BRCA2-interacting transcriptional repressor EMSY

Overview
NameBRCA2-interacting transcriptional repressor EMSY
Smed IDSMED30033217
Length (bp)2788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BRCA2-interacting transcriptional repressor EMSY (SMED30033217) t-SNE clustered cells

Violin plots show distribution of expression levels for BRCA2-interacting transcriptional repressor EMSY (SMED30033217) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BRCA2-interacting transcriptional repressor EMSY (SMED30033217) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BRCA2-interacting transcriptional repressor EMSY (SMED30033217) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033217

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033217h1SMcG0009741 SmedASXL_015497SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30033217h1SMcG0009741 SmedASXL_015497SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30033217h1SMcG0009741 Contig48486newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Match: EMSY (EMSY transcriptional repressor, BRCA2 interacting [Source:HGNC Symbol;Acc:HGNC:18071])

HSP 1 Score: 112.849 bits (281), Expect = 1.540e-24
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Match: EMSY (EMSY transcriptional repressor, BRCA2 interacting [Source:HGNC Symbol;Acc:HGNC:18071])

HSP 1 Score: 112.849 bits (281), Expect = 1.540e-24
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Match: EMSY (EMSY transcriptional repressor, BRCA2 interacting [Source:HGNC Symbol;Acc:HGNC:18071])

HSP 1 Score: 112.464 bits (280), Expect = 1.554e-24
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Match: EMSY (EMSY transcriptional repressor, BRCA2 interacting [Source:HGNC Symbol;Acc:HGNC:18071])

HSP 1 Score: 112.464 bits (280), Expect = 1.700e-24
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Match: EMSY (EMSY transcriptional repressor, BRCA2 interacting [Source:HGNC Symbol;Acc:HGNC:18071])

HSP 1 Score: 90.8929 bits (224), Expect = 1.586e-21
Identity = 43/78 (55.13%), Postives = 61/78 (78.21%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIA 316
             +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA
Sbjct:    3 VVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIA 80          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Fly
Match: CG15356 (gene:FBgn0031377 transcript:FBtr0077869)

HSP 1 Score: 99.3673 bits (246), Expect = 7.620e-21
Identity = 47/93 (50.54%), Postives = 65/93 (69.89%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  ++++  ECR +LR  EL  YS VVSV RAQG LSE K  +L  L++   I+ ER++AE+RRAAN+E+L TIAENV G + + EW+  G
Sbjct:    1 MWPQTLEMSRDECRGMLRRLELESYSHVVSVFRAQGALSETKAKLLEELRQQFHINQERHRAEVRRAANDEQLCTIAENVCGPNTWQEWSREG 93          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Zebrafish
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:335889])

HSP 1 Score: 106.686 bits (265), Expect = 6.275e-23
Identity = 47/93 (50.54%), Postives = 71/93 (76.34%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L+++KK +L  L ++LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKELLGELTRVLSISTERHRAEVRRAVNDERLTTIAHHMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Zebrafish
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:335889])

HSP 1 Score: 106.686 bits (265), Expect = 6.275e-23
Identity = 47/93 (50.54%), Postives = 71/93 (76.34%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L+++KK +L  L ++LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKELLGELTRVLSISTERHRAEVRRAVNDERLTTIAHHMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Zebrafish
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:335889])

HSP 1 Score: 81.2629 bits (199), Expect = 3.811e-15
Identity = 36/69 (52.17%), Postives = 54/69 (78.26%), Query Frame = 2
Query:  149 LLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWA 355
            L  Y+ V+S LRAQG L+++KK +L  L ++LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+
Sbjct:    2 LEAYAGVISALRAQGDLTKDKKELLGELTRVLSISTERHRAEVRRAVNDERLTTIAHHMSGPNSSSEWS 70          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Match: EMSY (EMSY, BRCA2-interacting transcriptional repressor [Source:NCBI gene;Acc:100136947])

HSP 1 Score: 105.531 bits (262), Expect = 1.503e-24
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +D +  EC++ILR+ EL  Y+ V+S LRAQG L +EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Match: EMSY (EMSY, BRCA2-interacting transcriptional repressor [Source:NCBI gene;Acc:100136947])

HSP 1 Score: 105.531 bits (262), Expect = 2.329e-24
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +D +  EC++ILR+ EL  Y+ V+S LRAQG L +EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Match: EMSY (EMSY, BRCA2-interacting transcriptional repressor [Source:NCBI gene;Acc:100136947])

HSP 1 Score: 110.153 bits (274), Expect = 7.388e-24
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +D +  EC++ILR+ EL  Y+ V+S LRAQG L +EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:   21 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 113          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Match: EMSY (EMSY, BRCA2-interacting transcriptional repressor [Source:NCBI gene;Acc:100136947])

HSP 1 Score: 110.153 bits (274), Expect = 8.194e-24
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +D +  EC++ILR+ EL  Y+ V+S LRAQG L +EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Match: EMSY (EMSY, BRCA2-interacting transcriptional repressor [Source:NCBI gene;Acc:100136947])

HSP 1 Score: 110.153 bits (274), Expect = 8.356e-24
Identity = 49/93 (52.69%), Postives = 70/93 (75.27%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +D +  EC++ILR+ EL  Y+ V+S LRAQG L +EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDFSRDECKRILRKLELEAYAGVISALRAQGDLCKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Match: Emsy (EMSY, BRCA2-interacting transcriptional repressor [Source:MGI Symbol;Acc:MGI:1924203])

HSP 1 Score: 108.997 bits (271), Expect = 1.959e-25
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Match: Emsy (EMSY, BRCA2-interacting transcriptional repressor [Source:MGI Symbol;Acc:MGI:1924203])

HSP 1 Score: 112.079 bits (279), Expect = 9.718e-25
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Match: Emsy (EMSY, BRCA2-interacting transcriptional repressor [Source:MGI Symbol;Acc:MGI:1924203])

HSP 1 Score: 100.523 bits (249), Expect = 4.798e-21
Identity = 49/107 (45.79%), Postives = 72/107 (67.29%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAE--------------NVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA               ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEG 110          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Match: Emsy (EMSY, BRCA2-interacting transcriptional repressor [Source:MGI Symbol;Acc:MGI:1924203])

HSP 1 Score: 100.908 bits (250), Expect = 4.883e-21
Identity = 49/107 (45.79%), Postives = 72/107 (67.29%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAE--------------NVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA               ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEG 110          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Match: Emsy (EMSY, BRCA2-interacting transcriptional repressor [Source:MGI Symbol;Acc:MGI:1924203])

HSP 1 Score: 67.781 bits (164), Expect = 6.011e-11
Identity = 30/63 (47.62%), Postives = 46/63 (73.02%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAE 274
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LS+S   + +E
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSMSGPNSSSE 66          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. UniProt/SwissProt
Match: sp|Q7Z589|EMSY_HUMAN (BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 7.398e-24
Identity = 50/93 (53.76%), Postives = 72/93 (77.42%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA N+SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. UniProt/SwissProt
Match: sp|Q7ZUV7|EMSY_DANRE (BRCA2-interacting transcriptional repressor EMSY OS=Danio rerio OX=7955 GN=emsy PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 4.901e-22
Identity = 47/93 (50.54%), Postives = 71/93 (76.34%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L+++KK +L  L ++LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKELLGELTRVLSISTERHRAEVRRAVNDERLTTIAHHMSGPNSSSEWSIEG 96          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. UniProt/SwissProt
Match: sp|Q8BMB0|EMSY_MOUSE (BRCA2-interacting transcriptional repressor EMSY OS=Mus musculus OX=10090 GN=Emsy PE=1 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 3.416e-20
Identity = 49/107 (45.79%), Postives = 72/107 (67.29%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAE--------------NVSGFDAYSEWASLG 364
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L++EKK++L  L K+LSIS ER++AE+RRA N+E+L TIA               ++SG ++ SEW+  G
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSISTERHRAEVRRAVNDERLTTIAHKMNLSLYLGERPSYSMSGPNSSSEWSIEG 110          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Match: A0A4Z2D781 (BRCA2-interacting transcriptional repressor EMSY OS=Schistosoma japonicum OX=6182 GN=EWB00_003787 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.902e-25
Identity = 70/138 (50.72%), Postives = 92/138 (66.67%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCETHDSE 496
            TIWP+ +D +  EC QILR  EL  YS +V+VLRAQGPL+EEKK +L  LQ++LSIS +R+KAE+RRA N+E+LATI+E V G +   EW   G    P  +RP+P TI+  QA++ S    V+    P P ET  SE
Sbjct:   13 TIWPLLLDYDQRECLQILRRLELEAYSKIVAVLRAQGPLTEEKKKLLYKLQRLLSISIDRHKAEVRRALNDEELATISEAVCGKEVDEEWILEGKRISPIFQRPSPETIFISQANKASFEQLVRNTRLPRPAETALSE 150          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Match: A0A183P8B3 (ENT domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS10601 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 7.050e-25
Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCET 484
            TIWP+ +D N  EC QILR  EL  YS +V+VLRAQGPL+EEKK +L  LQ++LSIS +R+KAE+R+A N+E+LATI+E V G +   EW   G    P  +RP+P TI+  QA++ S    ++    P P ET
Sbjct:   13 TIWPLLLDYNQRECLQILRRLELEAYSKIVAVLRAQGPLTEEKKKLLHKLQRLLSISIDRHKAEVRKALNDEELATISEAVCGKEVDEEWILEGKRISPIFQRPSPETIFISQANKASFEQLIRNSRLPCPAET 146          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Match: A0A5K4EZF8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.085e-24
Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCET 484
            TIWP+ +D N  EC QILR  EL  YS +V+VLRAQGPL+EEKK +L  LQ++LSIS +R+KAE+R+A N+E+LATI+E V G +   EW   G    P  +RP+P TI+  QA++ S    ++    P P ET
Sbjct:   13 TIWPLLLDYNQRECLQILRRLELEAYSKIVAVLRAQGPLTEEKKKLLHKLQRLLSISIDRHKAEVRKALNDEELATISEAVCGKEVDEEWILEGKRISPIFQRPSPETIFISQANKASFEQLIRNSRLPCPAET 146          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Match: A0A095C5S3 (Protein EMSY OS=Schistosoma haematobium OX=6185 GN=MS3_05623 PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 1.261e-24
Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCET 484
            TIWP+ +D N  EC QILR  EL  YS +V+VLRAQGPL+EEKK +L  LQ++LSIS +R+KAE+R+A N+E+LATI+E V G +   EW   G    P  +RP+P TI+  QA++ S    ++    P P ET
Sbjct:   13 TIWPLLLDYNQRECLQILRRLELEAYSKIVAVLRAQGPLTEEKKKLLHKLQRLLSISIDRHKAEVRKALNDEELATISEAVCGKEVDEEWILEGKRISPIFQRPSPETIFISQANKASFEQLIRNSRLPCPAET 146          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Match: A0A5K4EZJ5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.273e-24
Identity = 67/134 (50.00%), Postives = 90/134 (67.16%), Query Frame = 2
Query:   83 TIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCET 484
            TIWP+ +D N  EC QILR  EL  YS +V+VLRAQGPL+EEKK +L  LQ++LSIS +R+KAE+R+A N+E+LATI+E V G +   EW   G    P  +RP+P TI+  QA++ S    ++    P P ET
Sbjct:   13 TIWPLLLDYNQRECLQILRRLELEAYSKIVAVLRAQGPLTEEKKKLLHKLQRLLSISIDRHKAEVRKALNDEELATISEAVCGKEVDEEWILEGKRISPIFQRPSPETIFISQANKASFEQLIRNSRLPCPAET 146          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Cavefish
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:335889])

HSP 1 Score: 108.997 bits (271), Expect = 1.122e-23
Identity = 48/97 (49.48%), Postives = 74/97 (76.29%), Query Frame = 2
Query:   65 MSYTCETIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWA 355
            ++ T   +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L+++KK++L  L K+LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+
Sbjct:    9 LAGTMPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKDLLGELTKVLSISTERHRAEVRRAVNDERLTTIAYHMSGPNSSSEWS 105          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Cavefish
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:335889])

HSP 1 Score: 107.071 bits (266), Expect = 3.646e-23
Identity = 47/90 (52.22%), Postives = 71/90 (78.89%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWA 355
            +WP  +DL+  EC++ILR+ EL  Y+ V+S LRAQG L+++KK++L  L K+LSIS ER++AE+RRA N+E+L TIA ++SG ++ SEW+
Sbjct:    4 VWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKDKKDLLGELTKVLSISTERHRAEVRRAVNDERLTTIAYHMSGPNSSSEWS 93          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Nematostella
Match: EDO45194 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTD9])

HSP 1 Score: 75.485 bits (184), Expect = 8.007e-14
Identity = 41/107 (38.32%), Postives = 65/107 (60.75%), Query Frame = 2
Query:   98 RIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVL--LNLQ----------------KILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG 364
            +++++  E ++ILR  EL  YS +VSV RAQG LS +KK +L  L LQ                K++SIS ER++AE+RRA ++++L  +A+ + G    +EWA+ G
Sbjct:   96 KMEVSRDEAKRILRRLELEAYSSIVSVFRAQGDLSRDKKKILTDLGLQLRYVNPITLLELCVKYKLISISTERHRAEIRRAYSDDRLGAVADCIYGPSTCAEWAAEG 202          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Nematostella
Match: EDO26054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD04])

HSP 1 Score: 58.9214 bits (141), Expect = 3.425e-11
Identity = 30/58 (51.72%), Postives = 43/58 (74.14%), Query Frame = 2
Query:  146 ELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAE 319
            EL  YS +VSV RAQG LS +KK +L +L   LSIS ER++AE+RRA ++++L  +A+
Sbjct:    1 ELEAYSSIVSVFRAQGDLSRDKKKILTDLGLQLSISTERHRAEIRRAYSDDRLGAVAD 58          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Medaka
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:101167977])

HSP 1 Score: 110.538 bits (275), Expect = 3.351e-24
Identity = 60/150 (40.00%), Postives = 92/150 (61.33%), Query Frame = 2
Query:   50 LRFQIMSYTCETIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCETHDSEL 499
            L   ++  T   +WP  +DL   EC++ILR+ EL  Y+ V+S LRAQG L+++KK++L  L KIL IS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G    P   R  P+T +   A+  + +   +    P P ET + E+
Sbjct:    4 LEKPVLPGTMPVVWPTILDLGRDECKRILRKLELEAYAGVISALRAQGDLTKDKKDLLAELTKILGISTERHRAEVRRAVNDERLTTIAYHMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTATANAVASATANQNASLPLPAETGNKEV 153          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Medaka
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:101167977])

HSP 1 Score: 110.538 bits (275), Expect = 3.499e-24
Identity = 60/150 (40.00%), Postives = 92/150 (61.33%), Query Frame = 2
Query:   50 LRFQIMSYTCETIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCETHDSEL 499
            L   ++  T   +WP  +DL   EC++ILR+ EL  Y+ V+S LRAQG L+++KK++L  L KIL IS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G    P   R  P+T +   A+  + +   +    P P ET + E+
Sbjct:    4 LEKPVLPGTMPVVWPTILDLGRDECKRILRKLELEAYAGVISALRAQGDLTKDKKDLLAELTKILGISTERHRAEVRRAVNDERLTTIAYHMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTATANAVASATANQNASLPLPAETGNKEV 153          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Medaka
Match: emsy (EMSY transcriptional repressor, BRCA2 interacting [Source:NCBI gene;Acc:101167977])

HSP 1 Score: 107.842 bits (268), Expect = 2.603e-23
Identity = 58/138 (42.03%), Postives = 88/138 (63.77%), Query Frame = 2
Query:   86 IWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCETHDSEL 499
            +WP  +DL   EC++ILR+ EL  Y+ V+S LRAQG L+++KK++L  L KIL IS ER++AE+RRA N+E+L TIA ++SG ++ SEW+  G    P   R  P+T +   A+  + +   +    P P ET + E+
Sbjct:    4 VWPTILDLGRDECKRILRKLELEAYAGVISALRAQGDLTKDKKDLLAELTKILGISTERHRAEVRRAVNDERLTTIAYHMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTATANAVASATANQNASLPLPAETGNKEV 141          
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Planmine SMEST
Match: SMESG000052140.1 (SMESG000052140.1)

HSP 1 Score: 1147.88 bits (2968), Expect = 0.000e+0
Identity = 661/676 (97.78%), Postives = 661/676 (97.78%), Query Frame = 2
Query:   95 MRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFXXXXXXXXXXIYCDQASQTSISFTVKEKDFPSPCETHDSELSDKHEASILTNRIINKDRRAVKTEATVKAQCSMSTMTDINKTPSQELFKNNLTKEPSTSHDYNLHLLSEIATGESNQSEVINDPIVETNIKPDSFSIHNQINDIEQGITSSETPSVTINTRQTLASSLLMXXXXXXXLIFSGPIKSLNTNIQEINLTGSNNQMIISNNAGQRFAFPRNTITQSINLISTNPQKNXXXXXXXXXXXXXXXXXXTLSNNQLRSPPSHHLGGSWTGQQNQPTQQVFIQNVPTVHHASNLQHHQSGDYANSLGLALKQRAMTEQVKTHQPHQINNKLVVRNLGTQVSAESDRNKRFMVVKGNAGSGSVGPSNKKPKISNPSNRQPGRPPLMPAPSSAYTSRPYVANEIFHSNRAINXXXXXXXXXXXXXXNGLKXXXXXXXXXXXXXXXXQIRSNSYYPVNRGNGLQRTNXXXXXXXXXXXXXXXILTVDSSSNITTTNTLRPKNIQPVISVVPLSPRGLSTTDSVISNVSILGNSNKDDNEHNVMDKDSSSFKVTSKDEVYANLLERSNQPPMVSLSQTENKIQ 2122
            MRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFPPTKRPTPRTIYCDQASQTSISFTVKEKDFPSPCETHDSELSDKHEASILTNRIINKDRRAVKTEATVKAQCSMSTMTDINKTPSQELFKNNLTKEPSTSHDYNLHLLSEIATGESNQSEVINDPIVETNIKPDSFSIHNQINDIEQGITSSETPSVTINTRQTLASSLLMPPNNPPNLIFSGPIKSLNTNIQEINLTGSNNQMIISNNAGQRFAFPRNTITQSINLISTNPQKNQISSFISQQQSQAGGSFITLSNNQLRSPPSHHLGGSWTGQQNQPTQQVFIQNVPTVHHASNLQHHQSGDYANSLGLALKQRAMTEQVKTHQPHQINNKLVVRNLGTQVSAESDRNKRFMVVKGNAGSGSVGPSNKKPKISNPSNRQPGRPPLMPAPSSAYTSRPYVANEIFHSNRAINTISSISDTSSTTDSNGLKISSISSGSRGVNVNSSQIRSNSYYPVNRGNGLQRTNTSTSSSVVQLGSGSQILTVDSSSNITTTNTLRPKNIQPVISVVPLSPR               GNSNKDDNEHNVMDKDSSSFKVTSKDEVYANLLERSNQPPMVSLSQTENKIQ
Sbjct:    1 MRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKKNVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLGALKFPPTKRPTPRTIYCDQASQTSISFTVKEKDFPSPCETHDSELSDKHEASILTNRIINKDRRAVKTEATVKAQCSMSTMTDINKTPSQELFKNNLTKEPSTSHDYNLHLLSEIATGESNQSEVINDPIVETNIKPDSFSIHNQINDIEQGITSSETPSVTINTRQTLASSLLMPPNNPPNLIFSGPIKSLNTNIQEINLTGSNNQMIISNNAGQRFAFPRNTITQSINLISTNPQKNQISSFISQQQSQAGGSFITLSNNQLRSPPSHHLGGSWTGQQNQPTQQVFIQNVPTVHHASNLQHHQSGDYANSLGLALKQRAMTEQVKTHQPHQINNKLVVRNLGTQVSAESDRNKRFMVVKGNAGSGSVGPSNKKPKISNPSNRQPGRPPLMPAPSSAYTSRPYVANEIFHSNRAINTISSISDTSSTTDSNGLKISSISSGSRGVNVNSSQIRSNSYYPVNRGNGLQRTNTSTSSSVVQLGSGSQILTVDSSSNITTTNTLRPKNIQPVISVVPLSPR---------------GNSNKDDNEHNVMDKDSSSFKVTSKDEVYANLLERSNQPPMVSLSQTENKIQ 661          
The following BLAST results are available for this feature:
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EMSY1.540e-2453.76EMSY transcriptional repressor, BRCA2 interacting ... [more]
EMSY1.540e-2453.76EMSY transcriptional repressor, BRCA2 interacting ... [more]
EMSY1.554e-2453.76EMSY transcriptional repressor, BRCA2 interacting ... [more]
EMSY1.700e-2453.76EMSY transcriptional repressor, BRCA2 interacting ... [more]
EMSY1.586e-2155.13EMSY transcriptional repressor, BRCA2 interacting ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG153567.620e-2150.54gene:FBgn0031377 transcript:FBtr0077869[more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
emsy6.275e-2350.54EMSY transcriptional repressor, BRCA2 interacting ... [more]
emsy6.275e-2350.54EMSY transcriptional repressor, BRCA2 interacting ... [more]
emsy3.811e-1552.17EMSY transcriptional repressor, BRCA2 interacting ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EMSY1.503e-2452.69EMSY, BRCA2-interacting transcriptional repressor ... [more]
EMSY2.329e-2452.69EMSY, BRCA2-interacting transcriptional repressor ... [more]
EMSY7.388e-2452.69EMSY, BRCA2-interacting transcriptional repressor ... [more]
EMSY8.194e-2452.69EMSY, BRCA2-interacting transcriptional repressor ... [more]
EMSY8.356e-2452.69EMSY, BRCA2-interacting transcriptional repressor ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Emsy1.959e-2553.76EMSY, BRCA2-interacting transcriptional repressor ... [more]
Emsy9.718e-2553.76EMSY, BRCA2-interacting transcriptional repressor ... [more]
Emsy4.798e-2145.79EMSY, BRCA2-interacting transcriptional repressor ... [more]
Emsy4.883e-2145.79EMSY, BRCA2-interacting transcriptional repressor ... [more]
Emsy6.011e-1147.62EMSY, BRCA2-interacting transcriptional repressor ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q7Z589|EMSY_HUMAN7.398e-2453.76BRCA2-interacting transcriptional repressor EMSY O... [more]
sp|Q7ZUV7|EMSY_DANRE4.901e-2250.54BRCA2-interacting transcriptional repressor EMSY O... [more]
sp|Q8BMB0|EMSY_MOUSE3.416e-2045.79BRCA2-interacting transcriptional repressor EMSY O... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2D7812.902e-2550.72BRCA2-interacting transcriptional repressor EMSY O... [more]
A0A183P8B37.050e-2550.00ENT domain-containing protein OS=Schistosoma matth... [more]
A0A5K4EZF81.085e-2450.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A095C5S31.261e-2450.00Protein EMSY OS=Schistosoma haematobium OX=6185 GN... [more]
A0A5K4EZJ51.273e-2450.00Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
emsy1.122e-2349.48EMSY transcriptional repressor, BRCA2 interacting ... [more]
emsy3.646e-2352.22EMSY transcriptional repressor, BRCA2 interacting ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO451948.007e-1438.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260543.425e-1151.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
emsy3.351e-2440.00EMSY transcriptional repressor, BRCA2 interacting ... [more]
emsy3.499e-2440.00EMSY transcriptional repressor, BRCA2 interacting ... [more]
emsy2.603e-2342.03EMSY transcriptional repressor, BRCA2 interacting ... [more]
back to top
BLAST of BRCA2-interacting transcriptional repressor EMSY vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000052140.10.000e+097.78SMESG000052140.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033217 ID=SMED30033217|Name=BRCA2-interacting transcriptional repressor EMSY|organism=Schmidtea mediterranea sexual|type=transcript|length=2788bp
TAAATTTTCATATAAAATATTATTGTTCAAATATACGGATTGCACTTGAT
TAAGATTTCAAATTATGTCATATACTTGCGAAACAATTTGGCCTATGCGC
ATCGATCTGAATTCCCTTGAATGCCGACAGATTCTAAGAGAGAAAGAACT
TTTATGTTATTCTGATGTTGTGTCTGTACTTAGAGCACAAGGTCCTTTAT
CGGAAGAGAAAAAAAATGTTTTACTAAATTTACAAAAAATTCTATCAATT
AGTGATGAACGAAACAAAGCGGAATTACGCAGAGCTGCTAATAATGAAAA
ATTAGCTACAATTGCTGAAAATGTTTCTGGTTTTGATGCTTATTCAGAAT
GGGCATCTTTAGGAGCGTTAAAATTTCCACCAACTAAGAGACCAACTCCT
CGAACTATATACTGTGATCAAGCTTCACAAACGAGTATTAGCTTTACTGT
TAAGGAAAAGGATTTTCCATCACCTTGTGAAACTCATGATTCTGAATTAT
CTGACAAACACGAAGCATCTATTCTTACTAACAGAATTATAAATAAAGAC
AGAAGAGCTGTTAAAACTGAAGCCACGGTTAAAGCCCAGTGTTCAATGTC
GACAATGACTGATATAAATAAAACACCAAGTCAAGAGCTATTTAAGAATA
ATCTCACAAAAGAACCAAGCACATCTCACGATTATAATCTTCATTTACTA
TCAGAAATTGCAACTGGAGAGTCAAATCAATCAGAAGTAATTAATGATCC
TATAGTTGAAACTAATATCAAGCCTGATTCATTTTCTATTCATAATCAAA
TCAATGATATTGAACAAGGAATTACCTCAAGTGAAACTCCATCTGTAACA
ATTAATACACGTCAAACTTTGGCTAGTAGTTTGTTAATGCCGCCCAATAA
CCCACCAAATTTAATATTTAGTGGCCCTATTAAATCTCTCAATACAAATA
TTCAAGAAATTAATCTAACTGGAAGTAATAATCAAATGATAATTTCGAAT
AACGCTGGACAGCGATTTGCTTTCCCTCGAAATACAATAACACAAAGCAT
CAATTTAATATCTACAAATCCGCAAAAGAATCAAATTTCATCATTTATCT
CTCAACAGCAATCACAAGCCGGTGGCAGTTTCATAACTTTATCCAACAAT
CAATTGCGCTCTCCTCCGTCTCATCATCTAGGCGGCAGTTGGACGGGTCA
ACAAAATCAACCTACTCAACAGGTTTTCATCCAAAATGTGCCCACTGTCC
ATCACGCATCTAACCTGCAACATCATCAAAGCGGAGATTACGCAAACTCT
CTCGGATTGGCACTTAAACAACGAGCAATGACCGAACAAGTAAAAACCCA
CCAACCGCACCAAATTAACAACAAACTTGTTGTTAGAAATCTCGGCACGC
AAGTCTCAGCGGAATCCGATCGCAATAAAAGATTTATGGTAGTTAAAGGC
AATGCAGGAAGTGGCTCAGTTGGACCGAGTAATAAAAAACCCAAAATATC
CAATCCATCAAATCGTCAACCAGGTCGACCTCCTCTGATGCCGGCACCTA
GCTCGGCATATACAAGCCGACCATATGTAGCTAATGAAATATTCCACAGC
AATCGAGCAATCAACACTATTTCATCGATTTCCGATACATCATCTACCAC
TGATTCTAATGGTTTGAAAATCAGTTCCATCAGTTCAGGAAGCCGCGGAG
TCAATGTAAACTCGTCACAGATACGATCGAATTCATATTATCCAGTGAAT
CGTGGCAACGGCTTGCAACGGACAAATACCAGCACCAGTAGTTCAGTTGT
ACAATTGGGATCGGGCTCCCAGATTCTCACAGTTGACTCCTCGAGTAACA
TCACCACCACCAATACATTGAGGCCGAAAAATATCCAACCTGTTATTTCT
GTGGTGCCTTTGAGTCCCAGAGGTTTGAGTACAACTGACAGTGTGATTTC
AAATGTATCCATTTTAGGAAATTCAAACAAAGATGACAATGAACATAATG
TAATGGACAAAGATTCGAGTTCTTTTAAAGTTACGTCCAAGGATGAAGTG
TATGCAAACCTTTTAGAGCGAAGTAATCAACCACCAATGGTCTCTCTGAG
TCAGACTGAAAATAAAATACAGTAATTAACTTATCGTATTTTAGTGATAT
CTTTTAAACTTTTGTAAATGGTGTATCTGGTTTTTGATTTTTTTTGTGAA
TGAGTTCTATAGATGAGTATGTGTATGATTTATTTCATGCATGTTTTATT
CGCATTTAATGATTATGTTCCCAATGTTTCTATCAAGTCAACCTTTACGT
GTTCAAACGTGAATTTTAATTCCATAACATGAATATATATATGGGATTCA
TTGAATTTATTAAATTTAAAAAATCGGAATATTTGGAAACTGTATTAAAA
AAATACAATGAAAGAAATGATAGAAATAATTGAAGAATTTTTGCTTTTTT
AATCACAATGAGAGTAAATATAATTTTTTTATTATTATTTCATGTATGTA
AATTTATTTTTGATGGACATAAAAAGGTTTAAAAAAATTATTGATTGAAT
TTATAATTTTATTTATTAAAATTGTAAGTCATTTTAACGAAAGTGTAGTG
TTTATAATCATAACTTAATGGATGTTGTTAATACGTATTATTTGCTATTT
ATGTAAATTCTTGATTCGAAGTTGTCAGTAAAAAAGTCTGATTTCTGTAC
ATAGTTCAAATACTCCAGGAATTTATGGCCTGATATTTTGTTTGGGTTAG
CAAATTGTATGTTGGTTATAGTTAATAAATTGTATTTC
back to top

protein sequence of SMED30033217-orf-1

>SMED30033217-orf-1 ID=SMED30033217-orf-1|Name=SMED30033217-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=687bp
MSYTCETIWPMRIDLNSLECRQILREKELLCYSDVVSVLRAQGPLSEEKK
NVLLNLQKILSISDERNKAELRRAANNEKLATIAENVSGFDAYSEWASLG
ALKFPPTKRPTPRTIYCDQASQTSISFTVKEKDFPSPCETHDSELSDKHE
ASILTNRIINKDRRAVKTEATVKAQCSMSTMTDINKTPSQELFKNNLTKE
PSTSHDYNLHLLSEIATGESNQSEVINDPIVETNIKPDSFSIHNQINDIE
QGITSSETPSVTINTRQTLASSLLMPPNNPPNLIFSGPIKSLNTNIQEIN
LTGSNNQMIISNNAGQRFAFPRNTITQSINLISTNPQKNQISSFISQQQS
QAGGSFITLSNNQLRSPPSHHLGGSWTGQQNQPTQQVFIQNVPTVHHASN
LQHHQSGDYANSLGLALKQRAMTEQVKTHQPHQINNKLVVRNLGTQVSAE
SDRNKRFMVVKGNAGSGSVGPSNKKPKISNPSNRQPGRPPLMPAPSSAYT
SRPYVANEIFHSNRAINTISSISDTSSTTDSNGLKISSISSGSRGVNVNS
SQIRSNSYYPVNRGNGLQRTNTSTSSSVVQLGSGSQILTVDSSSNITTTN
TLRPKNIQPVISVVPLSPRGLSTTDSVISNVSILGNSNKDDNEHNVMDKD
SSSFKVTSKDEVYANLLERSNQPPMVSLSQTENKIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036142ENT_dom-like_sf
IPR033482EMSY
IPR005491ENT_dom
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005491ENT domainSMARTSM01191ENT_2coord: 20..92
e-value: 3.6E-20
score: 83.0
IPR005491ENT domainPFAMPF03735ENTcoord: 22..89
e-value: 4.6E-20
score: 71.5
IPR005491ENT domainPROSITEPS51138ENTcoord: 20..104
score: 10.406
IPR036142ENT domain-like superfamilyGENE3DG3DSA:1.10.1240.40coord: 11..143
e-value: 9.5E-38
score: 130.9
IPR036142ENT domain-like superfamilySUPERFAMILYSSF158639ENT-likecoord: 16..120
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 466..485
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 462..489
IPR033482BRCA2-interacting transcriptional repressor EMSYPANTHERPTHR16500FAMILY NOT NAMEDcoord: 8..630