Long-chain-fatty-acid--CoA ligase ACSBG2

Overview
NameLong-chain-fatty-acid--CoA ligase ACSBG2
Smed IDSMED30033222
Length (bp)2393
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30033222) t-SNE clustered cells

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30033222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30033222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Long-chain-fatty-acid--CoA ligase ACSBG2 (SMED30033222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30033222h1SMcG0012761 dd_Smed_v4_56231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30033222h1SMcG0012761 dd_Smed_v4_56231_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG1 (acyl-CoA synthetase bubblegum family member 1 [Source:HGNC Symbol;Acc:HGNC:29567])

HSP 1 Score: 430.254 bits (1105), Expect = 1.866e-148
Identity = 214/470 (45.53%), Postives = 307/470 (65.32%), Query Frame = 1
Query:  766 EFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            EFM LG  + ++ L   ++   PN+CC L+YTSGTTGNPKGVM+S DN+ WTA         R +   +E+++SYLPLSH+AAQ+ D+   +   A + FA+PDALKGSL +TL+EV PT  +GVPRV+EKIME+++E+A     +++ +  WA  +    NL     +  PF   +A  ++  KV +ALGF +C   F  AAP+  +   +F  L++ +   YG+SE SGP  +     +R  S GK++P    KL ++D +  GEIC++GR +FMGY+N  +KT E  D E WLH+GD G  + +G+L+ITGR+KEL+ITAGGEN+ PVPIE+ +K  L  ISNAM++GD+RK+L +LLT+KC +DP T   TD+LT  A  +   +G   T++S+II  K+  +  +I+EGI+R N NA +R   +QKW  L  DFS+ GGELGPT+KLKR  V E Y  +I+S Y+
Sbjct:  251 EFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ 720          

HSP 2 Score: 117.857 bits (294), Expect = 1.866e-148
Identity = 62/162 (38.27%), Postives = 97/162 (59.88%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            E +++T  D   +LR++         P T+H MF+ A+DK  +  AL +K  ++  +  I+YSQYY L   AAK  +++GL    SV I G NSPEWF +  GT+FAGG+ +GIY T++ E  ++I  +C   V +V  ++ L+K + + K  P+LKA+V Y
Sbjct:   79 EALWTTRADGRVRLRIDPS---CPQLPYTVHRMFYEALDKYGDLIALGFK--RQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIY 235          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 436.417 bits (1121), Expect = 4.562e-145
Identity = 217/472 (45.97%), Postives = 308/472 (65.25%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK----LDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I D  L   +     N+C  LIYTSGTTG PKGVM+SHDN+ W A  +    K     E ++SYLPLSH+AAQM DI +P+   A  +FAQ DALKG+L  TLKEV PT FIGVP+++EKI E +K+ +     +KK    WA++IG++ N  KM+ K N P  Y +AK ++F+KV  +LG D C    S  APL+ +   +F SLD+ I E+YG+SE SGP TI  QN +R  S GKIL   GCK      ++DG  GEIC++GRH+FMGY+ +  +T E  D E WLHSGD+G  +  G+L++TG IKE+LITAGGEN+ P+P+E  +K+ +  ISNAM+VGDK K+L +LLT+KC ++ ++  P D L   A  +  G+G   +++++I+  ++P +  +I +GI   N+ A++ +  ++KW  L  DFS+ GGELGP +KLKR+ V + Y   I+ +Y
Sbjct:   10 WDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILT--GCKNMLFQQNKDGI-GEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 478          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 435.261 bits (1118), Expect = 3.426e-144
Identity = 217/472 (45.97%), Postives = 308/472 (65.25%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK----LDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I D  L   +     N+C  LIYTSGTTG PKGVM+SHDN+ W A  +    K     E ++SYLPLSH+AAQM DI +P+   A  +FAQ DALKG+L  TLKEV PT FIGVP+++EKI E +K+ +     +KK    WA++IG++ N  KM+ K N P  Y +AK ++F+KV  +LG D C    S  APL+ +   +F SLD+ I E+YG+SE SGP TI  QN +R  S GKIL   GCK      ++DG  GEIC++GRH+FMGY+ +  +T E  D E WLHSGD+G  +  G+L++TG IKE+LITAGGEN+ P+P+E  +K+ +  ISNAM+VGDK K+L +LLT+KC ++ ++  P D L   A  +  G+G   +++++I+  ++P +  +I +GI   N+ A++ +  ++KW  L  DFS+ GGELGP +KLKR+ V + Y   I+ +Y
Sbjct:  197 WDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILT--GCKNMLFQQNKDGI-GEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          

HSP 2 Score: 98.5969 bits (244), Expect = 3.426e-144
Identity = 58/174 (33.33%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  146 FEIKQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNC-PNLKAIVYY 664
             E+  +    T  +++T  D    LR++  G      P+T+   F  ++++     AL  K  ++   L  N++QYY+ C  AAKSLI++GL     V I G NS EWFIT  G I AGG+  GIY TN+ E  +++I + +  + +V N++ L+K + + ++    LKAI+ Y
Sbjct:   14 LEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGP-GHETPMTIPEFFRESVNRFGTYPALASKNGKKWEIL--NFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY 184          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 435.261 bits (1118), Expect = 3.426e-144
Identity = 217/472 (45.97%), Postives = 308/472 (65.25%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK----LDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I D  L   +     N+C  LIYTSGTTG PKGVM+SHDN+ W A  +    K     E ++SYLPLSH+AAQM DI +P+   A  +FAQ DALKG+L  TLKEV PT FIGVP+++EKI E +K+ +     +KK    WA++IG++ N  KM+ K N P  Y +AK ++F+KV  +LG D C    S  APL+ +   +F SLD+ I E+YG+SE SGP TI  QN +R  S GKIL   GCK      ++DG  GEIC++GRH+FMGY+ +  +T E  D E WLHSGD+G  +  G+L++TG IKE+LITAGGEN+ P+P+E  +K+ +  ISNAM+VGDK K+L +LLT+KC ++ ++  P D L   A  +  G+G   +++++I+  ++P +  +I +GI   N+ A++ +  ++KW  L  DFS+ GGELGP +KLKR+ V + Y   I+ +Y
Sbjct:  197 WDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILT--GCKNMLFQQNKDGI-GEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 665          

HSP 2 Score: 98.5969 bits (244), Expect = 3.426e-144
Identity = 58/174 (33.33%), Postives = 95/174 (54.60%), Query Frame = 2
Query:  146 FEIKQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNC-PNLKAIVYY 664
             E+  +    T  +++T  D    LR++  G      P+T+   F  ++++     AL  K  ++   L  N++QYY+ C  AAKSLI++GL     V I G NS EWFIT  G I AGG+  GIY TN+ E  +++I + +  + +V N++ L+K + + ++    LKAI+ Y
Sbjct:   14 LEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGP-GHETPMTIPEFFRESVNRFGTYPALASKNGKKWEIL--NFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY 184          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Match: ACSBG2 (acyl-CoA synthetase bubblegum family member 2 [Source:HGNC Symbol;Acc:HGNC:24174])

HSP 1 Score: 436.032 bits (1120), Expect = 5.441e-143
Identity = 217/472 (45.97%), Postives = 308/472 (65.25%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK----LDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I D  L   +     N+C  LIYTSGTTG PKGVM+SHDN+ W A  +    K     E ++SYLPLSH+AAQM DI +P+   A  +FAQ DALKG+L  TLKEV PT FIGVP+++EKI E +K+ +     +KK    WA++IG++ N  KM+ K N P  Y +AK ++F+KV  +LG D C    S  APL+ +   +F SLD+ I E+YG+SE SGP TI  QN +R  S GKIL   GCK      ++DG  GEIC++GRH+FMGY+ +  +T E  D E WLHSGD+G  +  G+L++TG IKE+LITAGGEN+ P+P+E  +K+ +  ISNAM+VGDK K+L +LLT+KC ++ ++  P D L   A  +  G+G   +++++I+  ++P +  +I +GI   N+ A++ +  ++KW  L  DFS+ GGELGP +KLKR+ V + Y   I+ +Y
Sbjct:  147 WDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGVMLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADALKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKKMLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELYGLSESSGPHTISNQNNYRLLSCGKILT--GCKNMLFQQNKDGI-GEICLWGRHIFMGYLESETETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPIISNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQIDHMY 615          

HSP 2 Score: 92.0485 bits (227), Expect = 1.528e-18
Identity = 50/136 (36.76%), Postives = 80/136 (58.82%), Query Frame = 2
Query:  260 ITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNC-PNLKAIVYY 664
            +T+   F  ++++     AL  K  ++   L  N++QYY+ C  AAKSLI++GL     V I G NS EWFIT  G I AGG+  GIY TN+ E  +++I + +  + +V N++ L+K + + ++    LKAI+ Y
Sbjct:    1 MTIPEFFRESVNRFGTYPALASKNGKKWEIL--NFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFITAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKAIIQY 134          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 152.14 bits (383), Expect = 4.483e-38
Identity = 131/468 (27.99%), Postives = 226/468 (48.29%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS----KEMLISYLPLSHVAAQMCDIIIPLLC---QATIHFAQPDALKGSLGHTLKEVHPTYFIG----VPRVFEKIMEQ-----MKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPA-AKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            P +  ++ YTSGTTG PKGVM++H N++    CM +   F+HS     + +IS+LPL+H    M + +I  +C    A + F + D     L   +KE+ PT        + R+++K+M +     +K+M  DF+     IS  A+D+         ++ +G F       ++F K+ +  G  R   + + +APLS +VL +  A++  V+ E YG +EC    T+  + +   G VG ++P    KL            + GE+C+ G  +F GY    ++TKE  D + WLH+GD+G +  EG L I  R K +   + GE +AP  IE  I     +++ + V G+  K  C++     ++ P  ++    L PA A +   G      +  ++  +   K +I +D+ +    +  +    +V+  +     FSV    L PTLK KR  +   YS  ++++Y
Sbjct:  247 PEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDF---FKHSGIAATDSMISFLPLAH----MLERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFA-----ISYKARDMANFN-----IRNDGFF-----DNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK-TCLI----AIVVPDAEV----LVPAMADQGIKG------TFEELCNNDAVKKAI-LDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 672          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 152.14 bits (383), Expect = 5.648e-38
Identity = 131/468 (27.99%), Postives = 226/468 (48.29%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS----KEMLISYLPLSHVAAQMCDIIIPLLC---QATIHFAQPDALKGSLGHTLKEVHPTYFIG----VPRVFEKIMEQ-----MKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPA-AKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            P +  ++ YTSGTTG PKGVM++H N++    CM +   F+HS     + +IS+LPL+H    M + +I  +C    A + F + D     L   +KE+ PT        + R+++K+M +     +K+M  DF+     IS  A+D+         ++ +G F       ++F K+ +  G  R   + + +APLS +VL +  A++  V+ E YG +EC    T+  + +   G VG ++P    KL            + GE+C+ G  +F GY    ++TKE  D + WLH+GD+G +  EG L I  R K +   + GE +AP  IE  I     +++ + V G+  K  C++     ++ P  ++    L PA A +   G      +  ++  +   K +I +D+ +    +  +    +V+  +     FSV    L PTLK KR  +   YS  ++++Y
Sbjct:  290 PEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDF---FKHSGIAATDSMISFLPLAH----MLERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFA-----ISYKARDMANFN-----IRNDGFF-----DNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIPSCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK-TCLI----AIVVPDAEV----LVPAMADQGIKG------TFEELCNNDAVKKAI-LDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 715          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-13 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:V6CLI5])

HSP 1 Score: 151.754 bits (382), Expect = 7.381e-38
Identity = 132/470 (28.09%), Postives = 228/470 (48.51%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS----KEMLISYLPLSHVAAQMCDIIIPLLC---QATIHFAQPDALKGSLGHTLKEVHPTYFIG----VPRVFEKIMEQ-----MKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE---------GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPA-AKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            P +  ++ YTSGTTG PKGVM++H N++    CM +   F+HS     + +IS+LPL+H    M + +I  +C    A + F + D     L   +KE+ PT        + R+++K+M +     +K+M  DF+     IS  A+D+         ++ +G F       ++F K+ +  G  R   + + +APLS +VL +  A++  V+ E YG +EC    T+  + +   G VG ++P   C++   D  E         GE+C+ G  +F GY    ++TKE  D + WLH+GD+G +  EG L I  R K +   + GE +AP  IE  I     +++ + V G+  K  C++     ++ P  ++    L PA A +   G      +  ++  +   K +I +D+ +    +  +    +V+  +     FSV    L PTLK KR  +   YS  ++++Y
Sbjct:  297 PEDLATICYTSGTTGTPKGVMLTHANVIADGVCMDF---FKHSGIAATDSMISFLPLAH----MLERVIESVCFCVGAKVGFYRGDIR--VLAEDIKELKPTVVPVVPRVLNRLYDKVMSEVNKSTLKKMLFDFA-----ISYKARDMANFN-----IRNDGFF-----DNLVFKKIREGFG-GRVRLMITGSAPLSTNVLTFVRAAMGCVVVEGYGQTECVAACTVSMEGDSLAGHVGMVIP--SCQIKLVDVPELNYYAKDQAGEVCVKGHIIFKGYYKNEQQTKETIDEDGWLHTGDIGRWTPEGTLKIVDRKKHIFKLSQGEYVAPEKIEN-IYVRSKYVAQSFVHGESLK-TCLI----AIVVPDAEV----LVPAMADQGIKG------TFEELCNNDAVKKAI-LDDMVAVGKKAGLFSFEQVRDISLSAEQFSVENDLLTPTLKSKRPKLKAHYSKQLDAMY 722          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-5 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q9XWD1])

HSP 1 Score: 133.265 bits (334), Expect = 4.926e-32
Identity = 131/446 (29.37%), Postives = 205/446 (45.96%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM-KFRHS----KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGY-SIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVL-VYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLD--------SEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDK-RKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPK-LSISIDEGIKRSNE-NAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKR 2115
            P++   + YTSGTTG PKGVM++H N+V      L  +  F+ S     ++ ISYLPLSH+  Q+    +        +F    +++G L   +K + PT F  VPR+  ++ + +         + K + ++A     + +L K     G  G  +I   ++FNK+ + +G    L + + +AP+S  VL     +L   I E YG +EC+   T  +  +   G  G   P    KL         ++DGK GEI + G  V  GY   PE+T E+FD E +L +GD+G     G + I  R K +   A GE +AP  IEQ +      +    V GD   ++L  ++           +P  D+    K W    G     I +I  D+  K   +S    I ++N+ N+I    +V+K       F+V  G L PTLK KR
Sbjct:  250 PDDNYIICYTSGTTGTPKGVMLTHSNIVANISGFLKILFAFQPSMIDATQVHISYLPLSHMMEQLTHWTLLGFGSKIGYFR--GSIQG-LTDDIKTLKPTVFPVVPRLLNRLYDAITSKVQQQGFMAKLVYNFA--FARKLSLVKA----GKVGRDTIWDRLVFNKIQQQIGGKVDL-MVTGSAPISSTVLETCRVTLGTTIVEGYGQTECTALATFTWMGDPSTGHCGAPAPCALVKLGDVPDLNYFAKDGK-GEIRIKGPCVTKGYYKDPERTAELFDEEGFLQTGDIGEMLPNGTIRIIDRKKHIFKLAQGEYVAPEKIEQ-VYIRTPVVQQVYVDGDSLERWLIAVV-----------VPEPDV---LKEWNDKQGSGSRKIEEICNDEKAKEFVLSELHAIGKANKLNSIE---QVKKVILTSDTFTVENGLLTPTLKAKR 666          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Match: acs-18 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q21872])

HSP 1 Score: 128.257 bits (321), Expect = 2.324e-30
Identity = 123/458 (26.86%), Postives = 199/458 (43.45%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKC----VIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKIL----------PDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            P    ++ +TSGTTG PKGVM++H N+         +      ++  +SYLPL+H+  ++C ++   +  + I F++ D     L   ++ + P  F  VPRV +KI + + +   D   +KK I + A  I Y+    KM       G +  K      + +K+   LG +    I  AA      +     +  + + E YG +E SGP T++   + R G VG  +          P+ G  +D   G   E+ + G +V  GY   PE T   F  + ++ +GD+G F  EG L I  R K +     G+ +AP  + + +  +  F+    V GD  K   V +    V DP   + +  LT   K   +G  Y       I+ D   +  + + E  KR       R   V      P  FS   G   PTLK KRN + + + A I+ +Y+
Sbjct:  260 PETLATISFTSGTTGRPKGVMLTHLNMCSATMSCEEFENEAGVQDAYLSYLPLAHIYERLC-LLSNFMIGSRIGFSRGDP--KLLVDDVQALAPRSFATVPRVIDKIHKAVMKQVQD-KPLKKMILNAA--IAYKLYHYKMT------GKATRKTWVDKYVLHKIQMLLGPNIRQLILGAAKSDVSAMRFARGAFGVEVLEGYGQTETSGPTTLQLVGDTRIGCVGPPMACAMIKLIDVPELGYSVDKNGG---EVLVKGHNVTSGYYKNPEATASSFTEDGYMKTGDIGRFTAEGSLQIIDRRKNVFKMPQGKFVAP-DLTESLYTSSSFVQQIYVHGDMEKPWLVAI---VVPDP-EYLASYALT---KHNINGKTYEQLCNIPILADDVLRQFVELTEEDKR------PRYEGVYGVHLTPVAFSAENGLTTPTLKNKRNAIAQFFKAEIDGMYK 688          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0080590)

HSP 1 Score: 432.95 bits (1112), Expect = 2.134e-141
Identity = 221/470 (47.02%), Postives = 310/470 (65.96%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM-KFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKN-PKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W+E  ++ ++  +D  + RL ++  NECC L+YTSGT G PKGVM+SHDN+ +    ++  M +     E ++SYLPLSHVAAQ  DI         I FA  DALKG+L  +L++  PT F+GVPRV+EK  E+M  +A    S+KK ++SWAK I  +  +    K +G F Y IAK +I +KV +ALGFDR L + SAAAP+S +   YF SLDL I + +GMSE +G  TI   +     ++GK LP    K  ++D    GE+C+ GRHVFMGY++  EKT+E  D + WLHSGD+G  +D+GY+ +TGR KE++ITAGGENI PV IE  IK+ LD ISNA +VG++RKYL VL+T+K  +D  +  P D+L+  +  W   +G    ++S I+     PK+  SI++ IKR+N+ +IS + +VQK+T LPHDFS+P GELGPTLK+KRNVV+++Y+  I  LY
Sbjct:  196 WSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLY 665          

HSP 2 Score: 76.2554 bits (186), Expect = 6.726e-14
Identity = 41/156 (26.28%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  191 STSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIV 658
            +T+     K+RM  K  +   +PI++  +    ++   +  AL+ K + ++ + ++ Y QY Q     AK+ I++GL    SV +   N  EWF +  G I A G+ +GIY TN+ + V+ ++ +    + +V + + + K   +    P LKA +
Sbjct:   24 TTNRQDAVKIRM-AKDGIGAEEPISVPGLLKRTVNNYGDYPALRTK-NGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAI 177          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: bgm (gene:FBgn0027348 transcript:FBtr0346624)

HSP 1 Score: 432.95 bits (1112), Expect = 2.134e-141
Identity = 221/470 (47.02%), Postives = 310/470 (65.96%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM-KFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKN-PKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W+E  ++ ++  +D  + RL ++  NECC L+YTSGT G PKGVM+SHDN+ +    ++  M +     E ++SYLPLSHVAAQ  DI         I FA  DALKG+L  +L++  PT F+GVPRV+EK  E+M  +A    S+KK ++SWAK I  +  +    K +G F Y IAK +I +KV +ALGFDR L + SAAAP+S +   YF SLDL I + +GMSE +G  TI   +     ++GK LP    K  ++D    GE+C+ GRHVFMGY++  EKT+E  D + WLHSGD+G  +D+GY+ +TGR KE++ITAGGENI PV IE  IK+ LD ISNA +VG++RKYL VL+T+K  +D  +  P D+L+  +  W   +G    ++S I+     PK+  SI++ IKR+N+ +IS + +VQK+T LPHDFS+P GELGPTLK+KRNVV+++Y+  I  LY
Sbjct:  196 WSEIESMNVSDVEDQYMTRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDRVVVGAESIVSYLPLSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDARPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGHGELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIKKELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSVWVKSLGVEHKTVSDILAAGPCPKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMYADEIEKLY 665          

HSP 2 Score: 76.2554 bits (186), Expect = 6.726e-14
Identity = 41/156 (26.28%), Postives = 79/156 (50.64%), Query Frame = 2
Query:  191 STSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIV 658
            +T+     K+RM  K  +   +PI++  +    ++   +  AL+ K + ++ + ++ Y QY Q     AK+ I++GL    SV +   N  EWF +  G I A G+ +GIY TN+ + V+ ++ +    + +V + + + K   +    P LKA +
Sbjct:   24 TTNRQDAVKIRM-AKDGIGAEEPISVPGLLKRTVNNYGDYPALRTK-NGKNGYHTVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSAMGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAI 177          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: hll (gene:FBgn0286723 transcript:FBtr0080591)

HSP 1 Score: 333.954 bits (855), Expect = 2.532e-103
Identity = 194/485 (40.00%), Postives = 275/485 (56.70%), Query Frame = 1
Query:  799 DTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK-FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQM--KEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAK----CVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQT--IEFQNEFRFGSVGKILPDFGCKLDSED-GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIIT--------------------DKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            + L+ R + +  NEC  LI+TSGT G PK VM+SHDNLV+  +    +M+  +  KE  +SYLPLSHVAAQ+ D+ + L     + FA  DALKG+L  T ++  PT   GVPRVFEK+ E++   E      S      + A    ++T L   M    P  Y  AK    C +   + + +G D C   F+  AP S ++  +F  LD+ + E YGMSE SG  T  ++  N +   S G+       K+   D   +GEI M GR VFMGY+  P+KT+E    + WLHSGD+G  + +G L I+GR+KEL+ITAGGENI PV IE+ IK+ L  +SN +++GD RKYL VLL++K   D  T IP D L      W   +  + T +S+++                        PKL  +I+EGIKR+N+ AIS + +VQK+  + H+FSV  GELGPTLK++RN+V+  Y+ +I  LY+
Sbjct:  203 EELLARESRIRANECAMLIFTSGTVGMPKAVMLSHDNLVFDTKSAAAHMQDIQVGKESFVSYLPLSHVAAQIFDVFLGLSHAGCVTFADKDALKGTLIKTFRKARPTKMFGVPRVFEKLQERLVAAEAKARPYSRLLLARARAAVAEHQTTL---MAGKSPSIYGNAKYWLACRVVKPIREMIGVDNCRVFFTGGAPTSEELKQFFLGLDIALGECYGMSETSGAITLNVDISNLY---SAGQACEGVTLKIHEPDCNGQGEILMRGRLVFMGYLGLPDKTEETVKEDGWLHSGDLGYIDPKGNLIISGRLKELIITAGGENIPPVHIEELIKKELPCVSNVLLIGDHRKYLTVLLSLKTKCDAKTGIPLDALREETIEWLRDLDIHETRLSELLNIPADLQLPNDTAALAATLEITAKPKLLEAIEEGIKRANKYAISNAQKVQKFALIAHEFSVATGELGPTLKIRRNIVHAKYAKVIERLYK 681          

HSP 2 Score: 87.4261 bits (215), Expect = 2.083e-17
Identity = 47/163 (28.83%), Postives = 83/163 (50.92%), Query Frame = 2
Query:  191 STSLDKVSKLRMNCKGDLAR-IKPITLHTMFHNAIDKGANTEALKYKY--SQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            STSL    KLR++     ++ + P T+   F  + +K ++  AL ++   S    + ++ + +Y +    AA  L+ +G+  R SV I   N PEWF   FG + AG V +G+Y +N+ E V  ++   E  V +V + + + K   + +  P LKA++   G
Sbjct:   12 STSLHDAVKLRLDEPSSFSQTVPPQTIPEFFKESCEKYSDLPALVWETPGSGNDGWTTLTFGEYQERVEQAALMLLSVGVEERSSVGILAFNCPEWFFAEFGALRAGAVVAGVYPSNSAEAVHHVLATGESSVCVVDDAQQMAKLRAIKERLPRLKAVIQLHG 174          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0302322)

HSP 1 Score: 159.458 bits (402), Expect = 1.616e-40
Identity = 128/453 (28.26%), Postives = 220/453 (48.57%), Query Frame = 1
Query:  838 ECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM---KFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            + C++ YTSGTTGNPKGVM++H N+V     ++  M   + R + ++++S+LPL+H+  + C+  +       + F   D  +  L + LK + PT    VPR+  ++ ++++   I  S +K+ + + A     +     +++ NG +       ++F KVH+A G +  L +   +APL+ +VL +   +L  ++ E YG +EC+G  T+  Q +     VG  +     KL          +   GE+C+ G +VF GY   PEKT E  DSE W H+GDVG +   G L I  R K +   + GE I P  IE  I     +++   V G+  K         C+I  V  +P  D+    K+W +      T +S +  +KN K  + +++ +    ++ +    +V+     P  FSV  G L PT K KR  +   +   +  +Y+
Sbjct:  226 DLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIR-AGDVMVSFLPLAHMFERCCENGM-YYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQN-DISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDK-----LVFKKVHQAFGGNLRLMVV-GSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIEN-IYTLSQYVNQVYVYGESLK--------SCIIAVV--VPDTDVL---KQWATENNVRGT-LSVLCNNKNVK-ELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 651          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Match: CG3961 (gene:FBgn0036821 transcript:FBtr0333712)

HSP 1 Score: 159.458 bits (402), Expect = 1.943e-40
Identity = 128/453 (28.26%), Postives = 220/453 (48.57%), Query Frame = 1
Query:  838 ECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM---KFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            + C++ YTSGTTGNPKGVM++H N+V     ++  M   + R + ++++S+LPL+H+  + C+  +       + F   D  +  L + LK + PT    VPR+  ++ ++++   I  S +K+ + + A     +     +++ NG +       ++F KVH+A G +  L +   +APL+ +VL +   +L  ++ E YG +EC+G  T+  Q +     VG  +     KL          +   GE+C+ G +VF GY   PEKT E  DSE W H+GDVG +   G L I  R K +   + GE I P  IE  I     +++   V G+  K         C+I  V  +P  D+    K+W +      T +S +  +KN K  + +++ +    ++ +    +V+     P  FSV  G L PT K KR  +   +   +  +Y+
Sbjct:  238 DLCTVCYTSGTTGNPKGVMLTHGNVVAGVCSVILQMGDHRIR-AGDVMVSFLPLAHMFERCCENGM-YYVGGCVGFYSGDIKE--LTNDLKMLKPTVMPAVPRLLNRVYDKIQN-DISASGLKRGLFNMAMRAKEKEIARGVLRRNGCWDK-----LVFKKVHQAFGGNLRLMVV-GSAPLAGNVLTFMRCALGCLVLEGYGQTECTGAITLTVQGDHVPNHVGPPVSCNAVKLVDVPEMEYFANQNTGEVCVRGSNVFHGYYKDPEKTAEAIDSEGWHHTGDVGMWLPNGTLRIIDRRKHIFKLSQGEYIVPEKIEN-IYTLSQYVNQVYVYGESLK--------SCIIAVV--VPDTDVL---KQWATENNVRGT-LSVLCNNKNVK-ELIMNDMLNWGKQSGLKSFEQVKDIYLHPDPFSVQNGLLTPTFKAKRPQLKSYFKPQLEDMYK 663          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 519.62 bits (1337), Expect = 4.007e-174
Identity = 247/477 (51.78%), Postives = 332/477 (69.60%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM---MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL---DSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM DI +P+      +FAQPDALKGSL +TL+E+ PT F+GVPRV+EK+ E+MK +    S+V++ ++SWAKD+G +TNL KM        P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE SGP TI   N FR  S GK++P  GCK    + +D K GEIC +GRHVFMGY+N P+KT+E  D+E WLHSGD+G  ++  +LFITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAM++GDKRK+L +LLT+KC I+  T +P D+LTP A  +   +G + T +++I   ++  +  +I +GI R NE A S +  +QKWT L  DFS+PGGELGPT+KLKR VV ++Y   I S Y+
Sbjct:  305 WAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIP--GCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFYK 779          

HSP 2 Score: 113.62 bits (283), Expect = 4.007e-174
Identity = 59/166 (35.54%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  167 PVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            P +   +++T  D   KLRM   G L    P+T++ MF + + +  +  AL +K  ++  + ++ YS+YY+ C  AAKS +++GL     V I G NS EWFI     I AGG A GIY TN+ E  +++  NC+  + +V N + L+K + +    P+LKAI+ Y
Sbjct:  129 PTKGTELWTTHRDGEVKLRMAESG-LGAETPLTVNQMFTSTVQRFGSYPALGWKEGEQ--WKTMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY 291          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 519.235 bits (1336), Expect = 4.008e-174
Identity = 247/477 (51.78%), Postives = 332/477 (69.60%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM---MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL---DSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM DI +P+      +FAQPDALKGSL +TL+E+ PT F+GVPRV+EK+ E+MK +    S+V++ ++SWAKD+G +TNL KM        P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE SGP TI   N FR  S GK++P  GCK    + +D K GEIC +GRHVFMGY+N P+KT+E  D+E WLHSGD+G  ++  +LFITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAM++GDKRK+L +LLT+KC I+  T +P D+LTP A  +   +G + T +++I   ++  +  +I +GI R NE A S +  +QKWT L  DFS+PGGELGPT+KLKR VV ++Y   I S Y+
Sbjct:  253 WAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIP--GCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFYK 727          

HSP 2 Score: 114.005 bits (284), Expect = 4.008e-174
Identity = 59/166 (35.54%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  167 PVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            P +   +++T  D   KLRM   G L    P+T++ MF + + +  +  AL +K  ++  + ++ YS+YY+ C  AAKS +++GL     V I G NS EWFI     I AGG A GIY TN+ E  +++  NC+  + +V N + L+K + +    P+LKAI+ Y
Sbjct:   77 PTKGTELWTTHRDGEVKLRMAESG-LGAETPLTVNQMFTSTVQRFGSYPALGWKEGEQ--WKTMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY 239          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:ZFIN;Acc:ZDB-GENE-110914-219])

HSP 1 Score: 421.779 bits (1083), Expect = 2.297e-145
Identity = 214/474 (45.15%), Postives = 304/474 (64.14%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLD----SEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W EFM LG+ ++D  L   ++    N+CC LIYTSGTTG+PKGVM+SHDN+ WTA         + +   +E L+SYLPLSH+AAQ+ D+   +     I FAQPDALKG+L  +L+EV PT  +GVPRV+EKIME++KE       +K+ + +WA  +    N      E   F +++A+ +I  K+   LGF  C+  FS AAP+  + L +F  L++ + E YGMSE SGP  +     ++F S GK++P  GC+      + DG  GE+C +GR+VFMG++N  +KTKE  D + WL SGD+G  +++G+++I GRIKEL+ITAGGENI P+PIE  +K+ L  ISNAM++GD+RK+L +LLT+KC ++P T  PTD L+  A  +   IG   T +S I   K+  +  SI++GI + N  A S +  +QKWT L  DFSV GGELGPT+KL+R VV ++Y   I + Y
Sbjct:  202 WEEFMELGLEVSDHELDEVISKQRANQCCVLIYTSGTTGSPKGVMLSHDNITWTAHHASRAGDMQPAEIRQESLVSYLPLSHIAAQIYDLWTGIKWGEQISFAQPDALKGTLVDSLREVTPTAHMGVPRVWEKIMEKIKEGISRCGYMKRKMVTWAMSVSLDANQRLKKDEEKSFLFTLAEKLILQKLRAELGFSSCVKFFSGAAPIGRETLQFFLGLNIRLYEAYGMSETSGPHFMSGPEAYQFLSCGKVVP--GCQYKLININADGS-GEVCFWGRNVFMGFLNLEDKTKEALDEDGWLRSGDLGKVDEDGFIYINGRIKELIITAGGENIPPLPIEDAVKQELSIISNAMLIGDERKFLSMLLTLKCTVNPETTEPTDILSLEAVEFCQRIGSQSTKLSDITGGKDKLVYKSIEDGIGQVNSKATSNAQRIQKWTILDKDFSVAGGELGPTMKLRRPVVLQMYHNEIENFY 672          

HSP 2 Score: 115.546 bits (288), Expect = 2.297e-145
Identity = 63/174 (36.21%), Postives = 99/174 (56.90%), Query Frame = 2
Query:  176 TENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYS---QESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSI 688
             +++++T      +LRM+   +    +PIT+H MF+N++ K  N  AL  K     ++++FL     +YY LC MAAK  +++GL     V I G NS EWFI   GT+FAGG+ +GIY TN+ +    + N+    V +V N++ L K + V    P+LKAIV Y G + + +
Sbjct:   31 AQSLWTTEASGSVQLRMD---EHCPEQPITVHQMFYNSVQKYGNLTALASKRGNKWEKATFL-----EYYHLCRMAAKGFLKLGLEQFHGVAILGFNSAEWFIAAVGTVFAGGIMAGIYTTNSPDACLHVANDSRANVIVVENQKQLDKIMQVKDKLPHLKAIVQYSGSLKEKL 196          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 157.147 bits (396), Expect = 1.031e-41
Identity = 138/477 (28.93%), Postives = 225/477 (47.17%), Query Frame = 1
Query:  784 ININDDTLIGRLNHLIP----NECCSLI-YTSGTTGNPKGVMMSHDNLVWTAECMLYYMK---FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTP--AAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            +++ D   +G+ NH  P     E  S+I +TSGTTG+PKG M++H+N+V  A  ++   +        ++ IS+LPL+H+  ++   ++       + F Q D     L   +K + PT F  VPR+  ++ ++++      S  K     W  +       A++ K+      S+   +IF+KV ++LG  R   + + AAP+S  VL +  A L   I E YG +EC+   +     +++ G VG  +P    KL D E+        EGEIC+ G +VF GY+  PEKT E  D + WLH+GD+G +   G L I  R K +   A GE IAP  IE     +   ++   V G+  +   V +           +P  ++ P  A K    G      S+ ++  ++  K +I I +  K   E  +    +V+     P  F++  G L PTLK KR  + + +   I SLY
Sbjct:  231 LSLKDVEALGKNNHHRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHMFERVVQTVL-YGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQ------SGAKTPFKKWLLNFAIEKKCAEV-KQGIIRNDSMWDKLIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGESLQSSLVAIV----------VPDPEVLPGFAEKLGLKG------SLEELCRNQELKKAI-ISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          

HSP 2 Score: 34.2686 bits (77), Expect = 1.031e-41
Identity = 36/154 (23.38%), Postives = 54/154 (35.06%), Query Frame = 2
Query:  263 TLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKS--VCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVS--KNCPNLKAIVYYGGLIDDSIKGGCKISL 712
            TL+ +F   +    N   L ++  +   +  + Y Q           LI  G    +   + I   N PEW I          VA  +Y T   E + FIIN       I   ++  +  +  S  K  P LK I+          + G KI L
Sbjct:   76 TLYEVFQRGLRVSGNGPCLGFR-KKGQPYQWLKYKQVSDRAEFLGSGLIHRGQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGL 228          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:ZFIN;Acc:ZDB-GENE-040912-169])

HSP 1 Score: 157.147 bits (396), Expect = 1.031e-41
Identity = 138/477 (28.93%), Postives = 225/477 (47.17%), Query Frame = 1
Query:  784 ININDDTLIGRLNHLIP----NECCSLI-YTSGTTGNPKGVMMSHDNLVWTAECMLYYMK---FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTP--AAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            +++ D   +G+ NH  P     E  S+I +TSGTTG+PKG M++H+N+V  A  ++   +        ++ IS+LPL+H+  ++   ++       + F Q D     L   +K + PT F  VPR+  ++ ++++      S  K     W  +       A++ K+      S+   +IF+KV ++LG  R   + + AAP+S  VL +  A L   I E YG +EC+   +     +++ G VG  +P    KL D E+        EGEIC+ G +VF GY+  PEKT E  D + WLH+GD+G +   G L I  R K +   A GE IAP  IE     +   ++   V G+  +   V +           +P  ++ P  A K    G      S+ ++  ++  K +I I +  K   E  +    +V+     P  F++  G L PTLK KR  + + +   I SLY
Sbjct:  231 LSLKDVEALGKNNHHRPVPPKPEDLSIICFTSGTTGDPKGAMLTHENVVADAAGVVRTFESVFVPVPSDVSISFLPLAHMFERVVQTVL-YGVGGRVGFFQGDIR--LLPDDMKALQPTVFPVVPRLLNRVYDKVQ------SGAKTPFKKWLLNFAIEKKCAEV-KQGIIRNDSMWDKLIFHKVQESLG-GRVRVMVTGAAPISPSVLTFLRACLGCQIFEAYGQTECTAACSFTIPGDWKTGHVGAPIPCNTIKLVDVEEMDYFASNGEGEICVKGTNVFRGYLGDPEKTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIENVYIRSAP-VAQVFVHGESLQSSLVAIV----------VPDPEVLPGFAEKLGLKG------SLEELCRNQELKKAI-ISDLNKLGREAGLKSFEQVKDLYLHPDMFTIENGLLTPTLKAKRADLTKYFRVQIESLY 678          

HSP 2 Score: 34.2686 bits (77), Expect = 1.031e-41
Identity = 36/154 (23.38%), Postives = 54/154 (35.06%), Query Frame = 2
Query:  263 TLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKS--VCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVS--KNCPNLKAIVYYGGLIDDSIKGGCKISL 712
            TL+ +F   +    N   L ++  +   +  + Y Q           LI  G    +   + I   N PEW I          VA  +Y T   E + FIIN       I   ++  +  +  S  K  P LK I+          + G KI L
Sbjct:   76 TLYEVFQRGLRVSGNGPCLGFR-KKGQPYQWLKYKQVSDRAEFLGSGLIHRGQKPSQDTFIGIFAQNRPEWIIAELACYTYSMVAVPLYDTLGPEALVFIINRANISTVICDKKDKAETLLDNSEKKLTPLLKTIILMDSYDSALTERGSKIGL 228          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 486.108 bits (1250), Expect = 8.486e-168
Identity = 235/472 (49.79%), Postives = 321/472 (68.01%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   +    Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT+E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAMV+GDK+K+L +LLT+KC ++  T  P D+LTP A  +   IG   T +S I+  K+  +  +I +G+   N+ A S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  189 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKMNGTHILKRYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFYQ 660          

HSP 2 Score: 126.716 bits (317), Expect = 8.486e-168
Identity = 67/178 (37.64%), Postives = 99/178 (55.62%), Query Frame = 2
Query:  137 KITFEIKQHSPVETENM--FSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            K  F I Q   + T +M  ++T  D   +LRM   G +A + P+T+H +F + + K  +  AL  K  Q   +  + Y QYY+ C +AAK  +++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + +    P+LKAI+ Y
Sbjct:    1 KTVFFISQEGNLSTSDMKLWTTRRDNAVELRMEDSG-VASLPPVTIHQLFQDTVKKYGDYVALASK--QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY 175          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 488.034 bits (1255), Expect = 1.054e-167
Identity = 238/476 (50.00%), Postives = 323/476 (67.86%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   NG    P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT+E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAMV+GDK+K+L +LLT+KC ++  T  P D+LTP A  +   IG   T +S I+  K+  +  +I +G+   N+ A S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  193 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKM---NGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFYQ 665          

HSP 2 Score: 124.405 bits (311), Expect = 1.054e-167
Identity = 67/186 (36.02%), Postives = 103/186 (55.38%), Query Frame = 2
Query:  107 VNGPLNKSQNKITFEIKQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
             N  L++S+N  T ++K         +++T  D   +LRM   G +A + P+T+H +F + + K  +  AL  K  Q   +  + Y QYY+ C +AAK  +++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + +    P+LKAI+ Y
Sbjct:    6 TNNRLSESRNLSTSDMK---------LWTTRRDNAVELRMEDSG-VASLPPVTIHQLFQDTVKKYGDYVALASK--QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY 179          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 487.649 bits (1254), Expect = 1.308e-167
Identity = 238/476 (50.00%), Postives = 323/476 (67.86%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   NG    P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT+E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAMV+GDK+K+L +LLT+KC ++  T  P D+LTP A  +   IG   T +S I+  K+  +  +I +G+   N+ A S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  193 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKM---NGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFYQ 665          

HSP 2 Score: 124.405 bits (311), Expect = 1.308e-167
Identity = 62/165 (37.58%), Postives = 94/165 (56.97%), Query Frame = 2
Query:  170 VETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
             E + +++T  D   +LRM   G +A + P+T+H +F + + K  +  AL  K  Q   +  + Y QYY+ C +AAK  +++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + +    P+LKAI+ Y
Sbjct:   18 AELQYLWTTRRDNAVELRMEDSG-VASLPPVTIHQLFQDTVKKYGDYVALASK--QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY 179          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 488.804 bits (1257), Expect = 1.611e-167
Identity = 238/476 (50.00%), Postives = 323/476 (67.86%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   NG    P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT+E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAMV+GDK+K+L +LLT+KC ++  T  P D+LTP A  +   IG   T +S I+  K+  +  +I +G+   N+ A S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  215 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKM---NGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFYQ 687          

HSP 2 Score: 123.25 bits (308), Expect = 1.611e-167
Identity = 70/189 (37.04%), Postives = 103/189 (54.50%), Query Frame = 2
Query:  128 SQNKITFEIKQHS----PVE----TENM--FSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            S+N I  EI   +    P E    T +M  ++T  D   +LRM   G +A + P+T+H +F + + K  +  AL  K  Q   +  + Y QYY+ C +AAK  +++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + +    P+LKAI+ Y
Sbjct:   16 SENPIVTEITSAAAMLHPAEGNLSTSDMKLWTTRRDNAVELRMEDSG-VASLPPVTIHQLFQDTVKKYGDYVALASK--QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY 201          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:100158533])

HSP 1 Score: 488.804 bits (1257), Expect = 1.624e-167
Identity = 238/476 (50.00%), Postives = 323/476 (67.86%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   NG    P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT+E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAMV+GDK+K+L +LLT+KC ++  T  P D+LTP A  +   IG   T +S I+  K+  +  +I +G+   N+ A S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  274 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAASAGKTVRLREATDMQEIVVSYLPLSHIAAQMIDIWLTMKHGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKVATWAKGVGLETNLKKM---NGSTPHPMKYHVAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDNDGSGEILFWGRHVFMGYLNMEDKTQESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPIEDALKEQVPIISNAMVIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIEFCRQIGSKATLVSDIVGGKDTAVYAAIQDGVNSVNQKATSNAQKVQKWLILDQDFSIAGGELGPTMKLKRPVVAKMYKDQIDSFYQ 746          

HSP 2 Score: 122.865 bits (307), Expect = 1.624e-167
Identity = 70/189 (37.04%), Postives = 103/189 (54.50%), Query Frame = 2
Query:  128 SQNKITFEIKQHS----PVE----TENM--FSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            S+N I  EI   +    P E    T +M  ++T  D   +LRM   G +A + P+T+H +F + + K  +  AL  K  Q   +  + Y QYY+ C +AAK  +++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + +    P+LKAI+ Y
Sbjct:   75 SENPIVTEITSAAAMLHPAEGNLSTSDMKLWTTRRDNAVELRMEDSG-VASLPPVTIHQLFQDTVKKYGDYVALASK--QGDQWHKMTYEQYYEQCRIAAKGFLKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQIQDQLPHLKAIIQY 260          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:MGI Symbol;Acc:MGI:3587728])

HSP 1 Score: 447.973 bits (1151), Expect = 1.043e-147
Identity = 224/474 (47.26%), Postives = 313/474 (66.03%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRH---SKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK-LDSEDGKEG--EICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I +  L   +     N+C  ++YTSGTTG PKGV++SHDN+ WTA  M   M+       +  ++SYLPLSH+AAQ+ DI IP+   A   FAQPDAL+G+L +TL+EV PT F+GVPR++EK+ + +KE     S ++K   +WAK +G + N  +M+ K + P  Y +AK ++F KV  +LG D C   FS+A+PLS DV  +F SLD+ I EIYGMSECSGP T+  ++ +R  S GK+L   GCK +     KEG  E+CM+GRHVFMGY+N  E T E  D   WLHSGD+G  +   +L+ITGRIKE+LITAGGEN++P+PIE  +KE +  IS+AM+VGDK K+LC+LLT+KC  D  +  P + L+  AK +   +G   T++S I+  ++  +  +I  GI   N+ A+S S  ++KW  L  DFS+ GGELGPT KLKR+V+ + Y A I+S+Y
Sbjct:  194 WNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLS--GCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          

HSP 2 Score: 97.0561 bits (240), Expect = 1.043e-147
Identity = 56/162 (34.57%), Postives = 92/162 (56.79%), Query Frame = 2
Query:  182 NMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKN-CPNLKAIVYY 664
             ++ST  D    LR++  G      P+T+  +F  + ++ +   AL  K  ++  + ++ +SQYY++C  AAKSLI++GL   + V I G NS EW +T  GTI AGG+  GIY TN+ E  +++I      + IV N++ L+K + +  +    +KAIV Y
Sbjct:   22 RLWSTHCDGEVLLRLSKHGP-GHETPMTIPELFQESAERFSAYPALASKNGKK--WDTLTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQY 180          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:MGI Symbol;Acc:MGI:2385656])

HSP 1 Score: 421.394 bits (1082), Expect = 7.069e-147
Identity = 205/470 (43.62%), Postives = 306/470 (65.11%), Query Frame = 1
Query:  766 EFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            E + LG  + ++ L   ++   PN+CC L+YTSGTTGNPKGVM+S DN+ WTA         + +   +E+++SYLPLSH+AAQ+ D+   +   A + FA PDALKG+L +TL+EV PT  +GVPRV+EKIME+++E+A     +++ +  WA  +    NL     +  PF   +A  ++  +V +ALGF +C   F  AAP++ +   +F  L++ +   YG+SE +GP  +     +R  S G+++P    KL ++D    GEIC++GR +FMGY+N  +KT E  DSE WLH+GD+G  + +G+L+ITGR+KEL+ITAGGEN+ PVPIE+ +K  L  IS+AM++GD+RK+L +LLT+KC +DP T  PTD LT  A  +   +G   +++S+I+  ++  +  +I EGI+R N NA +R   +QKW  L  DFS+ GGELGPT+KLKR  V E Y  +I+S Y+
Sbjct:  248 ELIELGQEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFADPDALKGTLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSNDLKPFTSRLADYLVLARVRQALGFAKCQKNFYGAAPMTAETQRFFLGLNIRLYAGYGLSESTGPHFMSSPYNYRLYSSGRVVPGCRVKLVNQDADGIGEICLWGRTIFMGYLNMEDKTCEAIDSEGWLHTGDMGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISSAMLIGDQRKFLSMLLTLKCTLDPETSEPTDSLTEQAVEFCQRVGSKASTVSEIVGQRDEAVYQAIHEGIQRVNANAAARPYHIQKWAILQRDFSISGGELGPTMKLKRLTVLEKYKDIIDSFYQ 717          

HSP 2 Score: 121.324 bits (303), Expect = 7.069e-147
Identity = 60/162 (37.04%), Postives = 97/162 (59.88%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            E +++T  D   +LR+         +P T+H MF+ A+DK  N  AL +K  ++  +  I+Y QYY +    AK  +++GL    SV I G NSPEWF +  GT+FAGG+ +GIY T++ E  ++I ++C   V +V  ++ L+K + + K+ P+LKA+V Y
Sbjct:   76 EALWTTRADGRVRLRLE---PFCTQRPYTVHQMFYEALDKYGNLSALGFK--RKDKWERISYYQYYLIARKVAKGFLKLGLERAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYISHDCRANVIVVDTQKQLEKILKIWKDLPHLKAVVIY 232          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsbg3 (acyl-CoA synthetase bubblegum family member 3 [Source:MGI Symbol;Acc:MGI:1925875])

HSP 1 Score: 321.627 bits (823), Expect = 2.265e-103
Identity = 163/483 (33.75%), Postives = 272/483 (56.31%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFR---HSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALK----------GSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE-NGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W  F++L   I+D+ L   ++ L PN+CC+L+Y  GTTG  K +M+SHDN+ WT   ++  + F+     +E+L+SYLPL     Q+ D+ + +    T++F   D+ K          G L   L+EV PT F G+P V++++++ +K   +D ++ ++ I  WA  +G  TN   MM E + P  + +AK + F +  K LG + C    +    L    L +F S+++ I E+YG+SEC+G  T+     +R  S GK LP    K++ E+    G +C++GRH+FMGY+   + T+   D+  WLH+ D+G  + + +L++ G   +L+  + GE + P PIE++++  +  +  AM+VG    YLC LLT+KC I+P T     +LT         +    T +S ++ D++P ++  I++GI+  N  A +  A++ KW  L +DFSV GGELGP  K+ R++V ++Y   I  LYE
Sbjct:  219 WKGFLDLADGISDEKLDKIIDTLKPNQCCALVYNQGTTGPSKAIMLSHDNITWTTAAIVQSLGFKCPPQGQEILVSYLPLCFPGIQILDVWVAISVAGTVYFPSLDSGKWSGLPRTPGTGFLMELLREVQPTTFCGIPWVWDRMLDSLKTKFLDSTAFRRRIDHWAMRMGLHTNKKLMMGEIHQPLCFGLAKRLTFERARKFLGLNHCQQFLNMGMGLPSGTLDFFLSVNIPIMELYGLSECTGLHTVSNLQAYRILSAGKALPKTHTKVEKENKDGIGNLCIWGRHIFMGYLRDKQSTERKVDTHGWLHTNDLGFLDFDKFLYVMGNNNDLIKLSSGEMVNPYPIEERVRTRIPIVRYAMLVGQDAPYLCALLTLKCQINPETGEARSNLTSEVVACCRKLRSQSTWLSDVLYDRDPLVTEFINQGIEDVNSEAPTMGAKIIKWVILDNDFSVDGGELGPMSKMNRSIVVKIYQEEIQKLYE 701          

HSP 2 Score: 75.8702 bits (185), Expect = 2.265e-103
Identity = 48/150 (32.00%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  215 KLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            +LRM  K  L    P+T+  +  +A  K ++  A+  KY +    L+  Y +YY+ C  AAK+ +++GL     V I G NS EW I   G I AGG++ GI  + + +  + I    E  + +V N+  L+K   +     +LKAI+ Y
Sbjct:   59 QLRMG-KDPLDNEPPVTVPDLIMSAATKYSHYLAIGSKYKKSWQLLT--YIEYYEACRRAAKAFLKVGLERFHGVGIMGINSSEWVIASIGAIMAGGISVGILSSISPKACQVIAETSEMDIFVVDNDRQLQKINQIQGYLKHLKAIIQY 205          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl5 (acyl-CoA synthetase long-chain family member 5 [Source:MGI Symbol;Acc:MGI:1919129])

HSP 1 Score: 163.31 bits (412), Expect = 1.120e-45
Identity = 140/458 (30.57%), Postives = 226/458 (49.34%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK--FR-HSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTP--AAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFL-PHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            P +   + +TSGTTG+PKG M++H+N+V      L +++  F+  S ++ ISYLPL+H+  ++   I+   C   I F Q D     L   +K + PT F  VPR+  ++ ++++  A   + +KK + + A    +      +++ +     S+   ++F+K+  +LG    L I + AAP+S  VL +F A++   + E YG +EC+G  +I    ++  G VG  +     KL D  D        EGEIC+ G +VF GY+  PEKT+EV D + WLH+GD+G +   G L I  R K +   A GE IAP  IE     +   +    V G+  +   + +           +P  D  P  AAK    G      S  ++   KN  +  +I E +++  +    +S E  K  F+ P  F++  G L PTLK KR  + + +   I SLYE
Sbjct:  252 PEDLSVICFTSGTTGDPKGAMLTHENVVSNMAAFLKFLEPIFQPTSDDVTISYLPLAHMFERLVQGIL-FSCGGKIGFFQGDIR--LLPDDMKALKPTVFPTVPRLLNRVYDKVQNEAK--TPLKKFLLNLAIISKFNEVKNGIIRRD-----SLWDKLVFSKIQGSLGGKVRLMI-TGAAPISTPVLTFFRAAMGCWVFEAYGQTECTGGCSITSPGDWTAGHVGTPVACNFVKLEDVADMNYFSVNNEGEICIKGNNVFKGYLKDPEKTQEVLDKDGWLHTGDIGRWLPNGTLKIVDRKKNIFKLAQGEYIAPEKIENVYSRSRPVL-QVFVHGESLRSFLIGVV----------VPDPDSLPSFAAKIGVKG------SFEELC--KNQCVKEAILEDLQKIGKEGGLKSFEQVKSIFVHPEPFTIENGLLTPTLKAKRVELAKFFQTQIKSLYE 679          

HSP 2 Score: 41.2022 bits (95), Expect = 1.120e-45
Identity = 43/161 (26.71%), Postives = 62/161 (38.51%), Query Frame = 2
Query:  263 TLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKS--VCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYV-CVSKN-CPNLKAIVYYGGLIDDSIKGGCK-----ISLYD 718
            TL+  F   +    N   L Y+   +  +  I+Y Q           L+  G  + +   V I   N PEW I+         VA  +Y T   E + F+IN  +  V I    +     V  V K   P LK I+      DD +K G K     +SL+D
Sbjct:   76 TLYENFQRGLAVSDNGPCLGYRKPNQP-YKWISYKQVSDRAEYLGSCLLHKGYKSSQDQFVGIFAQNRPEWVISELACYTYSMVAVPLYDTLGTEAIIFVINRADIPVVICDTPQKATMLVENVEKGLTPGLKTIILMDPFDDDLMKRGEKCGVEMLSLHD 235          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Match: Acsl1 (acyl-CoA synthetase long-chain family member 1 [Source:MGI Symbol;Acc:MGI:102797])

HSP 1 Score: 162.155 bits (409), Expect = 2.700e-43
Identity = 138/468 (29.49%), Postives = 219/468 (46.79%), Query Frame = 1
Query:  808 IGRLNHLIPN-----ECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFR---HSKEMLISYLPLSHVAAQMCDIIIPLLCQ-ATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSEDGK------EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            +GR+N + P      +   + +TSGTTGNPKG M++H N++      +   +     ++ +  ISYLPL+H+  Q    +  +LC  A I F Q D     L   LK + PT F  VPR+  ++ +++      F     S+  W  D   +   A++ +       S+   +IF+K+  +LG    L I + AAP+S  VL +   +L     E YG +EC+    +    ++  G VG  +P    KL D E+        EGE+C+ G +VF GY+  P +T E  D + WLH+GD+G +   G L I  R K +   A GE IAP  IE  I    + ++   V G+  +       I  V+  V  +P    + A KR   G      S  ++  +K+   +I +D+ +K   E  +    +V+     P  FS+  G L PTLK KR  +   + + I+ LY
Sbjct:  255 LGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGAMITHQNIINDCSGFIKATESALTLNASDTQISYLPLAHMYEQQLQCV--MLCHGAKIGFFQGDIR--LLMDDLKVLQPTIFPVVPRLLNRMFDRI------FGQANTSLKRWLLDFASKRKEAEL-RSGIVRNNSLWDKLIFHKIQSSLGGKVRLMI-TGAAPVSATVLTFLRTALGCQFYEGYGQTECTAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKDPARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIEN-IYLRSEAVAQVFVHGESLQ----AFLIAVVVPDVESLP----SWAQKRGLQG------SFEELCRNKDINKAI-LDDLLKLGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELY 694          

HSP 2 Score: 34.6538 bits (78), Expect = 2.700e-43
Identity = 36/151 (23.84%), Postives = 57/151 (37.75%), Query Frame = 2
Query:  263 TLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLN--ARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYV--CVSKNCPNLKAIVYYGGLIDDSIKGGCK 703
            T++  F   I    N   L  +   +  +  I+Y +  +L       LIQ G    + + + +   N PEW I   G      V   +Y T   + + +I+N  E  V      E  K  +    +K  P LK IV       D ++ G K
Sbjct:   92 TMYDGFQRGIQVSNNGPCLGSRKPNQP-YEWISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCFSYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIMDSYGSDLVERGKK 241          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q7ZYC4|ACBG2_XENLA (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis OX=8355 GN=acsbg2 PE=2 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 8.509e-166
Identity = 236/476 (49.58%), Postives = 320/476 (67.23%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +I D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDN+ WTA      ++ R +   +E+++SYLPLSH+AAQM DI + +      +FAQPDALKGSL  TL+EV PT F+GVPRV+EK+ E+MK +    S++K+ +++WAK +G  TNL KM   NG    P  Y +A  ++F KV KALG DRC   ++ AAP++ D L +F SL++ + E+YGMSE SGP TI   + FR  S GK++     K+   D    GEI  +GRHVFMGY+N  +KT E  D E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVP E  +KE +  ISNAM++GDK+K+L +LLT+KC ++  T  P D+LTP A ++   IG   T +S I+  K+  +  +I EG+   NE + S + +VQKW  L  DFS+ GGELGPT+KLKR VV ++Y   I+S Y+
Sbjct:  254 WKEFMQLGKDIPDSQLDQIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNITWTAAAAGKTVRLREATDLQEIVVSYLPLSHIAAQMIDIWLTMKYGGATYFAQPDALKGSLAITLREVRPTAFMGVPRVWEKMQEKMKAVGAKSSTIKRKMATWAKGVGLETNLKKM---NGSTPHPMKYHVANKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLNIPVYELYGMSESSGPHTISLPDAFRITSCGKVISGCKTKIHQPDSDGSGEILFWGRHVFMGYLNMEDKTHESLDEEGWLHSGDIGKHDENGFLYITGRIKELIITAGGENIPPVPTEDAVKEQVPIISNAMLIGDKKKFLSMLLTLKCNVNADTGEPEDELTPEAIQFCRQIGSKATLVSDIVGGKDTAVYAAIQEGVNSVNEKSTSNAQKVQKWLILEKDFSITGGELGPTMKLKRPVVAKMYKDQIDSFYQ 726          

HSP 2 Score: 125.946 bits (315), Expect = 8.509e-166
Identity = 73/191 (38.22%), Postives = 104/191 (54.45%), Query Frame = 2
Query:  122 NKSQNKITFEIKQ-----HSPVE---TENM--FSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            N S+  I  EI       HS VE   T +M  ++   D   KLR+    D+A + P+T+H +F   ++K  +  AL  K  Q   +  ++Y QYY+ C +AAK  I++GL     V I G NS EWFI   G IFAGG A GIY TN+ E   ++  NCE  + +V N++ L+K + V    P+LKAI+ Y
Sbjct:   53 NSSEKPIVPEISSSDVMVHSAVENLPTSDMKLWTAQRDSAVKLRLE-DSDVASLPPVTIHQLFQETVNKYGDYVALASK--QGDQWHKMSYKQYYEQCRIAAKGFIKLGLERYHGVGILGFNSAEWFIADVGAIFAGGFAVGIYTTNSAEACHYVAQNCEANIIVVENQKQLQKILQVQDQLPHLKAIIQY 240          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q5ZKR7|ACBG2_CHICK (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus OX=9031 GN=ACSBG2 PE=2 SV=2)

HSP 1 Score: 471.855 bits (1213), Expect = 3.014e-159
Identity = 235/478 (49.16%), Postives = 319/478 (66.74%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWT---AECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL----DSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W EF++LG +I D  L   +    PN+CC+LIYTSGTTG PKGVM+SHDNL WT   A   L  ++    +E+++SYLPLSHVAAQM DI +P+     + FAQPDALKG+L  TL+EV PT F+GVPRV+EKI E+MK +    S++++ ++SWAK +G +TNL  M   NG    P  + +A+ +++ KV KA+G DRC   F+ AAP+S + L +F SL++ + E+YGMSE SGP T+     FR  S GK +   GC+        DG  GEIC  GRH+FMGY+N  EKTKE  D + WLHSGD+G  + +G+++ITGRIKEL+ITAGGEN+ PVPIE  +KE    ISNAM+VGDK K+L +LLT+KC+I+  +  P DDLT  A  +   +G   T +S+II+ K+  +  +I   +   N+ A+S + ++QKW  L  DFSV GGELGPT+KLKR VV + Y  LI+  Y
Sbjct:  248 WREFLDLGEDIPDSQLREIIESQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTSIAAGRSLMLLEATEKQELVVSYLPLSHVAAQMIDIWLPVTFGGQVFFAQPDALKGTLVDTLREVRPTAFLGVPRVWEKIEEKMKSVGAKSSTLRRKVASWAKGVGLQTNLKWM---NGHSEVPMNFRLARQLVYKKVRKAIGLDRCTKCFTGAAPISRETLEFFLSLNIPVFELYGMSESSGPHTVSIPQAFRLTSCGKEMA--GCRTLIHKPDADGI-GEICFAGRHIFMGYLNMEEKTKEAIDKDGWLHSGDLGKCDKDGFIYITGRIKELIITAGGENVPPVPIEDAVKEACPIISNAMLVGDKAKFLAMLLTLKCIINTESGEPGDDLTAEAIEYCQKLGSKATKVSEIISSKDKAVYAAIQAAVSEVNKRAVSNAQKIQKWVVLEKDFSVGGGELGPTMKLKRPVVAQKYKDLIDEFY 719          

HSP 2 Score: 114.39 bits (285), Expect = 3.014e-159
Identity = 61/163 (37.42%), Postives = 91/163 (55.83%), Query Frame = 2
Query:  182 NMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANE-ELLKKYVCVSKNCPNLKAIVYYG 667
            N+++T  D   KLRM+ +G +    P T+H +F  A+ K  +  AL  K  +   ++ + Y  YY  C  AAKS +++ L     VCI G NSPEWFI   G IFAGG+A GIY TN+ E   ++  NC   + +V N  +  +K + +    P++KAI+ YG
Sbjct:   76 NVWTTQQDGEVKLRMDEEG-MGSEAPKTVHEVFQEAVSKYGDYYALASK--KNGQWVKLTYKMYYDKCWKAAKSFLKLVLERFHGVCILGFNSPEWFIADIGAIFAGGLAVGIYTTNSPEACHYVAENCSANILVVENHTQACRKSLEIEHKLPHMKAIIQYG 235          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q96GR2|ACBG1_HUMAN (Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens OX=9606 GN=ACSBG1 PE=1 SV=2)

HSP 1 Score: 430.254 bits (1105), Expect = 8.264e-148
Identity = 214/470 (45.53%), Postives = 307/470 (65.32%), Query Frame = 1
Query:  766 EFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            EFM LG  + ++ L   ++   PN+CC L+YTSGTTGNPKGVM+S DN+ WTA         R +   +E+++SYLPLSH+AAQ+ D+   +   A + FA+PDALKGSL +TL+EV PT  +GVPRV+EKIME+++E+A     +++ +  WA  +    NL     +  PF   +A  ++  KV +ALGF +C   F  AAP+  +   +F  L++ +   YG+SE SGP  +     +R  S GK++P    KL ++D +  GEIC++GR +FMGY+N  +KT E  D E WLH+GD G  + +G+L+ITGR+KEL+ITAGGEN+ PVPIE+ +K  L  ISNAM++GD+RK+L +LLT+KC +DP T   TD+LT  A  +   +G   T++S+II  K+  +  +I+EGI+R N NA +R   +QKW  L  DFS+ GGELGPT+KLKR  V E Y  +I+S Y+
Sbjct:  251 EFMELGNEVPEEALDAIIDTQQPNQCCVLVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIRPAEVQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPGSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMMAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKLVPGCRVKLVNQDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDEEGWLHTGDAGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKMELPIISNAMLIGDQRKFLSMLLTLKCTLDPDTSDQTDNLTEQAMEFCQRVGSRATTVSEIIEKKDEAVYQAIEEGIRRVNMNAAARPYHIQKWAILERDFSISGGELGPTMKLKRLTVLEKYKGIIDSFYQ 720          

HSP 2 Score: 117.857 bits (294), Expect = 8.264e-148
Identity = 62/162 (38.27%), Postives = 97/162 (59.88%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            E +++T  D   +LR++         P T+H MF+ A+DK  +  AL +K  ++  +  I+YSQYY L   AAK  +++GL    SV I G NSPEWF +  GT+FAGG+ +GIY T++ E  ++I  +C   V +V  ++ L+K + + K  P+LKA+V Y
Sbjct:   79 EALWTTRADGRVRLRIDPS---CPQLPYTVHRMFYEALDKYGDLIALGFK--RQDKWEHISYSQYYLLARRAAKGFLKLGLKQAHSVAILGFNSPEWFFSAVGTVFAGGIVTGIYTTSSPEACQYIAYDCCANVIMVDTQKQLEKILKIWKQLPHLKAVVIY 235          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q2XU92|ACBG2_MOUSE (Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus OX=10090 GN=Acsbg2 PE=1 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 6.348e-147
Identity = 224/474 (47.26%), Postives = 313/474 (66.03%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRH---SKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMM-KENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK-LDSEDGKEG--EICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W +FM LG +I +  L   +     N+C  ++YTSGTTG PKGV++SHDN+ WTA  M   M+       +  ++SYLPLSH+AAQ+ DI IP+   A   FAQPDAL+G+L +TL+EV PT F+GVPR++EK+ + +KE     S ++K   +WAK +G + N  +M+ K + P  Y +AK ++F KV  +LG D C   FS+A+PLS DV  +F SLD+ I EIYGMSECSGP T+  ++ +R  S GK+L   GCK +     KEG  E+CM+GRHVFMGY+N  E T E  D   WLHSGD+G  +   +L+ITGRIKE+LITAGGEN++P+PIE  +KE +  IS+AM+VGDK K+LC+LLT+KC  D  +  P + L+  AK +   +G   T++S I+  ++  +  +I  GI   N+ A+S S  ++KW  L  DFS+ GGELGPT KLKR+V+ + Y A I+S+Y
Sbjct:  194 WNDFMELGNDIPNIQLDRVILSQKANQCAVILYTSGTTGTPKGVLLSHDNITWTAGAMSQEMEINRVSGKQNTIVSYLPLSHIAAQLTDIWIPIKIGALTFFAQPDALRGTLVYTLQEVKPTLFMGVPRIWEKMQDTIKENVARSSRLRKKAFAWAKMLGLKVNTKRMLGKRDIPMNYRMAKALVFAKVRTSLGLDNCHAFFSSASPLSQDVSEFFLSLDIPIGEIYGMSECSGPHTVSNKSVYRVLSCGKVLS--GCKNMLYNQNKEGVGEVCMWGRHVFMGYLNKEEATLEALDENGWLHSGDIGRLDSHDFLYITGRIKEILITAGGENVSPIPIETLVKEKIPIISHAMLVGDKAKFLCMLLTLKCETDRKSGEPLNKLSVEAKSFCQMLGSQATTVSDILKSRDQVVYTAIQYGIDIVNQQAMSDSHRIRKWIILEKDFSIQGGELGPTSKLKRSVITQKYKAQIDSMY 665          

HSP 2 Score: 97.0561 bits (240), Expect = 6.348e-147
Identity = 56/162 (34.57%), Postives = 92/162 (56.79%), Query Frame = 2
Query:  182 NMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKN-CPNLKAIVYY 664
             ++ST  D    LR++  G      P+T+  +F  + ++ +   AL  K  ++  + ++ +SQYY++C  AAKSLI++GL   + V I G NS EW +T  GTI AGG+  GIY TN+ E  +++I      + IV N++ L+K + +  +    +KAIV Y
Sbjct:   22 RLWSTHCDGEVLLRLSKHGP-GHETPMTIPELFQESAERFSAYPALASKNGKK--WDTLTFSQYYEMCRKAAKSLIKLGLQRFQCVGILGFNSVEWVVTALGTILAGGLCVGIYATNSAEACQYVIQQANVSILIVENDQQLQKILLIPPDKMETVKAIVQY 180          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Match: sp|Q2KHW5|ACBG1_BOVIN (Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus OX=9913 GN=ACSBG1 PE=2 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 1.063e-146
Identity = 215/480 (44.79%), Postives = 312/480 (65.00%), Query Frame = 1
Query:  766 EFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE*YSDQIGHSI 2193
            E M LG  + ++ L   +N   PN+CC+L+YTSGTTGNPKGVM+S DN+ WTA         + +   +E+++SYLPLSH+AAQ+ D+   +   A + FA+PDALKGSL +TL+EV PT  +GVPRV+EKIMEQ++E+A     + + +  WA  +    NL     +  PF   +A  ++  KV +ALGF +C   F  AAP++ +   +F  L++ +   YG+SE SGP  +     +R  S GK++P    KL +ED +  GEIC++GR +FMGY+N  +KT E  D+E WLH+GD G  + +G+L+ITGR+KEL+ITAGGEN+ PVPIE+ +K  L  I NAM++GD+RK+L +LLT+KC +DP T  PTD+LT  A  +   +G   T++S+++  K+  +  +I+EGI+R N NA +R   +QKW  L  DFS+ GGELGPT+KLKR  V E Y  +I+S Y+    + G S+
Sbjct:  234 ELMELGNEVPEEALDVIINAQKPNQCCALVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEIQQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPRVWEKIMEQIQEVAAQSGFIWRKMLLWAMSVTLEQNLTCPSSDLKPFTTRLADYLVLAKVRQALGFAKCQKNFYGAAPMTAETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSGKVVPGCQVKLVNEDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDAEGWLHTGDTGRLDADGFLYITGRLKELIITAGGENVPPVPIEEAVKTELPIIRNAMLIGDQRKFLSMLLTLKCTLDPDTFEPTDNLTEQAVEFCQRVGSKATTVSEVVGKKDEAVYQAIEEGIQRVNMNAAARPYHIQKWAILEKDFSISGGELGPTMKLKRLAVLEKYKDVIDSFYQEQKSKQGSSL 713          

HSP 2 Score: 113.62 bits (283), Expect = 1.063e-146
Identity = 58/169 (34.32%), Postives = 99/169 (58.58%), Query Frame = 2
Query:  158 QHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            Q +P E E +++T  D   +LR++    +    P T+H MF   +DK  +  A+ +K  ++ ++  I+Y+QYY L   AAK  +++GL    SV I   NSPEWF +  G +F GG+ +GIY T++ E  ++I  +C   + +V  ++ L+K + + K+ P+LKA+V Y
Sbjct:   56 QLNPPE-EALWTTRADGRVRLRID---PICSQTPRTVHQMFSTTLDKYGDLSAMGFK--RQGTWEHISYTQYYLLARKAAKGFLKLGLERAHSVAILAFNSPEWFFSAVGAVFGGGIITGIYTTSSPEACQYIAYDCRANIIVVDTQKQLEKILKIWKHLPHLKAVVIY 218          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: W5L9W3 (AMP-binding domain-containing protein OS=Astyanax mexicanus OX=7994 PE=4 SV=2)

HSP 1 Score: 503.827 bits (1296), Expect = 2.815e-173
Identity = 244/471 (51.80%), Postives = 324/471 (68.79%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG-PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLD--SEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W +FM LG +I DD L   +N    NECCSLIYTSGTTGNPKGVM+SHDN+ W A      +  +  +E L+SYLPLSHVAAQ+ D+ + +    T HFA+PDALKGSL +TL++V PT F+GVPRV+EK+ E M+ +    S++KK I+ WAK IG +TN   M  +   P+G+ +A  +IF +V  ALG DRC   F+ AAP++ + L YF SL++ + E+YGMSE +GP T+ ++N FR  S GK++     KLD   EDG  GE+C +GRHVFMGY+N PEKT E  D+E WLHSGD+G  +   +++ITGRIKEL+ITAGGEN+ PVPIE  +KE +  ISNAM+VGDK+K+L +LLT+KC +D     PTD+LTP A  +    G   T +S+II +K P +  +I EG+   NE A S +  VQKWT LP DFS+ GGELGPT+KLKR VV+++Y   I+  YE
Sbjct:  298 WADFMKLGTDIADDQLDDLINSQNANECCSLIYTSGTTGNPKGVMLSHDNITWIANASGMMIGTKMKEESLVSYLPLSHVAAQVNDLWVSMKFAGTTHFAEPDALKGSLANTLRDVRPTSFLGVPRVWEKMQEAMQSIGAKNSAMKKRIADWAKGIGLQTNYNLMNGDTSVPWGFMLANNLIFKRVRAALGLDRCRTCFTGAAPITKETLEYFMSLNIQLYELYGMSESTGPHTLSWENNFRIMSCGKVIRGCKTKLDKPDEDGN-GEVCFWGRHVFMGYLNMPEKTDEALDTEGWLHSGDLGKLDQNDFMYITGRIKELIITAGGENVPPVPIEDALKEEVSIISNAMLVGDKKKFLAMLLTLKCKVDDNGD-PTDELTPLAVEYCQQRGVTATKVSEIINNKEPAIYKAIQEGVNIINEKATSNAQRVQKWTLLPRDFSISGGELGPTMKLKRPVVSKMYKDDIDKFYE 766          

HSP 2 Score: 137.117 bits (344), Expect = 2.815e-173
Identity = 73/183 (39.89%), Postives = 109/183 (59.56%), Query Frame = 2
Query:  140 ITFEIKQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSI 688
            ITFE++  S    E  +S++ DK  KLRM   G  +   P+T+H MF + ++K  +  AL++K  +  ++ ++ Y QYYQ C  AAKS +++GL     V I G NSPEWFI+    I AGG+ +GIY TN+ E  +++ +NCE  V +V N + L K + V    P+LKAIV Y G ++  I
Sbjct:  116 ITFEVRLAS---AEQYWSSARDKAVKLRMAESGPGSEA-PLTIHQMFQDTVNKYGDHPALRWK--ENGAWTTLTYKQYYQHCRTAAKSFLKLGLERFHGVGILGFNSPEWFISNVACIMAGGLTTGIYTTNSAEACQYVAHNCEANVIVVENNKQLVKILQVKDQLPHLKAIVQYKGELERKI 292          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A3P8WSG3 (AMP-binding domain-containing protein OS=Cynoglossus semilaevis OX=244447 PE=4 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 1.243e-171
Identity = 242/469 (51.60%), Postives = 328/469 (69.94%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEN-GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            W EFM LG ++ D+ L  R++ L  NECC+LIYTSGTTGNPKGVM+SHDNL WTA      + + +  E+L+SYLPLSHVAAQM DI + +    T++FA PDALKGSLG TL+E  PTYF+GVPRV+EK+ E+MK M +  S +++ +++WAK IG + N + M  EN  P+GY +A  ++F KV  ALG DRC   F+ AAP+S D L YF SL++ + E+YGMSE SGP T+   +++   S GK++P    KL++ D +  GEIC +GRH+FMGY+N  +KT E  D + WLHSGD+G  +   +LFITGRIKEL+ITAGGENI PVPIE K+K  +  +SN M++GDK K+L +LLT+KCV+D   + PTDDL+P A  +    G   T +S+II ++ P +  +I EG++R N  A S + +VQKW  L  DFSVPGGELGPT+KL+R +V ++Y   IN +Y
Sbjct:  261 WEEFMKLGSDVPDEQLNARIDSLRANECCTLIYTSGTTGNPKGVMLSHDNLTWTARTASTLVDYSYGDEVLVSYLPLSHVAAQMVDIWLSMTFGGTVYFADPDALKGSLGTTLREARPTYFLGVPRVWEKMQEKMKAMGMKASPMRRRVANWAKSIGLQYNYSAMNGENVVPWGYMLANNLVFKKVRAALGLDRCKICFTGAAPISKDTLEYFMSLNIPLMELYGMSESSGPHTVSVNHDYSITSCGKVMPGCKTKLENPDNEGIGEICFWGRHIFMGYLNMVDKTAEALDQDGWLHSGDLGKHDRNKFLFITGRIKELIITAGGENIPPVPIEDKLKAEVPILSNVMLIGDKLKFLSMLLTLKCVMDDNGE-PTDDLSPEALDYCQQHGVTATKVSEIIANREPAIYKAIQEGLERVNAMATSNAQKVQKWVILDKDFSVPGGELGPTMKLRRPIVVKMYEDKINEMY 728          

HSP 2 Score: 128.257 bits (321), Expect = 1.243e-171
Identity = 66/164 (40.24%), Postives = 100/164 (60.98%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            + ++ST  DK  KLRM   G +A   P T+H +F  A+++  +  ALK K  +E  ++++ + +YY+ C  AAKS +++GL     V I G N+ EWFI+  G IFAGG+A+GIY TN+ E   ++  NCE  + +V N++ L K + V    P+LKAIV Y G
Sbjct:   89 DQLWSTHRDKAVKLRMEGSG-IASETPRTVHQLFLEAVEQCGDYPALKSK--KEGQWVTLTWREYYKQCRAAAKSFLKLGLERYHGVGILGFNAAEWFISDIGCIFAGGLAAGIYTTNSPEACMYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIVQYRG 249          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: B0S7E7 (Acyl-CoA synthetase bubblegum family member 2 (Fragment) OS=Danio rerio OX=7955 GN=acsbg2 PE=1 SV=1)

HSP 1 Score: 519.62 bits (1337), Expect = 5.466e-171
Identity = 247/477 (51.78%), Postives = 332/477 (69.60%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM---MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL---DSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM DI +P+      +FAQPDALKGSL +TL+E+ PT F+GVPRV+EK+ E+MK +    S+V++ ++SWAKD+G +TNL KM        P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE SGP TI   N FR  S GK++P  GCK    + +D K GEIC +GRHVFMGY+N P+KT+E  D+E WLHSGD+G  ++  +LFITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAM++GDKRK+L +LLT+KC I+  T +P D+LTP A  +   +G + T +++I   ++  +  +I +GI R NE A S +  +QKWT L  DFS+PGGELGPT+KLKR VV ++Y   I S Y+
Sbjct:  305 WAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIP--GCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFYK 779          

HSP 2 Score: 113.62 bits (283), Expect = 5.466e-171
Identity = 59/166 (35.54%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  167 PVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            P +   +++T  D   KLRM   G L    P+T++ MF + + +  +  AL +K  ++  + ++ YS+YY+ C  AAKS +++GL     V I G NS EWFI     I AGG A GIY TN+ E  +++  NC+  + +V N + L+K + +    P+LKAI+ Y
Sbjct:  129 PTKGTELWTTHRDGEVKLRMAESG-LGAETPLTVNQMFTSTVQRFGSYPALGWKEGEQ--WKTMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY 291          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: F1RCV2 (Acyl-CoA synthetase bubblegum family member 2 OS=Danio rerio OX=7955 GN=acsbg2 PE=1 SV=2)

HSP 1 Score: 519.235 bits (1336), Expect = 5.468e-171
Identity = 247/477 (51.78%), Postives = 332/477 (69.60%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM---MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL---DSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM DI +P+      +FAQPDALKGSL +TL+E+ PT F+GVPRV+EK+ E+MK +    S+V++ ++SWAKD+G +TNL KM        P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE SGP TI   N FR  S GK++P  GCK    + +D K GEIC +GRHVFMGY+N P+KT+E  D+E WLHSGD+G  ++  +LFITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAM++GDKRK+L +LLT+KC I+  T +P D+LTP A  +   +G + T +++I   ++  +  +I +GI R NE A S +  +QKWT L  DFS+PGGELGPT+KLKR VV ++Y   I S Y+
Sbjct:  253 WAEFMELGRDEPDTQLDDIISSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAVATSQHVSLNDADKLQEVVVSYLPLSHIAAQMIDIWLPMKAGGVTYFAQPDALKGSLANTLREIRPTAFLGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLQTNLNKMELGSNSRKPLNYRLAKHLVFRKVRKALGLDRCTRCYTGAAPITKDTLEFFLSLDIPLFELYGMSESSGPHTITQANAFRLTSCGKVIP--GCKTKLSNPDDEKNGEICFWGRHVFMGYLNMPDKTEEALDAEGWLHSGDLGKLDENNFLFITGRIKELIITAGGENIPPVPIEDAVKEAIPLISNAMLIGDKRKFLSMLLTVKCQINGETGVPEDELTPEAVEFCRKLGSSCTRVTEIAGGRDRAVQAAIQDGINRVNEKATSNAQRIQKWTVLDQDFSIPGGELGPTMKLKRPVVMKMYKEQIESFYK 727          

HSP 2 Score: 114.005 bits (284), Expect = 5.468e-171
Identity = 59/166 (35.54%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  167 PVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            P +   +++T  D   KLRM   G L    P+T++ MF + + +  +  AL +K  ++  + ++ YS+YY+ C  AAKS +++GL     V I G NS EWFI     I AGG A GIY TN+ E  +++  NC+  + +V N + L+K + +    P+LKAI+ Y
Sbjct:   77 PTKGTELWTTHRDGEVKLRMAESG-LGAETPLTVNQMFTSTVQRFGSYPALGWKEGEQ--WKTMTYSEYYKSCRTAAKSFLKLGLERYHGVGILGFNSTEWFIADIAAILAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY 239          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Match: A0A1S3T5V9 (long-chain-fatty-acid--CoA ligase ACSBG2-like isoform X3 OS=Salmo salar OX=8030 GN=LOC106613839 PE=4 SV=1)

HSP 1 Score: 511.916 bits (1317), Expect = 1.400e-170
Identity = 245/477 (51.36%), Postives = 332/477 (69.60%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRH---SKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG-----PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   +    PN+CC+LIYTSGTTG PKGVM+SHDNL WTA  +  Y++      S+EM++SYLPLSH+AAQM DI + +      +FAQPDALKGSL +T++EV PT F+GVPRV+EK+ E+MK +    S+V++ ++ WAK +G +TNL+KM  +NG     P  Y +AK ++F KV KALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE +GP TI   + FR  SVGK++P    K+++ D +  GEIC +GRHVFMGY+N  +KT++  D+E WLHSGD+G  +D G+LFITGRIKEL+ITAGGENI PVPIE  +KE +  +SNAM++GDKRK+L +LLTIKC ++  T  P D+L P A      +G N T +S+I   ++P +  +I EGI R NE A S +  +QKWT L  DFS+PGGELGPT+KLKR VV ++Y   + + Y+
Sbjct:  265 WAEFMELGRDEPDTKLDDIIAIQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAFAVGRYVRLAEATKSQEMVVSYLPLSHIAAQMVDIWVTMKVGGATYFAQPDALKGSLVNTMREVRPTAFMGVPRVWEKMQEKMKSVGAKSSTVRRKVAVWAKGVGLQTNLSKM-NQNGAMARTPMNYRLAKKLVFKKVRKALGLDRCTKCYTGAAPITKDTLEFFLSLDIPVYELYGMSESTGPHTISLPDAFRLTSVGKLIPGCETKINNPDEEGNGEICFWGRHVFMGYLNQADKTEDALDAEGWLHSGDLGKHDDNGFLFITGRIKELIITAGGENIPPVPIEDAVKEAVPLVSNAMLIGDKRKFLAMLLTIKCQVNGDTGAPEDELMPEAIELCRKLGSNATRVSEIAGGRDPVIHAAIQEGINRVNEKATSNAQRIQKWTILNQDFSIPGGELGPTMKLKRPVVMKMYKEQVENFYK 740          

HSP 2 Score: 120.168 bits (300), Expect = 1.400e-170
Identity = 62/165 (37.58%), Postives = 96/165 (58.18%), Query Frame = 2
Query:  170 VETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            V   +++++S D   KLRM   G  A   P+T+  MF  A+++  +  AL +K  +++   +INY +YYQ C  AAKS +++GL     V I G NS EWFI+    I AGG A GIY TN+ +  +++  NC+  + +V N + L+K + V    P+LKAI+ Y
Sbjct:   90 VAKPDLWTSSGDGEVKLRMGESG-FASEPPLTVDQMFKTAVERFGSYTALGWKEGEQTK--TINYQEYYQACRTAAKSFLKLGLERYHGVGILGFNSAEWFISDIAAILAGGFAVGIYTTNSPDACQYVAENCKANIIVVENHKQLQKILQVQDKLPHLKAIIQY 251          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: ENSAMXT00000016625.2 (long-chain-fatty-acid--CoA ligase ACSBG2-like [Source:NCBI gene;Acc:103043523])

HSP 1 Score: 503.827 bits (1296), Expect = 1.794e-176
Identity = 244/471 (51.80%), Postives = 324/471 (68.79%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENG-PFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLD--SEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W +FM LG +I DD L   +N    NECCSLIYTSGTTGNPKGVM+SHDN+ W A      +  +  +E L+SYLPLSHVAAQ+ D+ + +    T HFA+PDALKGSL +TL++V PT F+GVPRV+EK+ E M+ +    S++KK I+ WAK IG +TN   M  +   P+G+ +A  +IF +V  ALG DRC   F+ AAP++ + L YF SL++ + E+YGMSE +GP T+ ++N FR  S GK++     KLD   EDG  GE+C +GRHVFMGY+N PEKT E  D+E WLHSGD+G  +   +++ITGRIKEL+ITAGGEN+ PVPIE  +KE +  ISNAM+VGDK+K+L +LLT+KC +D     PTD+LTP A  +    G   T +S+II +K P +  +I EG+   NE A S +  VQKWT LP DFS+ GGELGPT+KLKR VV+++Y   I+  YE
Sbjct:  298 WADFMKLGTDIADDQLDDLINSQNANECCSLIYTSGTTGNPKGVMLSHDNITWIANASGMMIGTKMKEESLVSYLPLSHVAAQVNDLWVSMKFAGTTHFAEPDALKGSLANTLRDVRPTSFLGVPRVWEKMQEAMQSIGAKNSAMKKRIADWAKGIGLQTNYNLMNGDTSVPWGFMLANNLIFKRVRAALGLDRCRTCFTGAAPITKETLEYFMSLNIQLYELYGMSESTGPHTLSWENNFRIMSCGKVIRGCKTKLDKPDEDGN-GEVCFWGRHVFMGYLNMPEKTDEALDTEGWLHSGDLGKLDQNDFMYITGRIKELIITAGGENVPPVPIEDALKEEVSIISNAMLVGDKKKFLAMLLTLKCKVDDNGD-PTDELTPLAVEYCQQRGVTATKVSEIINNKEPAIYKAIQEGVNIINEKATSNAQRVQKWTLLPRDFSISGGELGPTMKLKRPVVSKMYKDDIDKFYE 766          

HSP 2 Score: 137.117 bits (344), Expect = 1.794e-176
Identity = 73/183 (39.89%), Postives = 109/183 (59.56%), Query Frame = 2
Query:  140 ITFEIKQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSI 688
            ITFE++  S    E  +S++ DK  KLRM   G  +   P+T+H MF + ++K  +  AL++K  +  ++ ++ Y QYYQ C  AAKS +++GL     V I G NSPEWFI+    I AGG+ +GIY TN+ E  +++ +NCE  V +V N + L K + V    P+LKAIV Y G ++  I
Sbjct:  116 ITFEVRLAS---AEQYWSSARDKAVKLRMAESGPGSEA-PLTIHQMFQDTVNKYGDHPALRWK--ENGAWTTLTYKQYYQHCRTAAKSFLKLGLERFHGVGILGFNSPEWFISNVACIMAGGLTTGIYTTNSAEACQYVAHNCEANVIVVENNKQLVKILQVKDQLPHLKAIVQYKGELERKI 292          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:103045839])

HSP 1 Score: 498.819 bits (1283), Expect = 1.937e-170
Identity = 245/477 (51.36%), Postives = 326/477 (68.34%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRH---SKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFG-----YSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EF+ LG N  D  L   ++   PN+CC+LIYTSGTTG PKGVM+SHDNL WTA      +   +   S+E +ISYLPLSH+AAQM DI I +      +FAQPDALKGSL +TL+EV PT F+GVPRV+EK+ E+MK +    S+V++ ++SWAKD+G  TNL+KM ++NG        Y +AK ++F KV KALG DRC   F+ AAP++ + L +F SLDL + E+YGMSE +GP TI   N FR  S GK++P    KL S D +  GEIC +GRHVFMGY+N  EKT E  D++ WLHSGD+G  + + +LFITGRIKEL+ITAGGENI PVPIE  +KE +  ISNAM++GDKRK+L +LLTIK  ++  T  P D+LTP A  +   +G N T +S++   ++  +  +I EGI + N+ A S +  +QK+T L  DFS+ GGELGPT+KLKR VV ++Y   I + Y+
Sbjct:  263 WEEFLELGRNEPDTKLNDIIDSQKPNQCCTLIYTSGTTGQPKGVMLSHDNLTWTAFATARNVNLDYADQSQEEVISYLPLSHIAAQMIDIWITMQVGGATYFAQPDALKGSLANTLREVRPTAFMGVPRVWEKMQEKMKSIGAKSSTVRRKVASWAKDVGLHTNLSKMEQQNGSMARASLNYRLAKRLVFRKVRKALGLDRCRLCFTGAAPITKETLEFFLSLDLPVYELYGMSESTGPHTISLPNAFRLTSCGKVIPGCQTKLFSPDAEGNGEICFWGRHVFMGYLNMTEKTAEALDADGWLHSGDLGKHDKDDFLFITGRIKELIITAGGENIPPVPIEDAVKEVVPLISNAMLIGDKRKFLSMLLTIKSEVNAETGAPEDELTPEAVEFCRKLGSNATRVSEVAGGRDHLVQAAIQEGINKVNKKATSNAQRIQKFTVLEQDFSITGGELGPTMKLKRPVVMKMYKEQIENFYK 739          

HSP 2 Score: 122.094 bits (305), Expect = 1.937e-170
Identity = 61/160 (38.12%), Postives = 93/160 (58.13%), Query Frame = 2
Query:  185 MFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYY 664
            +++T  D   KLRM   G  A    +T+H  F  A+ +  N  AL +K  ++  +  I+Y +Y+  C +AAKS +++GL     V I G NSPEWFI+  G IFAGG A GIY TN+ E  +++  NC+  + +V N + L+K + +    P+LKAI+ Y
Sbjct:   93 LWTTQRDGEVKLRMGESGPAAETA-VTVHQAFEKAVKRFGNYTALGWKEGEQ--WKKISYKEYFDTCLIAAKSFLKLGLERCHGVGILGFNSPEWFISDIGAIFAGGFAVGIYTTNSPEACQYVAENCQANILVVENHKQLQKILQIQDKLPHLKAIIQY 249          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsbg1 (acyl-CoA synthetase bubblegum family member 1 [Source:NCBI gene;Acc:103040425])

HSP 1 Score: 438.343 bits (1126), Expect = 9.249e-148
Identity = 215/472 (45.55%), Postives = 305/472 (64.62%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSED-GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W +FM LG +I D+TL G +    PN+CC LIYTSGTTG PKGVM+SHDN+ WTA         + +   +E ++SYLPLSH+AAQ+ D+   +     ++FA+PDALKG+L HTLKE  P+  +GVPRV+EK+ME++K      + +K+ + +WA  +    NL     E  PF + +   ++  K+   LGF  C   FS AAP+  D   +F  L++ + E YGMSE SGP  +     ++  S GK++P   CK+ +ED G  GE+C++GR++FMGY+N  +KT E FD + WL SGD+G  +++G+LFITGR+KEL+ITAGGEN+ PVPIE  +KE L  +S+AM++GDKRK+L +LLT+KCV +  T  PTDDL+P A ++   +G   T +S I   K+  ++ +I EGI R N  A S +  +QKWT L  DFSV GGELGPT+KL+R    ++Y   I + Y 
Sbjct:  228 WEQFMQLGQDIPDETLDGIIKSQKPNQCCVLIYTSGTTGLPKGVMLSHDNITWTACHASRAGDMQPAEIKQETIVSYLPLSHIAAQIYDMWTGIQWGEMVYFARPDALKGTLVHTLKEATPSSHMGVPRVWEKMMEKIKHELSRAAYLKRKLVNWAMSVTLDANLTYGKDEEKPFLFGVVNSLVIEKLRAELGFSNCEKFFSGAAPIGWDTYKFFLGLNIHLYEAYGMSESSGPHFMSGPQTYKMKSCGKVVPGCRCKIANEDAGGSGEVCLWGRNIFMGYLNMKDKTVEAFDEDGWLCSGDLGKLDEDGFLFITGRLKELIITAGGENVPPVPIEDAVKEELPIVSHAMLIGDKRKFLSMLLTVKCVFNLDTMEPTDDLSPEAVKFCQRLGSQATKVSDITGGKDKLVNHAIQEGIARVNARATSNAQRIQKWTILGKDFSVSGGELGPTMKLRRAAALKMYHNEIEAFYR 699          

HSP 2 Score: 107.071 bits (266), Expect = 9.249e-148
Identity = 62/172 (36.05%), Postives = 91/172 (52.91%), Query Frame = 2
Query:  155 KQHSPVETENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            K+ S  +  +++ T      KLR++   +    +PIT+H MF N + K     AL  K   E    +I++ QYY  C M AKS +++GL    SV I G NS EWF +  G +FAGG A+GIY TN+ E    I ++    + +V +   L K + +  N P+LKAIV   G
Sbjct:   50 KKRSDEDARSLWITEASGSVKLRID---EHCPQEPITVHQMFINCVKKYGKLPALATK--TEDKLTTISFCQYYDRCRMTAKSFLKLGLERFHSVAILGSNSEEWFFSAVGAVFAGGFATGIYSTNSPEACHHIASDSRANIIVVDSNWQLDKILLIKDNLPHLKAIVQISG 216          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl1a (long-chain-fatty-acid--CoA ligase 1 [Source:NCBI gene;Acc:103038692])

HSP 1 Score: 166.392 bits (420), Expect = 1.165e-42
Identity = 143/482 (29.67%), Postives = 223/482 (46.27%), Query Frame = 1
Query:  784 ININDDTLIGRLNHLIP-----NECCSLIYTSGTTGNPKGVMMSHDNLVWTA---------ECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIF-SAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            I++ +    G+ NH  P      +   + +TSGTTGNPKG M++H N++             CML      H  ++ ISYLPL+H+  ++ + +I L+  A I + Q D     L   LK + PT F  VPR+  ++ +++      F      +  W  D   R   +++ +       S+   +IF+KV  +LG   C+ +  + AAP+S  VL +  A+L     E YG +EC+   ++    ++  G VG  LP    KL D  D        EGE+C+ G +VF GY+  PEKT E  D + WLH+GD+  +   G L I  R K +   A GE IAP  IE    ++ D ++   V GD  +         C++  V  +P  D  P    W    G    S + +   K  K +I +++ ++   E  +    +V+     P  FSV  G L PTLK KR  +   +   I+ LY
Sbjct:  245 ISLKELEATGKANHKRPMPPKPEDLALICFTSGTTGNPKGAMLTHGNVISNCAGFIRITEIHCML------HHDDIHISYLPLAHMFERVVECVI-LVHGARIGYFQGDIR--MLMDDLKTLKPTVFPVVPRLLNRMFDKI------FGQANTPLKRWLLDFATRRKESEL-RSGVVRKDSMWDKLIFSKVQASLG--GCVRLMITGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSMSMPGDWTAGHVGAPLPCNYVKLVDVTDMNYRAASGEGEVCVKGPNVFQGYLKDPEKTAEAIDKDGWLHTGDIAKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYIQS-DPVAQIFVHGDSLQ--------ACLVGIV--VPDPDFLPG---WAKNRGLE-GSYTDLCKSKELKNAI-LEDLVRLGKEAGLKSFEQVRDIVLQPEMFSVQNGLLTPTLKAKRTELRNYFREHIDQLY 692          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Match: acsl1a (long-chain-fatty-acid--CoA ligase 1 [Source:NCBI gene;Acc:103038692])

HSP 1 Score: 165.236 bits (417), Expect = 2.516e-42
Identity = 137/455 (30.11%), Postives = 216/455 (47.47%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYM--KFR-HSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIF-SAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            P +   + +TSGTTGNPKG M++H N++      +     K R + ++ LIS+LPL+H+  ++ + +I L+  A I + Q D     L   LK + PT F  VPR+  ++ +++      F      +  W  D   R   +++ +       S+   +IF+KV  +LG   C+ +  + AAP+S  VL +  A+L     E YG +EC+   ++    ++  G VG  LP    KL D  D        EGE+C+ G +VF GY+  PEKT E  D + WLH+GD+  +   G L I  R K +   A GE IAP  IE    ++ D ++   V GD  +         C++  V  +P  D  P    W    G    S + +   K  K +I +++ ++   E  +    +V+     P  FSV  G L PTLK KR  +   +   I+ LY
Sbjct:  255 PEDLALICFTSGTTGNPKGAMLTHGNVISNCAGFIRITEGKLRPNRRDTLISFLPLAHMFERVVECVI-LVHGARIGYFQGDIR--MLMDDLKTLKPTVFPVVPRLLNRMFDKI------FGQANTPLKRWLLDFATRRKESEL-RSGVVRKDSMWDKLIFSKVQASLG--GCVRLMITGAAPVSPTVLTFLRAALGCQFYEGYGQTECTAGCSMSMPGDWTAGHVGAPLPCNYVKLVDVTDMNYRAASGEGEVCVKGPNVFQGYLKDPEKTAEAIDKDGWLHTGDIAKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENVYIQS-DPVAQIFVHGDSLQ--------ACLVGIV--VPDPDFLPG---WAKNRGLE-GSYTDLCKSKELKNAI-LEDLVRLGKEAGLKSFEQVRDIVLQPEMFSVQNGLLTPTLKAKRTELRNYFREHIDQLY 681          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:ZFIN;Acc:ZDB-GENE-030131-7099])

HSP 1 Score: 489.574 bits (1259), Expect = 9.398e-165
Identity = 244/477 (51.15%), Postives = 319/477 (66.88%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS----KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE--NGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCK--LDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM  G  + D  L   +     N+CCSLIYTSGTTG+PKGVM+SHDNL WTA       + R +    +E++ISYLPLSH+AAQ+ DI +P+      +FAQPDALKGSL  T+KEV PT F+GVPRV+EK+ME+MK  A      K+ I+ WAK +G +T+LA M       P GY++A  ++F KV +ALG DRC   ++ AAP++ D L +F SLD+ + E+YGMSE SGP TI     F+ GS G +L   GC+  L S+D +  GE+C +GRHVFMGY+N  EKT+E  D + WLHSGD+G  +++G L+ITGRIKEL+ITAGGEN+ P+PIE  IKE L  +SNAMV+GD+RK+L VLLT+KC  +  +  P D LT     W   +G   T  SQI   K+P +  +I +GI+R N+ A S +  VQKW  L  DFS+PGGELGPT+KLKR VV ++Y  LI  LYE
Sbjct:  227 WAEFMRAGEEVPDAQLDAIIASQRANQCCSLIYTSGTTGSPKGVMLSHDNLTWTATVTGELTQLRSADDNYQEVVISYLPLSHIAAQLVDIWLPMRFGGVTYFAQPDALKGSLVVTMKEVRPTGFMGVPRVWEKMMEKMKATAAKSGIFKRKIAGWAKSVGLQTHLANMKGNPAEAPMGYTLANMLVFKKVREALGLDRCTKCYTGAAPITRDTLEFFLSLDIPVFELYGMSESSGPHTISSPTAFQIGSCGTLL--RGCRTLLHSKDEEGSGEVCFWGRHVFMGYLNMEEKTREAIDDDGWLHSGDLGRVDEQGLLYITGRIKELIITAGGENVPPIPIEDAIKEELPVVSNAMVIGDRRKFLSVLLTLKCESNGDSGEPDDALTDEVVHWCQRVGSTATRASQIAGGKDPVVERAIRDGIERVNKRAPSNAQRVQKWELLLRDFSIPGGELGPTMKLKRPVVTKIYQELIERLYE 701          

HSP 2 Score: 109.768 bits (273), Expect = 9.398e-165
Identity = 59/164 (35.98%), Postives = 93/164 (56.71%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            + +++T  D    LR+N  G L+   P T++ +F   +    + +AL  K  + +++  + Y +YY  C  AAKS +++GL     V I G NS EWFI+  G I AGG A GIY TN+ E  +++ +NC   + +V N++ L+K + V    P+LKAIV Y G
Sbjct:   55 DRLWTTERDGAVLLRINASGPLSDT-PETINQLFERTVKLYGDHKALASK--EGNTWKILTYKEYYAQCRQAAKSFLKLGLQRYHGVGILGFNSAEWFISDIGAILAGGFAVGIYTTNSAEACQYVADNCLANIIVVENDKQLQKILEVQSQLPHLKAIVQYKG 215          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 163.31 bits (412), Expect = 3.228e-42
Identity = 140/476 (29.41%), Postives = 231/476 (48.53%), Query Frame = 1
Query:  805 LIGRLNHL-----IPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK---FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQA-TIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM----MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFS--GIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHD-FSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            +IG+ NH       P++   + YTSGTTGNPKG M++H N++      L   K     ++ ++LIS+LPL+H+  ++ +  I  LC    + F Q D     L   +K + PT F  VPR+  +I +++       S  K     W  +      +A++    ++++     SI   +IF++V  ++G  R   + + AAP+S  +L +  A L   + E +G +EC+   T    ++   G VG  +P    K+ D  +        EGE+C+YG +VF GY+  P +T E  D + WLH+GD+G +   G L I  R K +   + GE IAP  IE  +    + ++   V GD  +   V     C++     +P  ++ P+   W    GI  NP S   +  +K+ + +I  D  + R  + A  +S E  +   L  D FS+  G L PT K+KR  V + + + I+SLY
Sbjct:  255 VIGKTNHREPIPPQPDDIAIICYTSGTTGNPKGAMLTHKNMISDFSAFLAITKDTFLPNTDDVLISFLPLAHMFERLVEASI--LCNGGRVGFYQGDIR--LLMDDMKVLQPTVFPVVPRLLNRIHDKV------LSGAKSHFKRWLLEFAVSRKIAELRCGVVRKD-----SIWDKLIFHRVQASMG-GRVRFMVTGAAPISASILTFLRAILGCQVYEGFGQTECTAGCTFTMPSDSTAGHVGPPMPCNHIKVVDVAEMNYFAANGEGEVCVYGTNVFKGYLKDPTRTAEALDEDGWLHTGDIGKWLPNGTLKIVDRKKHIFKLSQGEYIAPEKIE-TVYVRSEPVAQVFVHGDSLQSCLV-----CIV-----VPDMEVLPS---WVQKRGIKCNPNS---VFINKDVRAAILHD--MVRLGKEAGLKSFEQVRAVHLHSDLFSIENGLLTPTFKVKRAEVCKFFHSEIDSLY 695          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: ACSL1 (acyl-CoA synthetase long chain family member 1 [Source:HGNC Symbol;Acc:HGNC:3569])

HSP 1 Score: 143.665 bits (361), Expect = 4.683e-37
Identity = 127/461 (27.55%), Postives = 219/461 (47.51%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK---FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQ-ATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKM----MKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSEDGK------EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHD-FSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            P +   + +TSGTTGNPKG M++H N+V      L   +      + ++ ISYLPL+H+  ++  +   L C  A+I F Q D     L   ++ + PT F  VPR+  ++ +++        S +        + G R  +A++    ++ N     S+   ++F  +  ++G  R   I + AAP+S  VL +    +   + E YG +EC+   T+    +++ G VG  +P    KL D +D +      +GE+C+ G +VF GY+   EKT E  D + WLH+GD+G +   G L I  R K +   A GE IAP  IE  +    + ++   V GD  +         C++  V   P        K+   G      + S++   +N ++  +I E ++R  + +  +  E  K   L ++ FS+  G L PT K KR  +   + ++I+S+Y+
Sbjct:   18 PEDLAIVCFTSGTTGNPKGAMLTHRNIVSDMSGFLKVTESLFLPETSDIAISYLPLAHMFERL--VQATLFCHGASIGFFQGDVR--LLLDDMQALRPTVFPVVPRILNRMYDKV------LGSTRTPFRRKLLEFGARRKMAELQRGVVRRN-----SLWDWLVFRPMQLSVG-GRVRMIMTGAAPISPGVLNFLRVVMGCQMYEGYGQTECTAGCTLTLPGDWKAGHVGAPMPCNYIKLHDVKDMEYYTSQGKGEVCVKGPNVFKGYLKDAEKTAEAVDRDGWLHTGDIGQWMPNGTLKIIDRKKHIFKLAQGEYIAPEKIEN-VYSRCEPVAQVYVHGDSLQ--------ACLVAVVVPDPEILCCWIRKKGIVG------TYSELC--RNKEVRQAILEDMQRLGKESDLQPFEQVKDVHLHNEMFSIENGLLTPTFKAKRTELRTHFRSVISSMYQ 445          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Match: acsl3b (acyl-CoA synthetase long chain family member 3b [Source:ZFIN;Acc:ZDB-GENE-030131-492])

HSP 1 Score: 66.6254 bits (161), Expect = 3.741e-12
Identity = 71/253 (28.06%), Postives = 114/253 (45.06%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHV---AAQMCDIIIPLLCQATIHFAQ------PDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVIC----EIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEG 1551
            P +   ++YTSG+TG PKGV ++H NLV     M   +      +  I YLPL+HV    A+M  + +   C+     AQ          KGS G  +  + PT    VP + E+I + +       S +++ I   A    Y   L ++  E G F   +   ++FNK+   LG +  L + S AAPLS     +   +++  C    + YG++E     TI    ++  G VG   P   C++   + +EG
Sbjct:   59 PRDLAVVMYTSGSTGIPKGVRIAHSNLVAAITGMYLRINDICGDDTYIGYLPLAHVLELGAEM--VCLSRGCRIGYSSAQTLTDQSTRIKKGSQGD-VTILRPTLMAAVPEIMERIYKGVMGKVQCMSLLQRIIFKLA----YNYKLEQL--ERG-FDTPLCNRLVFNKLCALLGGNVRL-LLSGAAPLSPRTQRF---MNVCFCCPVGQGYGLTETCAAGTIAELQDYSTGHVGA--PLSCCEIQLRNWEEG 295          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA2 (Medium chain fatty acyl-CoA synthetase; activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome; comparative analysis suggests that a mitochondrially targeted form may result from translation starting at a non-canonical codon upstream of the annotated start codon [Source:SGD;Acc:S000000817])

HSP 1 Score: 117.857 bits (294), Expect = 1.064e-27
Identity = 98/351 (27.92%), Postives = 159/351 (45.30%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKF----RHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFA-QPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGP----FGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFAS-LDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS--------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCV 1830
            P+   ++ +TSGTTG PKGV MSH N+           +     R+ +   + +LPL+H+  +M  I   L     I F  +PD     L   LK + P     VPR+  +    +K  A+D S+V++++++   D    +  A+     GP      + +   V+ +K+  +LG      I + +AP+S D L++  S LD+ I + YG++E      +    E   GS G I     C+L S        +   +GE+ + G  VF  Y   P +T +  D + W  +GDV   + +G + +  R+K     A GE IAP  IE     +  +I+   V GD  K   V
Sbjct:  291 PDSLYTISFTSGTTGLPKGVEMSHRNIASGIAFAFSTFRIPPDKRNQQLYDMCFLPLAHIFERMV-IAYDLAIGFGIGFLHKPDPT--VLVEDLKILKPYAVALVPRILTRFEAGIKN-ALDKSTVQRNVANTILD----SKSARFTARGGPDKSIMNFLVYHRVLIDKIRDSLGLSNNSFIITGSAPISKDTLLFLRSALDIGIRQGYGLTETFAGVCLSEPFEKDVGSCGAIGISAECRLKSVPEMGYHADKDLKGELQIRGPQVFERYFKNPNETSKAVDQDGWFSTGDVAFIDGKGRISVIDRVKNFFKLAHGEYIAPEKIENIYLSSCPYITQIFVFGDPLKTFLV 633          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA1 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; accounts for most acyl-CoA synthetase activity; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms ER foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000005844])

HSP 1 Score: 113.235 bits (282), Expect = 2.716e-26
Identity = 93/340 (27.35%), Postives = 159/340 (46.76%), Query Frame = 1
Query:  835 NECCSLIYTSGTTGNPKGVMMSHDNLVW-TAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHT----LKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRK 1818
            ++ C ++YTSG+TG PKGV++ H N+V       L  +KF  + + +I +LPL+H+   + +++      A I +A    L  S        L+E  PT  +GV  V+E + + +     +   + K I  W     Y T L  M + + P G ++   ++F K+  A G  +   + +  +P+S D   +  +L   +   YG++E     TI     F  G  G +      KL D E+        +GE+ + G +V   Y    E+T +   S+ W  +GD+G +   G+L I  R K L+ T  GE IA   +E   + N ++++N  V  D+ K
Sbjct:  262 DDLCCIMYTSGSTGEPKGVVLKHSNVVAGVGGASLNVLKFVGNTDRVICFLPLAHIFELVFELL-SFYWGACIGYATVKTLTSSSVRNCQGDLQEFKPTIMVGVAAVWETVRKGILNQIDNLPFLTKKIF-WT---AYNTKL-NMQRLHIPGGGALGN-LVFKKIRTATG-GQLRYLLNGGSPISRDAQEFITNLICPMLIGYGLTETCASTTILDPANFELGVAGDLTGCVTVKLVDVEELGYFAKNNQGEVWITGANVTPEYYKNEEETSQALTSDGWFKTGDIGEWEANGHLKIIDRKKNLVKTMNGEYIALEKLESVYRSN-EYVANICVYADQSK 592          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA4 (Long chain fatty acyl-CoA synthetase; activates fatty acids with a preference for C12:0-C16:0 chain lengths; role in the competitive import of long-chain fatty acids and sphingoid long-chain bases; role in stationary phase survival; localizes to lipid particles and the plasma membrane; role in sphingolipid-to-glycerolipid metabolism; forms cytoplasmic foci upon replication stress; faa1 faa4 double null complemented by any of human ACSBG1, ACSL1, 3, 4, 5, 6, SLC27A2, or 4 [Source:SGD;Acc:S000004860])

HSP 1 Score: 88.9669 bits (219), Expect = 1.138e-20
Identity = 89/393 (22.65%), Postives = 171/393 (43.51%), Query Frame = 1
Query:  766 EFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLY-YMKFRHSKEMLISYLPLSHVAAQMCDIII----PLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTI-------KCVIDPVTQIPTDDL 1887
            E + +G    D+     L+   P +   ++YTSG+TG PKGV+++H N+V     + +  + +    + +I++LPL+H+     +        +L  A +    P + +   G  L E  PT  +GV  V+E + + +       + + + +  W++ + +       +KE       +   +IF ++ +A G +    I +  + +S D   + ++L   +   YG++E      +     F +G  G ++     KL D ED        +GE+   G  +   Y   PE+T   F  + W  +GD+  +  +G + I  R K L+ T  GE IA   +E   + N  ++ N  V  D+ K   V + +       K  I+    +P +D+
Sbjct:  242 EIIEIGKKAKDEV---ELHFPKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIGWIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGD-LMEFKPTVMVGVAAVWETVRKGI------LAKINE-LPGWSQTLFWTV---YALKERNIPCSGLLSGLIFKRIREATGGNLRF-ILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGTITAKLVDVEDLGYFAKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTPKGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSN-PYVQNICVYADENKVKPVGIVVPNLGHLSKLAIELGIMVPGEDV 618          

HSP 2 Score: 28.8758 bits (63), Expect = 1.138e-20
Identity = 26/117 (22.22%), Postives = 51/117 (43.59%), Query Frame = 2
Query:  323 YKYSQESSFLSINYSQYYQLCCM--AAKSLIQIGL--NARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVY 661
            + Y + + ++++ Y +   +C M    + LI+IG+  N      I    S +W  T+ G +  G      Y T  +  +   +   +  VAI  + +LL K     K   N+K +++
Sbjct:   89 WLYYELTPYITMTYEE--MICVMHDIGRGLIKIGVKPNGENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDS-VAIFTDNQLLSKLAVPLKTAKNVKFVIH 202          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: FAA3 (Long chain fatty acyl-CoA synthetase; activates imported fatty acids with a preference for C16:0-C18:0 chain lengths; green fluorescent protein (GFP)-fusion protein localizes to the cell periphery [Source:SGD;Acc:S000001271])

HSP 1 Score: 88.1965 bits (217), Expect = 1.975e-18
Identity = 91/347 (26.22%), Postives = 151/347 (43.52%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLV-WTAECMLYYMKFRHSKEMLISYLPLSHV-------AAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEI---YGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRK 1818
            P +   ++YTSG+   PKGV+++H N+V   A        +  S + ++S+LPL+H+        A   + I+      T+        KG L     E  PT  IGV  V+E + + + E   D + V + I  W+         A  MKE           ++F KV +A G      I +  + +S D   +F+   +V+C +   YG++E      +   + F +G VG ++     KL D +D        +GE+ + G  V   Y   P +T   F  + W  +GD+  +  +G L I  R K L+ T  GE IA   +E   + N  ++ N  V  D+ +
Sbjct:  261 PKDLACIMYTSGSISAPKGVVLTHYNIVSGIAGVGHNVFGWIGSTDRVLSFLPLAHIFELVFEFEAFYWNGILGYGSVKTLTNTSTRNCKGDL----VEFKPTIMIGVAAVWETVRKAILEKISDLTPVLQKIF-WS---------AYSMKEKSVPCTGFLSRMVFKKVRQATG-GHLKYIMNGGSAISIDAQKFFS---IVLCPMIIGYGLTETVANACVLEPDHFEYGIVGDLVGSVTAKLVDVKDLGYYAKNNQGELLLKGAPVCSEYYKNPIETAVSFTYDGWFRTGDIVEWTPKGQLKIIDRRKNLVKTLNGEYIALEKLESVYRSN-SYVKNICVYADESR 588          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 71.633 bits (174), Expect = 1.780e-13
Identity = 46/122 (37.70%), Postives = 66/122 (54.10%), Query Frame = 1
Query: 1414 ICEIYGMSECSGPQTIEF--QNEFRFGSVGKILPDFGCKLDSED-----GKEGEICMYGRHVFMGYVNAPEKTKEVF-DSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIE 1755
            + E Y M+E S   T       + + G+VG+        LD  D     GK GE+ + G +V +GY N P+  KE F   E +  +GD G F+ EG+L +TGRIKE LI  GGE I+P+ ++
Sbjct:  330 VLEAYAMTEASHQMTSNNLPPGKRKPGTVGQPQGVTVVILDDNDNVLPPGKVGEVSIRGENVTLGYANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKE-LINRGGEKISPIELD 450          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO32054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW65])

HSP 1 Score: 432.565 bits (1111), Expect = 4.194e-143
Identity = 218/447 (48.77%), Postives = 296/447 (66.22%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS--EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELG 2094
            W +F+ LG  + D  L  R++ L+ N CC+LIYTSGTTG PKGVM+SHDN+ WTA+  L +++    +E ++SYLPLSHVAAQM DI + + C  T+ FAQPDALKGSL +TL+E  PT F+GVPRV+EKIME+M E+    +  K+ I+ WAK    + N+      + PFG++IA   I  K+  +LG DRC G F AAAP++ + L YF S+++ + E+YGMSECSGP TI        GS G  +     K+D   EDG  GE+CM GR+VFMG++N  EKTKE  D + WLHSGDV   +D       G   +L+ITAGGENIAPVPIE  IK+ +  ISNA+++GDKRK+L  LLT+K  ++  T  PTD LT AA  +   +G   T++S+I+  K+  +  +I  G+ R+NE AISR+ +VQKW  L +DF++ GGELG
Sbjct:  113 WNQFLELGKTVADRVLQERMSQLVANRCCTLIYTSGTTGAPKGVMISHDNITWTAQAALNHVQAGKREEHIVSYLPLSHVAAQMTDIYMSMYCCGTVWFAQPDALKGSLVNTLRECRPTLFLGVPRVWEKIMEKMLEVGATVTGPKRRIADWAKGKALQGNMNIEQGRSTPFGWTIATG-ILKKIKVSLGLDRCWGQFVAAAPVTMETLRYFQSINIPLYELYGMSECSGPLTISIPGHVLSGSCGIKMEGTEMKIDKPDEDGN-GELCMRGRNVFMGFLNNEEKTKEALDVDGWLHSGDVCKIDDVSIRIAEG---QLIITAGGENIAPVPIEDNIKKEVPLISNAILIGDKRKFLSCLLTLKVEVEADTGAPTDRLTKAAIAFCKSVGSEATTVSEILKTKDENVMKAIQAGVDRANEEAISRAQKVQKWCILENDFTIHGGELG 554          

HSP 2 Score: 55.8398 bits (133), Expect = 5.179e-8
Identity = 37/108 (34.26%), Postives = 51/108 (47.22%), Query Frame = 2
Query:  362 YSQYYQLCCMAAKSLIQ--IGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLID 679
            YS+YY+   +AAKS I+   G N R                    I   G A GIY TN+ E   F+ +NC   V +V N+  L K + V    P+LKA+V Y G ++
Sbjct:   14 YSEYYEEVRIAAKSFIEREWGRNGR-----------------LHCILIRGFAVGIYTTNSPEACHFVADNCNANVIVVENKAQLSKILKVWDRLPHLKAVVQYTGEVE 104          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45461 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR3])

HSP 1 Score: 153.68 bits (387), Expect = 9.575e-43
Identity = 136/469 (29.00%), Postives = 210/469 (44.78%), Query Frame = 1
Query:  808 IGRLNHLI-----PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPR----VFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF--ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILP-------DFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            IGR N  +     PN+  ++ YTSGTTG PKG + +H N++     ++         ++  SYLPL+H A +   +I  L     I F + D     L   ++E+ PT+F  VPR    V++K+M Q+ E             SW    G     A M K N     +I   V+F KV    G  R   I S AAPLS  V+ +F  A  D  I E YG +EC+   +++   + + G VG  L        D   K  S    +GE+C+ G +V   Y   PEKT E  D + WLH+GD+G + + G L I  R K++   A GE +AP  +E  I +   F++ A V G+  K   V +           +P  ++    K+W +    N     + + +K        ++ ++   E  +    +V+     P  FSV    +  T K+KR  + + +  +I SLY
Sbjct:  224 IGRKNIKVVNPPKPNDIFTICYTSGTTGTPKGAVQTHSNVIADVSGVIRQYN-TCGIDVHFSYLPLAH-AYERTGVICMLQSGCRIGFYRGDP--QLLFEDIQELKPTFFASVPRIMNKVYDKVMAQVSE---------SKFKSWMFQKGLHAKKADMNK-NVFRSNTIWDKVVFKKVQMLFG-GRVRAITSGAAPLSPKVMTFFRCAMGDCRIMEGYGQTECTACASLQLPQDMQAGIVGPPLTCNYIKLVDVPEKSYSTKDLKGEVCIKGPNVIPRYHKNPEKTAETLDEDGWLHTGDIGMWLENGALKIIDRKKDIFKLAQGEYVAPGKLEN-IAQRSPFVAQAFVHGESLKTFVVAIL----------VPDGEVL---KKWAA--QKNIQGDLKTLCEKEEVRQAVFEDVVRVCKEAELFSFEQVKAVHLHPEAFSVENDLMTATFKIKRPQIIKAFHDVIESLY 661          

HSP 2 Score: 39.6614 bits (91), Expect = 9.575e-43
Identity = 32/129 (24.81%), Postives = 58/129 (44.96%), Query Frame = 2
Query:  356 INYSQYYQLCCMAAKSLIQIGLNA--RKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDVYVFLI 736
            ++Y++  +       +L+ +G +   R  V I   N  EW +T         V+  IY T+  +   FIIN+ + +  IV N   +   +   K  P+LK I+  G L+ +  +   K+S  ++  F I
Sbjct:   93 LSYNEVRERAHSFGSALVHLGCHPSQRTFVGIQAKNCVEWVLTDLACQMFSMVSVPIYDTHGPDACLFIINHAD-VETIVCNHTKVPFILKNIKRIPHLKCIIQIGELVKEEERKDAKVSGIELLSFSI 220          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO46361 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQG4])

HSP 1 Score: 156.762 bits (395), Expect = 1.589e-40
Identity = 137/476 (28.78%), Postives = 225/476 (47.27%), Query Frame = 1
Query:  784 ININDDTLIGRLNHLIP--NECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK-----FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFAS-LDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAG-GENIAPVPIEQKIKENLDFISNAMVVGDK-RKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            I+ +D +   RL    P  ++  ++ YTSGTTG PKG M++HDN++      LY +K     +    ++ +S+LPLSH+  ++  I+I  +    I F   D  K  L    K + PT F  VPR+  +I +++    I+ S +K+ I   A +   R    K+++ +  + Y     +IFNK+   LG  R   I S +APLS  V  +    +   + E YG +E     T++  ++F  G VG   P    KL          + K+GEIC+ GR+VF GY++ P  T EV D + WL++GD+G +   G   +  R +   I    GE IAP  IE  I     F++   V GD  R +L  ++           +P  ++  A   W    G     + ++  +K     I  +  +K   E+ ++   +V+        FS+  G L PTLK+KR  ++  +  +I++LY
Sbjct:   92 ISSSDRSAAARLRIKPPKSDDLYTVCYTSGTTGTPKGAMLTHDNVISDLSAFLYVLKQVIIRYFGVDDVHLSFLPLSHMYERVNQIVI-FMNGGKIGFFNGDIKK--LLDDFKTLRPTVFGAVPRLLNRIHDKVTN-EINKSWIKRWIFQIALNAKKRDLARKIVRRDTIWDY-----LIFNKIQALLG-GRVWFIISGSAPLSPKVATFIRCVMGCQVQEGYGQTETVASVTLQLLDDFTAGHVGPPTPVNVVKLVDVPEMDYWANNKQGEICVKGRNVFKGYLHNPAMTAEVLDKDRWLYTGDIGEWTTVGTRRLYTRERGACIQGNEGEYIAPQKIEN-IYLRSPFVAQIYVHGDSIRSFLVAVV-----------VPDAEVLEA---WAEKKGIR-GDLKRLCQNKTVHQRI-FESMVKVGEESQLNSLEKVRGIHLCSEAFSIDNGLLTPTLKIKRPQMSTFFRDIIDNLY 540          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO46335 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQC0])

HSP 1 Score: 157.918 bits (398), Expect = 2.005e-40
Identity = 137/463 (29.59%), Postives = 209/463 (45.14%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK----FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQ-MKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLD--------SEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITD-----KNPKLSISIDEGIKRSNENAISRSAEVQKWTFL-PHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            P++   + YTSGTTGNPKG M++H N V     +   +K       + ++ ISYLPL+H+  ++  ++I  +    + F   +  K  +   L+E+ PT FI VPRV  ++ ++ MKE  I  SS+KK + + A           ++++N  + Y     ++FNK+                                 + E YG +E +   TI+   +  FG VG  +P    KL         ++DGK GEIC YG +VF GY++ PEKT+E  D + WLHSGDVG + + G L +  R K +   A GE IAP  IE  +      +    V GD RK         C++  V    T     A K+W        T  +++  D      N K+  +I E +    +     S +  K  +L P  F+V  G L PTLK KR V+   +      LY+
Sbjct:  254 PDDLAVVCYTSGTTGNPKGAMITHSNAVAMLAGLCVMIKKCGIRVDNDDVHISYLPLAHMYERLAQLMI-FMYGGKVGFFGGNIRK--IMEDLQELKPTVFISVPRVLNRVYDKVMKE--ISSSSIKKFVFNTALSFKKAEVERNIVRKNSIWDY-----LVFNKIQ--------------------------------VLEGYGQTETTAAATIQLVGDHTFGHVGPPMPCTKIKLVDVPDMNYFAKDGK-GEICFYGPNVFKGYLHDPEKTREAIDEDGWLHSGDVGEWTENGTLKLIDRKKHIFKLAQGEYIAPEKIEA-VYMQCPLVHQVFVYGDSRK--------SCIVGVVVPEET-----ALKKW--------TEKNEVQGDMEALCNNEKVRKAILEEMSAMGKKEKLFSFQQVKDIYLHPDPFTVDNGLLTPTLKFKRPVIQAHFKDTFEKLYD 651          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Match: EDO45504 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR2])

HSP 1 Score: 147.517 bits (371), Expect = 4.261e-37
Identity = 131/491 (26.68%), Postives = 232/491 (47.25%), Query Frame = 1
Query:  733 DLIYMIIV*WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEML-----ISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFAS-LDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDS-------EDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRW-FSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            D++ + I+ + E   +GIN   + +  R     P +  ++ +TSGTTG PKGV+++HDN++      L+ +K +  +E+      +SYLP  H+  + C  ++ ++  A I        +  L    K + PT F  VPR+   I +++  +        +  S +A +  +  +  ++++++     +I   ++F K+   +G +  + I   +APLS  V  +    +   + E YG +E +   T++   +F  G VG  +P    KL             +GEIC+ GR+VF GY++  E+T+E FDS  W +SGD+G +  +G L I  R K +   + GE IAP  I+     ++ F++   V G+  K   V      V+ P  ++    L P AK     G       I Q+  ++  + +I  D  I +  E  ++   +V+     P  F+V  G L PTLK KR  + + +   +N LYE
Sbjct:  167 DILGIRIISFDEVEKIGINNPHEKVPAR-----PEDTFTISWTSGTTGFPKGVILTHDNIISDMSAYLFLIK-QDGEELTPQDTHLSYLPPEHMY-ERCTQVLMMMAGAKIGLYH--GKREFLMDDFKALRPTVFAAVPRLLNAIYDKVVPL--------RRYSLFAGNTFF-FHARRIIRKD-----TIWDRLVFKKIQDLIGGNVRI-ITCGSAPLSARVTSFIRCVMGCYLNEGYGSTETTAMVTMQRLKDFNTGHVGAPVPCATVKLVDVPEMDYYASNNQGEICIRGRNVFKGYLHDAERTEEAFDSSGWFYSGDIGEWTQDGTLRIIDRKKHIFKLSQGEYIAPAKIQNAYLRSM-FVAQVFVHGNSLKSFIV-----AVVVPDAEV----LIPWAKTHDIEG------DIKQLCQNQTVRKAIHGDM-IAKGKEAKLNSLEQVKGIYLHPELFTVEEGLLTPTLKTKRPALAQFFEEKLNVLYE 616          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 498.434 bits (1282), Expect = 2.906e-172
Identity = 240/476 (50.42%), Postives = 331/476 (69.54%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE----NGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   +    PN+CCSLIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM D+ + +    + HFAQPDALKGSL +TLKEV PT F+GVPRV+EK+ E+MK +    S++++ ++SWAKD+G +TNL +M +       PF Y +AK ++F KV KALG DRC   ++ AAP + D L +F SLD+ + E+YGMSEC+GP TI   + FR  S GK +P    KLD+ D +  GEIC +GRH+FMGY+NAP+KT+E  D+E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +K+ +  +SNAM++GDKRK+L +L+TIKC I+P T  P D+LTP A      +G +  ++S+I   ++  +  +I EGI + N+ A S +  +QK+  L  DFS+ GGELGPT+KLKR VV ++Y   I++ Y+
Sbjct:  281 WAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQYHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFYK 756          

HSP 2 Score: 128.257 bits (321), Expect = 2.906e-172
Identity = 64/164 (39.02%), Postives = 97/164 (59.15%), Query Frame = 2
Query:  185 MFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLI 676
            ++++  D   KLRM   G +A   P+T+H MF +A+++  +  AL +K   ++   S+NY  YY+ C  AAKS +++GL     VCI G NS EWFI   G I AGG   G+Y TN+ E  +F+  NC+  V ++ NE+ L+K + +    P+LKAIV Y G +
Sbjct:  111 LWTSQGDAEVKLRMGESG-VAAEPPLTVHQMFTSAVERYGDNTALAWKEGDQAK--SLNYKDYYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKGAL 271          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsbg2 (acyl-CoA synthetase bubblegum family member 2 [Source:NCBI gene;Acc:101171154])

HSP 1 Score: 498.049 bits (1281), Expect = 3.888e-172
Identity = 240/476 (50.42%), Postives = 331/476 (69.54%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHS---KEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE----NGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            W EFM LG +  D  L   +    PN+CCSLIYTSGTTG PKGVM+SHDNL WTA     ++    +   +E+++SYLPLSH+AAQM D+ + +    + HFAQPDALKGSL +TLKEV PT F+GVPRV+EK+ E+MK +    S++++ ++SWAKD+G +TNL +M +       PF Y +AK ++F KV KALG DRC   ++ AAP + D L +F SLD+ + E+YGMSEC+GP TI   + FR  S GK +P    KLD+ D +  GEIC +GRH+FMGY+NAP+KT+E  D+E WLHSGD+G  ++ G+L+ITGRIKEL+ITAGGENI PVPIE  +K+ +  +SNAM++GDKRK+L +L+TIKC I+P T  P D+LTP A      +G +  ++S+I   ++  +  +I EGI + N+ A S +  +QK+  L  DFS+ GGELGPT+KLKR VV ++Y   I++ Y+
Sbjct:  272 WAEFMELGRDEPDGPLDAIIASQKPNQCCSLIYTSGTTGQPKGVMLSHDNLTWTALSTAKHVCLTDATVAQEVVVSYLPLSHIAAQMVDMWLIMRVGGSTHFAQPDALKGSLVNTLKEVRPTAFMGVPRVWEKMQEKMKSIGAKSSTLRRKVASWAKDVGLQTNLTRMRQNTATGQAPFQYHLAKKLVFKKVRKALGLDRCTKCYTGAAPTTKDTLEFFLSLDIPLFELYGMSECTGPHTISRPDAFRLTSCGKEIPGCTTKLDNPDEEGNGEICFWGRHIFMGYLNAPDKTEEALDAEGWLHSGDLGKRDEHGFLYITGRIKELIITAGGENIPPVPIEDAVKDAVPLLSNAMLIGDKRKFLSMLVTIKCQINPETGNPEDELTPEAVEICKKLGTSAKTVSEIAGGRDRTVHAAIQEGINQVNKKATSNAQCIQKFVILNRDFSINGGELGPTMKLKRPVVLKMYKDQIDNFYK 747          

HSP 2 Score: 128.257 bits (321), Expect = 3.888e-172
Identity = 64/164 (39.02%), Postives = 97/164 (59.15%), Query Frame = 2
Query:  185 MFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLI 676
            ++++  D   KLRM   G +A   P+T+H MF +A+++  +  AL +K   ++   S+NY  YY+ C  AAKS +++GL     VCI G NS EWFI   G I AGG   G+Y TN+ E  +F+  NC+  V ++ NE+ L+K + +    P+LKAIV Y G +
Sbjct:  102 LWTSQGDAEVKLRMGESG-VAAEPPLTVHQMFTSAVERYGDNTALAWKEGDQAK--SLNYKDYYKACRTAAKSYLKLGLQRYHGVCILGFNSAEWFIADIGAILAGGFGVGVYTTNSPEACQFVAENCKANVIVLENEKQLQKILQIEDQLPHLKAIVQYKGAL 262          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000027775.1 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 473.781 bits (1218), Expect = 1.825e-166
Identity = 235/473 (49.68%), Postives = 321/473 (67.86%), Query Frame = 1
Query:  748 IIV*WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEN-GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            I+  W EFM +G +++D+ L   ++    NECC+LIYTSGTTGNPKGVM+S DN+ WTA      +   + +E+LISYLPLSHVAAQM DI I +    T +FA+PDALKGSL +TLKE  PT F+GVPRV+EK+ E M+      S +KK ++ WAK IG + N + M  EN  P+G+ +A  ++F KV  ALG DRC   F+ AAP++ D L YF SL++ + E+YGMSE SGP T+   +E+R GS GK++P    KL++ D +  GE+C +GR+VFMGY+N P+KT+E  D + WLHSGD+G F+ E +L+ITGRIKEL+ITAGGENI PVPIE  +K  L  ISN M++GDK K+L +L+T+KCV+D   + P ++L+     +        T +S+I  +K P +  +I EGI R N  + S + ++QKW  L  DFSV GGELGPTLKL+R +V ++Y   IN LY
Sbjct:  248 ILYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTVSI-DEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLSMLITLKCVMDDNGE-PLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELY 718          

HSP 2 Score: 133.65 bits (335), Expect = 1.825e-166
Identity = 65/164 (39.63%), Postives = 99/164 (60.37%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            + ++S S DK   LRM   G  +   P+T+H MF   +++  +  AL +K   +++  S+ + QYY+ C  AAKS +++GL     V I G NSPEWFI+  G IFAGG+A+GIY TN+ E  +++  NCE  + +V N++ L K + V    P+LKAI+ Y G
Sbjct:   80 DKLWSASRDKAVNLRMEASGPGSET-PVTIHQMFLETVERSGDQTALVFKEDGQTA--SLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKG 240          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: ENSORLT00000001544.2 (long-chain-fatty-acid--CoA ligase ACSBG2 [Source:NCBI gene;Acc:101158282])

HSP 1 Score: 473.781 bits (1218), Expect = 1.825e-166
Identity = 235/473 (49.68%), Postives = 321/473 (67.86%), Query Frame = 1
Query:  748 IIV*WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEN-GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGK-EGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            I+  W EFM +G +++D+ L   ++    NECC+LIYTSGTTGNPKGVM+S DN+ WTA      +   + +E+LISYLPLSHVAAQM DI I +    T +FA+PDALKGSL +TLKE  PT F+GVPRV+EK+ E M+      S +KK ++ WAK IG + N + M  EN  P+G+ +A  ++F KV  ALG DRC   F+ AAP++ D L YF SL++ + E+YGMSE SGP T+   +E+R GS GK++P    KL++ D +  GE+C +GR+VFMGY+N P+KT+E  D + WLHSGD+G F+ E +L+ITGRIKEL+ITAGGENI PVPIE  +K  L  ISN M++GDK K+L +L+T+KCV+D   + P ++L+     +        T +S+I  +K P +  +I EGI R N  + S + ++QKW  L  DFSV GGELGPTLKL+R +V ++Y   IN LY
Sbjct:  248 ILYSWEEFMKVGEDVSDEQLNAVIDSQRANECCTLIYTSGTTGNPKGVMLSQDNITWTARISSGLICKNYGQEILISYLPLSHVAAQMVDIWISMSFSGTTYFAEPDALKGSLVNTLKEARPTCFLGVPRVWEKMQEGMRAGGEKASPLKKRVADWAKSIGLQYNYSAMEGENLVPWGFMLANNLVFKKVRAALGLDRCRYCFTGAAPITKDTLEYFLSLNIPVKELYGMSESSGPHTVSI-DEYRIGSCGKVIPGSKIKLNNPDEEGNGEVCFWGRNVFMGYLNMPDKTEEALDEDGWLHSGDLGKFDQENFLYITGRIKELIITAGGENIPPVPIEDAVKSELPIISNTMLIGDKLKFLSMLITLKCVMDDNGE-PLNELSSEVLDFCRRHSVTATKVSEITANKEPAIYKAIQEGIDRVNARSTSNAQKIQKWVVLERDFSVVGGELGPTLKLRRPIVVKMYQEKINELY 718          

HSP 2 Score: 133.65 bits (335), Expect = 1.825e-166
Identity = 65/164 (39.63%), Postives = 99/164 (60.37%), Query Frame = 2
Query:  179 ENMFSTSLDKVSKLRMNCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGG 670
            + ++S S DK   LRM   G  +   P+T+H MF   +++  +  AL +K   +++  S+ + QYY+ C  AAKS +++GL     V I G NSPEWFI+  G IFAGG+A+GIY TN+ E  +++  NCE  + +V N++ L K + V    P+LKAI+ Y G
Sbjct:   80 DKLWSASRDKAVNLRMEASGPGSET-PVTIHQMFLETVERSGDQTALVFKEDGQTA--SLTWRQYYEQCRAAAKSFLKLGLERFHGVGILGFNSPEWFISDIGCIFAGGLAAGIYTTNSPEACQYVAANCEANILVVENQKQLDKILQVKDQLPHLKAIIQYKG 240          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Match: acsl5 (acyl-CoA synthetase long chain family member 5 [Source:NCBI gene;Acc:101166257])

HSP 1 Score: 168.318 bits (425), Expect = 2.837e-43
Identity = 138/454 (30.40%), Postives = 222/454 (48.90%), Query Frame = 1
Query:  832 PNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMK---FRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYF-ASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKL-DSED------GKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            P +   + +TSGTTG+PKG M++H+N+V     ++   +      ++++ IS+LPL+H+  ++    +     A + F Q D     L   +K + PT F  VPR+  +I ++++  A   S  +K + ++A D  Y      ++++N     SI   +IFNKV ++LG  R   + + AAP+S  VL +  A+L   I E YG +EC+   T     +   G VG  LP    KL D E+        EGE+C+ G++VF GY+  PE+T E  D + WLH+GD+G +   G L I  R K +   A GE IAP  IE  +    + ++   V GD  +         C++  V  +P  D+ P   +     G    SI ++  +   K +I I +  K   E  +    +V+     P  F++  G L PTLK KR  +  L+   I+ LY
Sbjct:  253 PEDLSVICFTSGTTGDPKGAMITHENIVADLAGVIKIFESSFVPSTQDVSISFLPLAHMFERIVQTAV-YGAGARVGFYQGDIR--LLPDDMKTLQPTIFPVVPRLLNRIYDKVQSGAK--SPFQKWLLNFAVDRKYAEVQEGIIRKN-----SIWDKLIFNKVQESLG-GRVRLMVTGAAPISPAVLKFLRAALGCQIFEGYGQTECAAACTFTMPGDATTGHVGMPLPCNYMKLADVEEMSYFASNGEGEVCIKGKNVFKGYLKDPERTAEALDKDGWLHTGDIGKWLPSGVLKIIDRKKNIFKLAQGEYIAPEKIEN-VYVRSEAVAQVFVHGDSLQ--------SCLVAIV--VPDADVLPGFAKKLGHQG----SIEELCKNSEIKKAI-ITDMTKLGREAGLKSFEQVKDVYLHPEMFTIENGLLTPTLKAKRAELKALFLPQIDQLY 679          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000080395.1 (SMESG000080395.1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 466/468 (99.57%), Postives = 467/468 (99.79%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE+GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSI IDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE
Sbjct:  114 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEDGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSICIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 581          

HSP 2 Score: 214.542 bits (545), Expect = 3.296e-60
Identity = 104/110 (94.55%), Postives = 105/110 (95.45%), Query Frame = 2
Query:  404 LIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDVYVFL 733
            L  IGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYD   F+
Sbjct:    9 LYNIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDWTEFM 118          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000080395.1 (SMESG000080395.1)

HSP 1 Score: 968.378 bits (2502), Expect = 0.000e+0
Identity = 466/468 (99.57%), Postives = 467/468 (99.79%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE+GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSI IDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE
Sbjct:  109 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEDGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSICIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 576          

HSP 2 Score: 214.927 bits (546), Expect = 2.521e-60
Identity = 103/108 (95.37%), Postives = 105/108 (97.22%), Query Frame = 2
Query:  410 QIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDVYVFL 733
            +IGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYD   F+
Sbjct:    6 EIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDWTEFM 113          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000080395.1 (SMESG000080395.1)

HSP 1 Score: 959.518 bits (2479), Expect = 0.000e+0
Identity = 462/464 (99.57%), Postives = 463/464 (99.78%), Query Frame = 1
Query:  772 MNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 2163
            MNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKE+GPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSI IDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE
Sbjct:    1 MNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKEDGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSICIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLYE 464          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 506.523 bits (1303), Expect = 3.967e-171
Identity = 247/468 (52.78%), Postives = 334/468 (71.37%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            WTEFMNL    + D L  RL+ + P++C  LIYTSGTTG PKGVM+SHDN+++T +  + ++K +  K  +ISYLPLSH+AA + DI+  +    T++FAQPDALKGSLG TLKEV PT FIGVPRVFEKI EQM+E+     ++KK I+ WAK++G+R +LAK+  +     Y +AK ++F+K+ +ALG DRC+ + SAAAPL+   L YF SLD+ I +IYG+SEC+GP T+   ++ R GS G IL     K+D  +    GEIC+ GRHVF+GY N  EKTKE  DS+ WLHSGD+G   D  +L+ITGRIKEL+ITAGGENIAPVPIE KIKE + FIS+ M+VGD++K++  LLT+K  +D  TQ PT+ LTPAA R    IG    ++ +++  K+  L   IDE IK+ N  ++SR+A VQKW+ LP DFS+ GGELGPT+K+KR  + E+YS +++S+Y
Sbjct:  120 WTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 587          

HSP 2 Score: 101.679 bits (252), Expect = 4.061e-22
Identity = 48/122 (39.34%), Postives = 73/122 (59.84%), Query Frame = 2
Query:  368 QYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDVYVFL 733
            QY +L   AA + I++GL+ + +V I G N P WFI+  G IFAGG+  GIY TN  +  +FI+N+C C + +V N++ L K + +  + P LKAI+ Y G +   +K    IS+Y    F+
Sbjct:    3 QYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFM 124          
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Match: SMESG000027204.1 (SMESG000027204.1)

HSP 1 Score: 506.138 bits (1302), Expect = 9.212e-170
Identity = 247/468 (52.78%), Postives = 334/468 (71.37%), Query Frame = 1
Query:  760 WTEFMNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWTAECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDALKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAKDIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPLSHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGCKLDSEDGKE-GEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFNDEGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKYLCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPKLSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNVVNELYSALINSLY 2160
            WTEFMNL    + D L  RL+ + P++C  LIYTSGTTG PKGVM+SHDN+++T +  + ++K +  K  +ISYLPLSH+AA + DI+  +    T++FAQPDALKGSLG TLKEV PT FIGVPRVFEKI EQM+E+     ++KK I+ WAK++G+R +LAK+  +     Y +AK ++F+K+ +ALG DRC+ + SAAAPL+   L YF SLD+ I +IYG+SEC+GP T+   ++ R GS G IL     K+D  +    GEIC+ GRHVF+GY N  EKTKE  DS+ WLHSGD+G   D  +L+ITGRIKEL+ITAGGENIAPVPIE KIKE + FIS+ M+VGD++K++  LLT+K  +D  TQ PT+ LTPAA R    IG    ++ +++  K+  L   IDE IK+ N  ++SR+A VQKW+ LP DFS+ GGELGPT+K+KR  + E+YS +++S+Y
Sbjct:  211 WTEFMNLNQADSADELDRRLSEIQPDDCALLIYTSGTTGFPKGVMLSHDNMIFTVKKAMEHVKIQPFKNSVISYLPLSHIAANLNDIMTTVSVGVTVYFAQPDALKGSLGKTLKEVRPTVFIGVPRVFEKIQEQMQEIGSKAGTIKKYIAGWAKNVGHRNSLAKITGKPVEKSYFLAKYLVFDKIKEALGLDRCIYLASAAAPLTQQSLDYFLSLDMPINQIYGLSECTGPHTMGITDKIRIGSAGTILKGVEMKIDEPNEHNIGEICIRGRHVFLGYYNNMEKTKESIDSDGWLHSGDLGKVEDNEHLYITGRIKELIITAGGENIAPVPIEDKIKERIPFISSVMLVGDRQKFVSCLLTLKSTVDVDTQRPTNQLTPAAIRSLKDIGIEAKTVEEVLECKDIALKKFIDEAIKKVNSCSVSRAAYVQKWSLLPRDFSISGGELGPTMKMKRMAIVEMYSEIVSSMY 678          

HSP 2 Score: 106.686 bits (265), Expect = 1.553e-23
Identity = 52/140 (37.14%), Postives = 82/140 (58.57%), Query Frame = 2
Query:  317 LKYKYSQESSF-LSINYSQYYQLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYVTNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLIDDSIKGGCKISLYDVYVFL 733
            LKYK   ++ + + +   QY +L   AA + I++GL+ + +V I G N P WFI+  G IFAGG+  GIY TN  +  +FI+N+C C + +V N++ L K + +  + P LKAI+ Y G +   +K    IS+Y    F+
Sbjct:   76 LKYKSDPKNGYDIEVTMEQYLELIQKAASNFIKLGLDVKAAVGILGFNHPAWFISQLGGIFAGGIICGIYTTNTPDICKFIMNDCNCQIIVVENDDQLNKILSILPDVPQLKAIIKYTGDVSAELKTKYSISIYTWTEFM 215          
The following BLAST results are available for this feature:
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACSBG11.866e-14845.53acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
ACSBG24.562e-14545.97acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG23.426e-14445.97acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG23.426e-14445.97acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSBG25.441e-14345.97acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-134.483e-3827.99Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-135.648e-3827.99Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-137.381e-3828.09Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-54.926e-3229.37Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-182.324e-3026.86Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bgm2.134e-14147.02gene:FBgn0027348 transcript:FBtr0080590[more]
bgm2.134e-14147.02gene:FBgn0027348 transcript:FBtr0346624[more]
hll2.532e-10340.00gene:FBgn0286723 transcript:FBtr0080591[more]
CG39611.616e-4028.26gene:FBgn0036821 transcript:FBtr0302322[more]
CG39611.943e-4028.26gene:FBgn0036821 transcript:FBtr0333712[more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg24.007e-17451.78acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg24.008e-17451.78acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg12.297e-14545.15acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl51.031e-4128.93acyl-CoA synthetase long chain family member 5 [So... [more]
acsl51.031e-4128.93acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg28.486e-16849.79acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.054e-16750.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.308e-16750.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.611e-16750.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg21.624e-16750.00acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Acsbg21.043e-14747.26acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
Acsbg17.069e-14743.62acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
Acsbg32.265e-10333.75acyl-CoA synthetase bubblegum family member 3 [Sou... [more]
Acsl51.120e-4530.57acyl-CoA synthetase long-chain family member 5 [So... [more]
Acsl12.700e-4329.49acyl-CoA synthetase long-chain family member 1 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7ZYC4|ACBG2_XENLA8.509e-16649.58Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopu... [more]
sp|Q5ZKR7|ACBG2_CHICK3.014e-15949.16Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus... [more]
sp|Q96GR2|ACBG1_HUMAN8.264e-14845.53Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo s... [more]
sp|Q2XU92|ACBG2_MOUSE6.348e-14747.26Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus mu... [more]
sp|Q2KHW5|ACBG1_BOVIN1.063e-14644.79Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos ta... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W5L9W32.815e-17351.80AMP-binding domain-containing protein OS=Astyanax ... [more]
A0A3P8WSG31.243e-17151.60AMP-binding domain-containing protein OS=Cynogloss... [more]
B0S7E75.466e-17151.78Acyl-CoA synthetase bubblegum family member 2 (Fra... [more]
F1RCV25.468e-17151.78Acyl-CoA synthetase bubblegum family member 2 OS=D... [more]
A0A1S3T5V91.400e-17051.36long-chain-fatty-acid--CoA ligase ACSBG2-like isof... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000016625.21.794e-17651.80long-chain-fatty-acid--CoA ligase ACSBG2-like [Sou... [more]
acsbg21.937e-17051.36acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg19.249e-14845.55acyl-CoA synthetase bubblegum family member 1 [Sou... [more]
acsl1a1.165e-4229.67long-chain-fatty-acid--CoA ligase 1 [Source:NCBI g... [more]
acsl1a2.516e-4230.11long-chain-fatty-acid--CoA ligase 1 [Source:NCBI g... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
acsbg29.398e-16551.15acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ACSL13.228e-4229.41acyl-CoA synthetase long chain family member 1 [So... [more]
ACSL14.683e-3727.55acyl-CoA synthetase long chain family member 1 [So... [more]
acsl3b3.741e-1228.06acyl-CoA synthetase long chain family member 3b [S... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
FAA21.064e-2727.92Medium chain fatty acyl-CoA synthetase; activates ... [more]
FAA12.716e-2627.35Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA41.138e-2022.65Long chain fatty acyl-CoA synthetase; activates fa... [more]
FAA31.975e-1826.22Long chain fatty acyl-CoA synthetase; activates im... [more]
PCS601.780e-1337.70Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO320544.194e-14348.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454619.575e-4329.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463611.589e-4028.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463352.005e-4029.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455044.261e-3726.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acsbg22.906e-17250.42acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
acsbg23.888e-17250.42acyl-CoA synthetase bubblegum family member 2 [Sou... [more]
ENSORLT00000027775.11.825e-16649.68long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
ENSORLT00000001544.21.825e-16649.68long-chain-fatty-acid--CoA ligase ACSBG2 [Source:N... [more]
acsl52.837e-4330.40acyl-CoA synthetase long chain family member 5 [So... [more]
back to top
BLAST of Long-chain-fatty-acid--CoA ligase ACSBG2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080395.13.296e-6099.57SMESG000080395.1[more]
SMESG000080395.12.521e-6099.57SMESG000080395.1[more]
SMESG000080395.10.000e+099.57SMESG000080395.1[more]
SMESG000027204.13.967e-17152.78SMESG000027204.1[more]
SMESG000027204.19.212e-17052.78SMESG000027204.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033222 ID=SMED30033222|Name=Long-chain-fatty-acid--CoA ligase ACSBG2|organism=Schmidtea mediterranea sexual|type=transcript|length=2393bp
TTGACATTTATCTAGGGAATATTTATGTTAAAATAAGAATGTTTTATTAA
ACATTATAACTGTTATCAAGGAATTTATGGAAGTTGATCACGTGAAACTG
ATTAAAGTCAATGGACCGTTAAATAAATCTCAAAATAAAATTACCTTTGA
AATTAAACAACATAGTCCTGTCGAAACCGAAAACATGTTTTCGACAAGCC
TGGATAAAGTTTCAAAATTGAGAATGAACTGTAAAGGAGATCTAGCAAGA
ATTAAGCCTATAACACTCCATACAATGTTCCATAATGCAATTGATAAAGG
AGCAAATACCGAAGCACTTAAATATAAATACAGTCAAGAAAGCAGCTTTC
TTTCAATAAATTATTCTCAATATTACCAACTTTGTTGCATGGCCGCCAAA
AGTTTAATCCAAATTGGTTTAAATGCTCGTAAATCAGTTTGTATATCCGG
TCACAATAGCCCAGAATGGTTTATCACATATTTTGGTACAATATTTGCTG
GCGGAGTTGCCAGTGGTATTTATGTTACAAATAATAAGGAAACTGTTGAA
TTTATTATCAACAATTGTGAATGTATAGTGGCTATAGTTGCTAACGAAGA
ATTGCTGAAGAAATATGTTTGTGTTTCAAAAAACTGTCCCAATCTAAAGG
CCATCGTTTATTACGGTGGTCTAATTGATGACTCAATTAAGGGCGGATGT
AAAATATCACTATATGACGTATATGTGTTTTTGATTTAATATATATGATT
ATAGTGTAGTGGACAGAATTCATGAATCTCGGAATAAATATCAATGATGA
CACTCTCATAGGTAGATTGAATCATCTTATTCCAAATGAGTGCTGTTCTC
TTATTTACACCAGTGGAACAACTGGAAATCCAAAAGGTGTCATGATGAGT
CACGACAATCTTGTATGGACTGCGGAATGCATGTTGTATTATATGAAATT
TCGACACAGTAAGGAAATGCTAATAAGTTATTTGCCGCTGAGTCACGTTG
CAGCTCAAATGTGTGACATAATCATCCCGTTGCTCTGTCAGGCGACAATA
CATTTTGCTCAACCCGATGCTCTGAAAGGATCACTCGGACATACTTTAAA
AGAAGTGCACCCGACGTATTTCATCGGTGTACCTCGGGTATTTGAAAAAA
TAATGGAACAAATGAAAGAAATGGCGATTGATTTTTCATCAGTGAAAAAA
AGTATTTCTTCCTGGGCTAAAGATATTGGCTACAGAACGAATTTAGCTAA
AATGATGAAAGAAAATGGACCATTTGGGTATTCCATAGCAAAATGTGTTA
TATTCAACAAGGTTCATAAAGCACTTGGATTTGATCGGTGTCTTGGAATA
TTTTCAGCAGCAGCTCCTTTAAGTCATGATGTTTTAGTTTATTTTGCATC
ATTAGATTTAGTTATTTGTGAAATATACGGAATGAGTGAATGCTCTGGAC
CGCAAACGATTGAATTTCAAAATGAATTTCGTTTTGGATCAGTTGGTAAA
ATTCTACCCGATTTTGGCTGTAAATTAGATTCTGAGGATGGGAAAGAAGG
AGAAATTTGTATGTATGGACGACATGTTTTTATGGGTTATGTCAATGCAC
CAGAAAAAACGAAAGAAGTATTTGATTCGGAATATTGGCTCCATTCTGGA
GATGTTGGTACTTTTAACGATGAAGGCTATTTGTTCATAACTGGAAGAAT
AAAAGAGTTGCTAATTACTGCTGGAGGGGAAAACATTGCTCCTGTGCCAA
TTGAACAAAAAATAAAAGAGAATTTAGACTTTATTAGCAATGCAATGGTA
GTTGGGGATAAGAGAAAATATTTATGTGTTTTGTTAACTATTAAATGCGT
GATTGACCCGGTCACCCAGATACCCACGGATGACTTGACTCCCGCCGCGA
AAAGATGGTTTAGTGGAATTGGTTACAATCCAACGTCAATTTCACAAATA
ATAACAGATAAAAATCCCAAACTTTCCATAAGTATAGATGAAGGCATAAA
GCGCAGTAATGAAAACGCTATTTCGCGTTCAGCTGAAGTACAAAAATGGA
CATTTCTTCCACACGACTTTTCAGTTCCAGGTGGAGAACTTGGACCGACG
CTTAAATTGAAACGGAATGTGGTCAATGAGTTGTATAGTGCTTTAATAAA
CTCGCTTTATGAATAATATTCCGACCAGATCGGCCATTCAATCTTATATA
ACTGGGAAATTTCACTTTTAGGTCTTTATATTTTATCGTCATAATAATTT
AGAATTTTTTTATTCGTTTTAATGTAACTTAATTAATTGACACTGCATAA
AAGTAAATAATAAATAAGAATTATTTATTTTTGAAAAAATATAACGAAAA
TCTAGAATATTAAATTGTGATAAACAAATAAATATTTTTGACA
back to top

protein sequence of SMED30033222-orf-1

>SMED30033222-orf-1 ID=SMED30033222-orf-1|Name=SMED30033222-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=465bp
MNLGININDDTLIGRLNHLIPNECCSLIYTSGTTGNPKGVMMSHDNLVWT
AECMLYYMKFRHSKEMLISYLPLSHVAAQMCDIIIPLLCQATIHFAQPDA
LKGSLGHTLKEVHPTYFIGVPRVFEKIMEQMKEMAIDFSSVKKSISSWAK
DIGYRTNLAKMMKENGPFGYSIAKCVIFNKVHKALGFDRCLGIFSAAAPL
SHDVLVYFASLDLVICEIYGMSECSGPQTIEFQNEFRFGSVGKILPDFGC
KLDSEDGKEGEICMYGRHVFMGYVNAPEKTKEVFDSEYWLHSGDVGTFND
EGYLFITGRIKELLITAGGENIAPVPIEQKIKENLDFISNAMVVGDKRKY
LCVLLTIKCVIDPVTQIPTDDLTPAAKRWFSGIGYNPTSISQIITDKNPK
LSISIDEGIKRSNENAISRSAEVQKWTFLPHDFSVPGGELGPTLKLKRNV
VNELYSALINSLYE*
back to top

protein sequence of SMED30033222-orf-2

>SMED30033222-orf-2 ID=SMED30033222-orf-2|Name=SMED30033222-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=221bp
MEVDHVKLIKVNGPLNKSQNKITFEIKQHSPVETENMFSTSLDKVSKLRM
NCKGDLARIKPITLHTMFHNAIDKGANTEALKYKYSQESSFLSINYSQYY
QLCCMAAKSLIQIGLNARKSVCISGHNSPEWFITYFGTIFAGGVASGIYV
TNNKETVEFIINNCECIVAIVANEELLKKYVCVSKNCPNLKAIVYYGGLI
DDSIKGGCKISLYDVYVFLI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR000873AMP-dep_Synth/Lig
IPR020845AMP-binding_CS
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 21..316
e-value: 2.9E-63
score: 214.0
NoneNo IPR availablePANTHERPTHR43272FAMILY NOT NAMEDcoord: 1..463
NoneNo IPR availablePANTHERPTHR43272:SF32LONG-CHAIN-FATTY-ACID--COA LIGASE ACSBG2coord: 1..463
NoneNo IPR availableCDDcd05933ACSBG_likecoord: 1..463
e-value: 0.0
score: 641.33
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 21..463
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 27..38