09%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSF---DAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF---VFKKPSSIMAGTIYMG 885
            R++D   EWRSF+N+  G+D  RVGA E    S    S TI   F   D+ +   N ++K  N       ++ +      I  +++R+ L   I+ SA ++ K + +      KN EA +AACL+  C+++   R  KE  AV+ + K   I +  KIIV+ L  N +       + RF   L + N S++     IAK A        + P SI A  IYM 
Sbjct:   36 RLVDVGTEWRSFSNERSGNDPSRVGAPENPLLSGGDLSTTIAVGFGGSDSDNSLANAQRKSMNNT-----DRQMTAAMSLIREMSERIHLPRNIQDSASRIFKDVLESKALRGKNNEAQAAACLYIACRKDGVPRTFKEICAVSRVSKKE-IGRCFKIIVRSLETNLEQITSADFMSRFCGNLSLPN-SIQAAATRIAKCAVDMDLVAGRTPISIAAAAIYMA 251          

HSP 2 Score: 43.1282 bits (100), Expect = 4.221e-20
Identity = 18/30 (60.00%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            C  H    LIED+ AGDL+C  C LVVGDR
Sbjct:    7 CPIHPDVHLIEDHRAGDLVCPACGLVVGDR 36          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Fly
Match: TfIIB (gene:FBgn0004915 transcript:FBtr0080025)

HSP 1 Score: 69.3218 bits (168), Expect = 2.675e-23
Identity = 63/222 (28.38%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYM 882
            RVID  +EWR+F+N+  G D  RVG  E    S    S  I     +      G  K++N   +S +++ + +  + IS++ADR+ L   I   A  + K++        ++ +A ++ACL+  C++    R  KE  AV+ + K   I +  K+ +K L     S ++I     + RF   L + N+ V++    IAK A +      + P S+ A  IYM
Sbjct:   43 RVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKE-IGRCFKLTLKAL---ETSVDLITTADFMCRFCANLDLPNM-VQRAATHIAKKAVEMDIVPGRSPISVAAAAIYM 259          

HSP 2 Score: 51.2174 bits (121), Expect = 2.675e-23
Identity = 22/34 (64.71%), Postives = 26/34 (76.47%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +K+CC  H  + LIEDY AGD+ICS C LVVGDR
Sbjct:   10 NKVCCYAHPESPLIEDYRAGDMICSECGLVVGDR 43          

HSP 3 Score: 27.335 bits (59), Expect = 2.675e-23
Identity = 11/34 (32.35%), Postives = 20/34 (58.82%), Query Frame = 2
Query:  905 R*QENIKNVVGVSENTTASVYKILFENKESLIPE 1006
            R Q+ I ++ GV++ T    YK+++ +   L PE
Sbjct:  268 RSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFPE 301          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Fly
Match: TfIIB (gene:FBgn0004915 transcript:FBtr0333489)

HSP 1 Score: 69.3218 bits (168), Expect = 2.675e-23
Identity = 63/222 (28.38%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYM 882
            RVID  +EWR+F+N+  G D  RVG  E    S    S  I     +      G  K++N   +S +++ + +  + IS++ADR+ L   I   A  + K++        ++ +A ++ACL+  C++    R  KE  AV+ + K   I +  K+ +K L     S ++I     + RF   L + N+ V++    IAK A +      + P S+ A  IYM
Sbjct:   43 RVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKE-IGRCFKLTLKAL---ETSVDLITTADFMCRFCANLDLPNM-VQRAATHIAKKAVEMDIVPGRSPISVAAAAIYM 259          

HSP 2 Score: 51.2174 bits (121), Expect = 2.675e-23
Identity = 22/34 (64.71%), Postives = 26/34 (76.47%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +K+CC  H  + LIEDY AGD+ICS C LVVGDR
Sbjct:   10 NKVCCYAHPESPLIEDYRAGDMICSECGLVVGDR 43          

HSP 3 Score: 27.335 bits (59), Expect = 2.675e-23
Identity = 11/34 (32.35%), Postives = 20/34 (58.82%), Query Frame = 2
Query:  905 R*QENIKNVVGVSENTTASVYKILFENKESLIPE 1006
            R Q+ I ++ GV++ T    YK+++ +   L PE
Sbjct:  268 RSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFPE 301          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Zebrafish
Match: gtf2b (general transcription factor IIB [Source:ZFIN;Acc:ZDB-GENE-030131-3544])

HSP 1 Score: 68.1662 bits (165), Expect = 2.576e-20
Identity = 59/223 (26.46%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+N+    D  RVG  +    +    +  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      ++ +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNEKATKDPSRVGDAQNPLLNGGDLTTMISKGTGAASFDEFGNSKYQNRRTMSSSDRAMLNAFKEITTMADRINLPRNIIDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLGLPK-QVQMAATYIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.0618 bits (118), Expect = 2.576e-20
Identity = 21/35 (60.00%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L K+ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPKVQCPNHPDALLVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Xenopus
Match: rars2 (arginyl-tRNA synthetase 2, mitochondrial [Source:Xenbase;Acc:XB-GENE-976890])

HSP 1 Score: 73.1738 bits (178), Expect = 3.423e-22
Identity = 60/220 (27.27%), Postives = 101/220 (45.91%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    S    +  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      ++ +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L  N         + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   50 RVIDVGSEWRTFSNDKAAKDPSRVGDAQNPLLSGGDLTTMIGKGTGAASFDEFGNNKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKALETNVDLITTGDFMSRFCSNLGLTK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 267          

HSP 2 Score: 51.9878 bits (123), Expect = 3.423e-22
Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L K+ C  H  A+L+EDY AGD+ICS C LVVGDR
Sbjct:   16 LPKVTCPNHPDALLVEDYRAGDMICSECGLVVGDR 50          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Xenopus
Match: rars2 (arginyl-tRNA synthetase 2, mitochondrial [Source:Xenbase;Acc:XB-GENE-976890])

HSP 1 Score: 73.1738 bits (178), Expect = 3.481e-22
Identity = 60/220 (27.27%), Postives = 101/220 (45.91%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    S    +  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      ++ +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L  N         + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKAAKDPSRVGDAQNPLLSGGDLTTMIGKGTGAASFDEFGNNKYQNRRTMSSSDRAMMNAFKEITNMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKALETNVDLITTGDFMSRFCSNLGLTK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 51.9878 bits (123), Expect = 3.481e-22
Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L K+ C  H  A+L+EDY AGD+ICS C LVVGDR
Sbjct:   10 LPKVTCPNHPDALLVEDYRAGDMICSECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Mouse
Match: Gtf2b (general transcription factor IIB [Source:MGI Symbol;Acc:MGI:2385191])

HSP 1 Score: 69.707 bits (169), Expect = 7.230e-21
Identity = 63/223 (28.25%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLCLPK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.447 bits (119), Expect = 7.230e-21
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P29052|TF2B_DROME (Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.025e-22
Identity = 63/222 (28.38%), Postives = 106/222 (47.75%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYM 882
            RVID  +EWR+F+N+  G D  RVG  E    S    S  I     +      G  K++N   +S +++ + +  + IS++ADR+ L   I   A  + K++        ++ +A ++ACL+  C++    R  KE  AV+ + K   I +  K+ +K L     S ++I     + RF   L + N+ V++    IAK A +      + P S+ A  IYM
Sbjct:   43 RVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLSGGDLSTIIGPGTGSASFDAFGAPKYQNRRTMSSSDRSLISAFKEISSMADRINLPKTIVDRANNLFKQVHDGKNLKGRSNDAKASACLYIACRQEGVPRTFKEICAVSKISKKE-IGRCFKLTLKAL---ETSVDLITTADFMCRFCANLDLPNM-VQRAATHIAKKAVEMDIVPGRSPISVAAAAIYM 259          

HSP 2 Score: 51.2174 bits (121), Expect = 2.025e-22
Identity = 22/34 (64.71%), Postives = 26/34 (76.47%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +K+CC  H  + LIEDY AGD+ICS C LVVGDR
Sbjct:   10 NKVCCYAHPESPLIEDYRAGDMICSECGLVVGDR 43          

HSP 3 Score: 27.335 bits (59), Expect = 2.025e-22
Identity = 11/34 (32.35%), Postives = 20/34 (58.82%), Query Frame = 2
Query:  905 R*QENIKNVVGVSENTTASVYKILFENKESLIPE 1006
            R Q+ I ++ GV++ T    YK+++ +   L PE
Sbjct:  268 RSQKEIGDIAGVADVTIRQSYKLMYPHAAKLFPE 301          
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P29054|TF2B_XENLA (Transcription initiation factor IIB OS=Xenopus laevis OX=8355 GN=gtf2b PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 1.192e-20
Identity = 58/220 (26.36%), Postives = 101/220 (45.91%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    S    +  I +   +    E G  K++N   +S +++ +    + I+ ++DR+ L   I      + K++ +      ++ +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L  N         + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKAAADPSRVGDAQNPLLSGGDLTTMIGKGTGSASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITNMSDRINLPRNIIDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKALETNVDLITTGDFMSRFCSNLGLTK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 51.9878 bits (123), Expect = 1.192e-20
Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L K+ C  H  A+L+EDY AGD+ICS C LVVGDR
Sbjct:   10 LPKVTCPNHPDALLVEDYRAGDMICSECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P62916|TF2B_RAT (Transcription initiation factor IIB OS=Rattus norvegicus OX=10116 GN=Gtf2b PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.294e-20
Identity = 63/223 (28.25%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLCLPK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.447 bits (119), Expect = 4.294e-20
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|P62915|TF2B_MOUSE (Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 4.294e-20
Identity = 63/223 (28.25%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLCLPK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.447 bits (119), Expect = 4.294e-20
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R886|TF2B_PONAB (Transcription initiation factor IIB OS=Pongo abelii OX=9601 GN=GTF2B PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 4.662e-20
Identity = 63/223 (28.25%), Postives = 104/223 (46.64%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYMG 885
            RVID  +EWR+F+ND    D  RVG  +    SD   S  I +   A    E G  K++N   +S +++ +    + I+ +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM 
Sbjct:   44 RVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLCLPK-QVQMAATHIARKAVELDLVPGRSPISVAAAAIYMA 261          

HSP 2 Score: 50.447 bits (119), Expect = 4.662e-20
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Match: A0A1W0X8M1 (Transcription initiation factor IIB OS=Hypsibius dujardini OX=232323 GN=BV898_02234 PE=4 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.200e-25
Identity = 62/222 (27.93%), Postives = 108/222 (48.65%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGG-DDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF---VFKKPSSIMAGTIYMGCL 891
            RVID   EWR+F+N+ G DD  RVG  E    +    S  I  +  +  L   G  K+++   +S A++ + T    IS +A+R+ +   I   A  + K++ +      ++ EAI++ACLF  C++    R  KE  A++ + K   I +  K+I++ L  +         + RF   L +   S+++V   IA+ A  F     + P S+ A  I++ C+
Sbjct:   42 RVIDVGTEWRTFSNESGTDDPSRVGGPENPLLNGQELSTMIGSATGSAGLDAQGFNKYRSRKTVSSADRALTTAFREISTMAERINMARTIVDQANTLFKQVYETKALRGRSTEAIASACLFIACRKEGVPRTFKEICAISRVPKKE-IGRCFKLILRALETSVDLVTTGDYMARFCANLSLSQ-SIQRVASTIARRASDFDVVPGRSPISVAAAAIFLACV 261          

HSP 2 Score: 51.9878 bits (123), Expect = 2.200e-25
Identity = 20/34 (58.82%), Postives = 26/34 (76.47%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +++CC  H  A+L+EDY AGDL+C  C LVVGDR
Sbjct:    9 ARVCCPSHPEAILVEDYRAGDLVCPQCGLVVGDR 42          

HSP 3 Score: 29.6462 bits (65), Expect = 2.200e-25
Identity = 13/31 (41.94%), Postives = 18/31 (58.06%), Query Frame = 2
Query:  914 ENIKNVVGVSENTTASVYKILFENKESLIPE 1006
            + I  + GV+E+T  +VYK L     SL PE
Sbjct:  270 KEIGEIAGVAESTIRAVYKFLHPKAASLFPE 300          
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Match: A0A1I8GW91 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.189e-24
Identity = 69/235 (29.36%), Postives = 115/235 (48.94%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD-DNCRVGXXXX----XXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTA---GKFVFKKPSSIMAGTIYMGCLLMDIAMTRK 918
            RVID  +EWR+FANDG + D  RVG+ E     S       + T ++S+      E G   +KN   LS  ++ + +  + I  +A+RL L   +  +A K+ K++        +  E I++ACL+  C++ +  R +KE  +V+   + + I K  + I K L  N K  +    + RF   L++ N++++K    IA+ A    +   K P S+ A  IYM C   D    +K
Sbjct:  144 RVIDVGSEWRTFANDGSNKDMSRVGSAENPLLESTELTTRIANTGRESYGVD--PETGRPVYKNKKNLSIGDRTLTSAFKEIDQMANRLNLPKSVVNTANKIFKQVYDSKQCRGRANETIASACLYMACRQEAVPRTLKEVCSVSHSNRRD-IGKAFRKITKALDTNLKGISTTDFMSRFCSNLEL-NIAIQKAATHIAEKAMQIDEVAGKSPISVAAAAIYMACQASDTKKEKK 374          

HSP 2 Score: 56.225 bits (134), Expect = 1.189e-24
Identity = 23/33 (69.70%), Postives = 26/33 (78.79%), Query Frame = 2
Query:   92 KLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            K+ CK+H  AVLIEDY  GDL+CS C LVVGDR
Sbjct:  112 KVTCKYHPEAVLIEDYHCGDLVCSQCGLVVGDR 144          
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Match: A0A1I8GT66 (TFIIB-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 7.428e-23
Identity = 69/235 (29.36%), Postives = 115/235 (48.94%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD-DNCRVGXXX----XXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTA---GKFVFKKPSSIMAGTIYMGCLLMDIAMTRK 918
            RVID  +EWR+FANDG + D  RVG+ E     S       + T ++S+      E G   +KN   LS  ++ + +  + I  +A+RL L   +  +A K+ K++        +  E I++ACL+  C++ +  R +KE  +V+   + + I K  + I K L  N K  +    + RF   L++ N++++K    IA+ A    +   K P S+ A  IYM C   D    +K
Sbjct:  185 RVIDVGSEWRTFANDGSNKDMSRVGSAENPLLESTELTTRIANTGRESYGVD--PETGRPVYKNKKNLSIGDRTLTSAFKEIDQMANRLNLPKSVVNTANKIFKQVYDSKQCRGRANETIASACLYMACRQEAVPRTLKEVCSVSHSNRRD-IGKAFRKITKALDTNLKGISTTDFMSRFCSNLEL-NIAIQKAATHIAEKAMQIDEVAGKSPISVAAAAIYMACQASDTKKEKK 415          

HSP 2 Score: 53.5286 bits (127), Expect = 7.428e-23
Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 2
Query:   77 YFFLSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +  + K+ CK+H  AVLIEDY  GDL+CS C LVVGDR
Sbjct:  148 FRVVHKVTCKYHPEAVLIEDYHCGDLVCSQCGLVVGDR 185          
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Match: A0A1I8I2U5 (TFIIB-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 8.421e-23
Identity = 69/235 (29.36%), Postives = 115/235 (48.94%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD-DNCRVGXXX----XXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTA---GKFVFKKPSSIMAGTIYMGCLLMDIAMTRK 918
            RVID  +EWR+FANDG + D  RVG+ E     S       + T ++S+      E G   +KN   LS  ++ + +  + I  +A+RL L   +  +A K+ K++        +  E I++ACL+  C++ +  R +KE  +V+   + + I K  + I K L  N K  +    + RF   L++ N++++K    IA+ A    +   K P S+ A  IYM C   D    +K
Sbjct:  144 RVIDVGSEWRTFANDGSNKDMSRVGSAENPLLESTELTTRIANTGRESYGVD--PETGRPVYKNKKNLSIGDRTLTSAFKEIDQMANRLNLPKSVVNTANKIFKQVYDSKQCRGRANETIASACLYMACRQEAVPRTLKEVCSVSHSNRRD-IGKAFRKITKALDTNLKGISTTDFMSRFCSNLEL-NIAIQKAATHIAEKAMQIDEVAGKSPISVAAAAIYMACQASDTKKEKK 374          

HSP 2 Score: 53.5286 bits (127), Expect = 8.421e-23
Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 2
Query:   77 YFFLSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +  + K+ CK+H  AVLIEDY  GDL+CS C LVVGDR
Sbjct:  107 FRVVHKVTCKYHPEAVLIEDYHCGDLVCSQCGLVVGDR 144          
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Match: A0A151WLM7 (Transcription initiation factor IIB OS=Trachymyrmex zeteki OX=64791 GN=ALC60_12270 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.283e-22
Identity = 64/222 (28.83%), Postives = 105/222 (47.30%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYM 882
            RVID  +EWR+F+N+  G D  RVG  E    + A  S  I     A      G  K++N   +S +++ +      I+ +ADR+ L   I   A  + K++        +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L + N+ V++    IA+ A +      + P S+ A  IYM
Sbjct:   55 RVIDVGSEWRTFSNEKSGVDPSRVGGPENPLLNGADLSTMIGPGTGAASFDGFGTAKYQNRRTMSSSDRTLLNAFREINGMADRINLPKTIVDRANTLFKQVHDGKNLKGRANDAIASACLYIACRQEGVPRTFKEICAVSKISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLGLPNM-VQRAATHIARKAVEIDIVPGRSPISVAAAAIYM 271          

HSP 2 Score: 56.6102 bits (135), Expect = 2.283e-22
Identity = 26/43 (60.47%), Postives = 29/43 (67.44%), Query Frame = 2
Query:   62 YKFIYYFFLSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +KF Y    +K+CC  H  A LIEDY AGD ICS C LVVGDR
Sbjct:   13 FKFSYRNATNKVCCYAHPDAPLIEDYRAGDQICSECGLVVGDR 55          

HSP 3 Score: 26.1794 bits (56), Expect = 2.283e-22
Identity = 11/34 (32.35%), Postives = 19/34 (55.88%), Query Frame = 2
Query:  905 R*QENIKNVVGVSENTTASVYKILFENKESLIPE 1006
            R Q+ I +  GV++ T    YK+++ +   L PE
Sbjct:  280 RSQKEIGDTAGVADVTIRQSYKLMYPHASQLFPE 313          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Cavefish
Match: gtf2b (general transcription factor IIB [Source:NCBI gene;Acc:103039385])

HSP 1 Score: 59.6918 bits (143), Expect = 5.566e-18
Identity = 37/140 (26.43%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAV 654
            RVID  +EWR+F N+    D  RVG  +    +    +  I +   A    E G  K++N   +S +++ +    + IS +ADR+ L   I      + K++ +      ++ +AI++ACL+  C++    R  KE   +
Sbjct:   44 RVIDVGSEWRTFTNEKATKDPSRVGDAQNPLLNGGDLTTMISKGTGAASFDEFGNSKYQNRRTMSSSDRAMLNAFKEISTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRSNDAIASACLYIACRQEGVPRTFKEIGDI 183          

HSP 2 Score: 50.447 bits (119), Expect = 5.566e-18
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   10 LPRVQCPNHPEAILVEDYRAGDMICPECGLVVGDR 44          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Yeast
Match: SUA7 (Transcription factor TFIIB; a general transcription factor required for transcription initiation and start site selection by RNA polymerase II [Source:SGD;Acc:S000006290])

HSP 1 Score: 48.9062 bits (115), Expect = 2.776e-11
Identity = 63/246 (25.61%), Postives = 97/246 (39.43%), Query Frame = 1
Query:  238 RVIDFSNEWRSFAND--GGDDNCRVGXXXXXXXXXXXXXXX--XKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNI-----------KEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVR---NVSVE---KVCIEIAKTAGKFVFKKPSSIMAGTIYMGCLLMDIAMT 912
            +++D  +EWR+F+ND   GDD  RVG            S      ++ D +   E  + + KN  V+   +  ++     I+ + D  +L  I+K  A +  K          K+ E+I AA +   C+     R             KEF     + K  L  K     +K+   N      +  IPRF   L +      S E   K C EI + AG    K P +I   +IY+  LL  I +T
Sbjct:   55 KLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKN--VMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIHVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIKEIAG----KSPITIAVVSIYLNILLFQIPIT 294          

HSP 2 Score: 29.6462 bits (65), Expect = 2.776e-11
Identity = 11/30 (36.67%), Postives = 21/30 (70.00%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            CK +   + +E +S GD++C++C LV+ D+
Sbjct:   27 CKVYPPKI-VERFSEGDVVCALCGLVLSDK 55          

HSP 3 Score: 25.0238 bits (53), Expect = 2.776e-11
Identity = 10/21 (47.62%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  938 VSENTTASVYKILFENKESLI 1000
            V+E T  S YKIL+E+++ L+
Sbjct:  304 VTEGTIKSGYKILYEHRDKLV 324          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Nematostella
Match: EDO36932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH79])

HSP 1 Score: 55.8398 bits (133), Expect = 4.221e-14
Identity = 58/217 (26.73%), Postives = 101/217 (46.54%), Query Frame = 1
Query:  256 NEWRSFAND-GGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKF---VFKKPSSIMAGTIYMG 885
            +EWR+F+N+    D  RVGA +    S    S  I++        E   +   +   +S A++ +      IS +ADR+ L   I   A ++ K++ +      ++ + I++ACL+  C++    R +KE  A+  + K   I +  K+I+K L     S ++I     + RF   L +  +SV+K    IA+ A +      + P SI A  IYM 
Sbjct:   44 SEWRTFSNEKATSDPSRVGAAQNPLLSGGDLSTLIEKPSGGNADIEGFARTHNSRSGMSGADRSLMNAFREISIMADRINLPRKIVDRANQLFKQVHEQKSLKGRSNDTIASACLYIACRQEGVPRTLKEICAIGKISKKE-IGRCFKLILKHL---ETSVDLITSGDFMSRFCSNLTL-PLSVQKAATYIARRAVELDLVAGRSPISIAAAAIYMA 255          

HSP 2 Score: 39.6614 bits (91), Expect = 4.221e-14
Identity = 16/27 (59.26%), Postives = 19/27 (70.37%), Query Frame = 2
Query:   95 LCCKFHKTAVLIEDYSAGDLICSVCAL 175
            + C+ H  A LIEDY AGD+ICS C L
Sbjct:    7 VACRHHPDAPLIEDYRAGDMICSECGL 33          
BLAST of TFIIB-type domain-containing protein vs. Ensembl Medaka
Match: gtf2b (general transcription factor IIB [Source:NCBI gene;Acc:101158724])

HSP 1 Score: 66.6254 bits (161), Expect = 5.365e-20
Identity = 59/222 (26.58%), Postives = 103/222 (46.40%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD-DNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQ---IPRFLDRLKVRNVSVEKVCIEIAKTAGKFVF---KKPSSIMAGTIYM 882
            RVID  +EWR+F+N+    D  RVG  +    +    +  I +   +    E G  K++N   +S +++ +    + IS +ADR+ L   I      + K++ +      +  +AI++ACL+  C++    R  KE  AV+ + K   I +  K+I+K L     S ++I     + RF   L +    V+     IA+ A +      + P S+ A  IYM
Sbjct:   46 RVIDVGSEWRTFSNEKAQKDPSRVGDAQNPLLNGGDLTTMIGKGTGSASFDEFGNSKYQNRRTMSSSDRAMLHAFKEISTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKE-IGRCFKLILKAL---ETSVDLITTGDFMSRFCSNLGLPK-QVQMAATFIARKAVELDLVPGRSPISVAAAAIYM 262          

HSP 2 Score: 50.447 bits (119), Expect = 5.365e-20
Identity = 20/35 (57.14%), Postives = 25/35 (71.43%), Query Frame = 2
Query:   86 LSKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            L ++ C  H  A+L+EDY AGD+IC  C LVVGDR
Sbjct:   12 LPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDR 46          
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077013.1 (SMESG000077013.1)

HSP 1 Score: 161.77 bits (408), Expect = 1.674e-52
Identity = 102/231 (44.16%), Postives = 141/231 (61.04%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDG-GDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGK---FVFKKPSSIMAGTIYMGCLLMDIAMTRK 918
            RVID S+EWRSFANDG G+D+ RVGA+E +  S+A TSI IK S D +HL ENG QK+KN+V +SP E+M++ C   I+   +RL   S  +  AM +VKKL + + F RKNK AIS ACLF   ++NS  R  KE  AV+ + K + I K  K ++  +G+     ++ V + RF  RL  +N  V  +  EIA  A        K P++I+A +IYM  LLM+   +RK
Sbjct:   37 RVIDHSSEWRSFANDGTGEDSSRVGAVENANNSEATTSIGIKNSHDVRHLDENGNQKYKNHVAMSPMERMLKQCRNHINEYGERLNADSNNRNHAMGLVKKLAESNEFNRKNKAAISCACLFLAFRDNSVPRTFKEMCAVSGVSKKD-IGKTVKKVISAIGVEGTVRDVGVYLSRFCSRLNFKNKFVSTLASEIATLASNNKIISSKSPTTIIATSIYMASLLMNEERSRK 266          

HSP 2 Score: 53.9138 bits (128), Expect = 1.674e-52
Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +++ CK+H  A LIED++AGDLIC VC LVVGDR
Sbjct:    4 NQIHCKYHPNANLIEDFTAGDLICPVCGLVVGDR 37          

HSP 3 Score: 30.8018 bits (68), Expect = 1.674e-52
Identity = 12/28 (42.86%), Postives = 20/28 (71.43%), Query Frame = 2
Query:  920 IKNVVGVSENTTASVYKILFENKESLIP 1003
            I +++GVS+ T A+ YKI + N+  L+P
Sbjct:  268 IGDILGVSQGTIATTYKIFYLNRHVLVP 295          
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077016.1 (SMESG000077016.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.482e-33
Identity = 80/225 (35.56%), Postives = 125/225 (55.56%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTA---GKFVFKKPSSIMAGTIYMGCLLMDI 903
            RVIDF +EWRSFAND   D  RVG +ET   S+  TSITI+QS + +HL E+G Q +K+   LS +++ ++T +  I A+ DR+ L   +   AM + K++ +      +N EA++ +CLF  C++    R  KE  AV+ + K + I K+ K I ++L  +  +      + RF  +L +    +E++  EI+K A        + P SI A +IYM  L M I
Sbjct:   37 RVIDFESEWRSFANDDAQDMSRVGEVETGLKSETETSITIQQSSNIRHLDESGNQIYKSRSTLSSSDRALKTAHSNIRAMGDRINLPKNLTDLAMGLFKQVHETKQLRGRNNEAVATSCLFMACRQLKVPRTFKEICAVSNVSKKD-IGKIFKKIGRILSTSVGNATGEDFMARFCYQLGIPR--LERIAKEISKKALDDNMVAGRSPVSIAAASIYMASLAMGI 258          

HSP 2 Score: 50.447 bits (119), Expect = 1.482e-33
Identity = 20/34 (58.82%), Postives = 28/34 (82.35%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +K+ CK+H TA LIED++AGDL+C+ C LVV +R
Sbjct:    4 NKVHCKYHPTATLIEDHTAGDLVCTRCGLVVAER 37          
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019400.1 (SMESG000019400.1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.128e-19
Identity = 62/202 (30.69%), Postives = 103/202 (50.99%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD--DNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF 837
            R ID S+EWR+FA+DG D  D CRVGA+ET  T    ++   +  F+ + L ENG  KFK     +  E  + +    I+ + +R+K+   +   ++ ++ ++TK++   ++NK A++  CL+  C EN   R +KE      L       K+ K++   L   ++  N I+ I RFL  L V +  +E +  E  K   K 
Sbjct:   33 RAIDPSSEWRTFASDGADGHDACRVGAVETEETDGQTSTTV-QTGFNLRFLDENGNSKFKYLSSSTNKEVSLASQKRNIADLCERIKVDRNVYSRSVLLLHEITKLNVVGKRNKVALNCVCLYLACLENCVPRLLKEILNECPLVDEKKFKKLLKLVQITLKRPTQEINPILLIARFLYYLDVTDFKIENLVKEAVKNVSKI 233          

HSP 2 Score: 38.891 bits (89), Expect = 1.128e-19
Identity = 16/30 (53.33%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            CK+H   VLI D   GD++CS C L+V DR
Sbjct:    4 CKYHPYKVLITDIRTGDIVCSACGLIVVDR 33          
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000019348.1 (SMESG000019348.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.360e-19
Identity = 59/202 (29.21%), Postives = 102/202 (50.50%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGD--DNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTENGEQKFKNYVVLSPAEKMIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAACLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNIIVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKF 837
            R ID S+EWR+FA+DG D  D CRVGA+ET  T    ++   +  F+ + L ENG  KFK     +  E  + +    I+ + +R+K+   +   ++ ++ ++ K++  +++NK  ++  CL+  C +N   R +KE      L       K+ K++   L   ++  N I+ I RFL  L V +  +E +  E  K   K 
Sbjct:   35 RAIDPSSEWRTFASDGADGHDACRVGAVETEETDGQTSTTV-QTGFNLRFLDENGNSKFKYLSSSTNKEVSLASQKRNIADLCERIKVDRNVYSRSVFLLHEIIKLNAVSKRNKATLNCVCLYLACLDNGVPRLLKEIINECPLVDEKKFKKLLKLVQITLKRPTQEINPILLIARFLYYLDVTDFKIENLVKEAVKNVSKI 235          

HSP 2 Score: 39.2762 bits (90), Expect = 2.360e-19
Identity = 16/30 (53.33%), Postives = 20/30 (66.67%), Query Frame = 2
Query:  101 CKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            CK+H   VLI D   GD++CS C L+V DR
Sbjct:    6 CKYHPYKVLITDIRTGDIVCSACGLIVVDR 35          
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Match: SMESG000077015.1 (SMESG000077015.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.734e-13
Identity = 20/34 (58.82%), Postives = 29/34 (85.29%), Query Frame = 2
Query:   89 SKLCCKFHKTAVLIEDYSAGDLICSVCALVVGDR 190
            +K+ CK+H TA LIED++AGDL+C++C LVV +R
Sbjct:    4 NKVHCKYHPTATLIEDHTAGDLVCTLCGLVVAER 37          

HSP 2 Score: 43.1282 bits (100), Expect = 1.734e-13
Identity = 25/52 (48.08%), Postives = 37/52 (71.15%), Query Frame = 1
Query:  238 RVIDFSNEWRSFANDGGDDNCRVGXXXXXXXXXXXXXXXXKQSFDAKHLTEN 393
            RVID+ +EWRSFAND   + CRVG +E++  S+  TSI ++QS + + L E+
Sbjct:   37 RVIDYESEWRSFANDDNQEMCRVGEMESAFRSETETSIMMQQSSNIRLLDES 88          
The following BLAST results are available for this feature:
BLAST of TFIIB-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GTF2B1.075e-2028.25general transcription factor IIB [Source:HGNC Symb... [more]
GTF2B4.019e-1930.00general transcription factor IIB [Source:HGNC Symb... [more]
GTF2B2.126e-1630.00general transcription factor IIB [Source:HGNC Symb... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ttb-14.221e-2030.94Transcription initiation factor IIB [Source:UniPr... [more]
ttb-14.221e-2030.94Transcription initiation factor IIB [Source:UniPr... [more]
ttb-14.221e-2030.94Transcription initiation factor IIB [Source:UniPr... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TfIIB2.675e-2328.38gene:FBgn0004915 transcript:FBtr0080025[more]
TfIIB2.675e-2328.38gene:FBgn0004915 transcript:FBtr0333489[more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2b2.576e-2026.46general transcription factor IIB [Source:ZFIN;Acc:... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rars23.423e-2227.27arginyl-tRNA synthetase 2, mitochondrial [Source:X... [more]
rars23.481e-2227.27arginyl-tRNA synthetase 2, mitochondrial [Source:X... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gtf2b7.230e-2128.25general transcription factor IIB [Source:MGI Symbo... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P29052|TF2B_DROME2.025e-2228.38Transcription initiation factor IIB OS=Drosophila ... [more]
sp|P29054|TF2B_XENLA1.192e-2026.36Transcription initiation factor IIB OS=Xenopus lae... [more]
sp|P62916|TF2B_RAT4.294e-2028.25Transcription initiation factor IIB OS=Rattus norv... [more]
sp|P62915|TF2B_MOUSE4.294e-2028.25Transcription initiation factor IIB OS=Mus musculu... [more]
sp|Q5R886|TF2B_PONAB4.662e-2028.25Transcription initiation factor IIB OS=Pongo abeli... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W0X8M12.200e-2527.93Transcription initiation factor IIB OS=Hypsibius d... [more]
A0A1I8GW911.189e-2429.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GT667.428e-2329.36TFIIB-type domain-containing protein OS=Macrostomu... [more]
A0A1I8I2U58.421e-2329.36TFIIB-type domain-containing protein OS=Macrostomu... [more]
A0A151WLM72.283e-2228.83Transcription initiation factor IIB OS=Trachymyrme... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2b5.566e-1826.43general transcription factor IIB [Source:NCBI gene... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SUA72.776e-1125.61Transcription factor TFIIB; a general transcriptio... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO369324.221e-1426.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gtf2b5.365e-2026.58general transcription factor IIB [Source:NCBI gene... [more]
back to top
BLAST of TFIIB-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077013.11.674e-5244.16SMESG000077013.1[more]
SMESG000077016.11.482e-3335.56SMESG000077016.1[more]
SMESG000019400.11.128e-1930.69SMESG000019400.1[more]
SMESG000019348.12.360e-1929.21SMESG000019348.1[more]
SMESG000077015.11.734e-1358.82SMESG000077015.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033223 ID=SMED30033223|Name=TFIIB-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1088bp
GATCTAAATGAAGTAAGTAGTAAATTTTAATATAAAGAATTTTTATTTTT
TATAAGATATATATAAATTTATTTACTACTTTTTTCTTAGTAAACTTTGT
TGTAAATTCCACAAAACAGCAGTTTTGATAGAAGACTATTCAGCGGGAGA
CTTGATCTGTTCTGTTTGTGCGTTAGTTGTTGGCGATCGGTAAGGATTAA
TTAAACAAATAATTAAAAATTAATTTAAAAAAAATGTAGAGTGATTGACT
TCTCCAATGAATGGAGGTCATTTGCTAATGATGGGGGCGATGACAACTGT
CGAGTTGGGGCCATAGAAACCAGTGCGACCTCTGATGCTGCTACATCTAT
TACGATAAAACAATCATTCGACGCCAAACATTTGACTGAAAATGGAGAAC
AGAAATTCAAAAACTACGTTGTCCTTTCACCGGCAGAAAAAATGATTAGA
ACGTGCAATGAGTTCATTTCAGCAATTGCTGATCGGTTGAAGCTCATATC
AATAATAAAAATTTCTGCAATGAAAATGGTAAAGAAATTGACTAAAATTG
ACGGATTCACTCGGAAAAATAAAGAAGCAATATCGGCAGCTTGTTTATTT
CATTGCTGCAAAGAAAATAGCTGTGAAAGAAATATAAAAGAATTCGCTGC
CGTTACCACTTTGGAAAAGCCCAATCTGATCTTGAAAATGAACAAGATAA
TCGTCAAAGTTCTCGGATTGAATTCGAAATCCACAAACATCATTGTTCAG
ATCCCTCGATTTTTGGATAGGTTGAAGGTGAGAAATGTCAGCGTAGAAAA
GGTTTGCATAGAAATCGCAAAGACAGCCGGTAAATTCGTGTTTAAGAAAC
CCTCGAGTATCATGGCAGGCACAATTTACATGGGCTGCTTACTTATGGAT
ATAGCGATGACAAGAAAATATTAAAAATGTCGTCGGAGTATCAGAGAACA
CGACAGCTTCAGTATATAAGATTCTCTTTGAAAATAAAGAATCGCTGATA
CCAGAATCCGTGTTGCCACTCTTAAAAGTACCCCTCAACAAGCTACGAAC
GGATTGACACTAAGAATTTCTTTTCAATTTATACGATC
back to top

protein sequence of SMED30033223-orf-1

>SMED30033223-orf-1 ID=SMED30033223-orf-1|Name=SMED30033223-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MIRTCNEFISAIADRLKLISIIKISAMKMVKKLTKIDGFTRKNKEAISAA
CLFHCCKENSCERNIKEFAAVTTLEKPNLILKMNKIIVKVLGLNSKSTNI
IVQIPRFLDRLKVRNVSVEKVCIEIAKTAGKFVFKKPSSIMAGTIYMGCL
LMDIAMTRKY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0017025TBP-class protein binding
GO:0003743translation initiation factor activity
Vocabulary: biological process
TermDefinition
GO:0070897DNA-templated transcriptional preinitiation complex assembly
GO:0006352DNA-templated transcription, initiation
GO:0006355regulation of transcription, DNA-templated
GO:0006413translational initiation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR036915Cyclin-like_sf
IPR013137Znf_TFIIB
IPR000812TFIIB
IPR013763Cyclin-like
IPR013150TFIIB_cyclin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000812Transcription factor TFIIBPRINTSPR00685TIFACTORIIBcoord: 135..151
score: 36.47
coord: 49..68
score: 32.0
IPR000812Transcription factor TFIIBPANTHERPTHR11618TRANSCRIPTION INITIATION FACTOR IIB-RELATEDcoord: 5..160
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 3..96
e-value: 6.4E-12
score: 47.4
IPR013150Transcription factor TFIIB, cyclin-like domainPFAMPF00382TFIIBcoord: 9..75
e-value: 2.0E-6
score: 27.7
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 1..88
e-value: 9.30154E-4
score: 34.5217
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 101..159
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 5..94