28S ribosomal protein S9

Overview
Name28S ribosomal protein S9
Smed IDSMED30033211
Length (bp)1229
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 28S ribosomal protein S9 (SMED30033211) t-SNE clustered cells

Violin plots show distribution of expression levels for 28S ribosomal protein S9 (SMED30033211) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 28S ribosomal protein S9 (SMED30033211) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 28S ribosomal protein S9 (SMED30033211) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033211

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30033211SMESG000018935.1 SmedASXL_011510SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30033211SMESG000018935.1 dd_Smed_v4_2348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30033211SMESG000018935.1 dd_Smed_v4_2348_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033211SMESG000018935.1 Contig55573uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30033211SMESG000018935.1 Contig55573newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30033211SMESG000018935.1 dd_Smed_v4_2348_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 28S ribosomal protein S9 vs. Ensembl Human
Match: MRPS9 (mitochondrial ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:14501])

HSP 1 Score: 224.172 bits (570), Expect = 8.042e-69
Identity = 114/313 (36.42%), Postives = 184/313 (58.79%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPI--QLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF Q DID +I YLFPSGLFE  ARPVMK P +I+P +  ++   +GRPF+  +YT + ++YS+M +   +L NL+  + +      +P + +   ++ S+W+  ++L +  +EK+    Y  ++ +++ +L   C +  E+F+   R  +  + KK+     L++P    E G  + ++ G++K + AE  +Y  G G+I +N +      P   +RE ++FP  F D +GK D+   V G G S  A A+RLA+++AL  F+ E +V  +  AGLLT D R +ERKKPG  GA
Sbjct:   80 EFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQAKSLLPEKTVTRDVIGSRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQ-----LIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGA 387          
BLAST of 28S ribosomal protein S9 vs. Ensembl Celegans
Match: mrps-9 (Probable 40S ribosomal protein S9, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:P34388])

HSP 1 Score: 137.117 bits (344), Expect = 3.050e-36
Identity = 110/364 (30.22%), Postives = 171/364 (46.98%), Query Frame = 3
Query:  144 ITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMME--------AIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPE------TGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQ-----------------VKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKK---PGLRG 1133
            I  +++ YL   ++   MME  R +FE GRR+LAKMM  D    DQ  ID +I YLFPSGL +P ARPVM+ P EI P       D  G+P  + ++T  P  Y ++ +          +  E++ S   NR  L     EP  L  S+W++  +L     EK  ++ Y   +   + + + P ++  +KF+   R P+       ++L     PE      T R+Y E   + K + A V++   G GK  I+ L+L +    L  RE +L P+  + ++G+ D+ A                  ++  G S +  A+R   +  +A   PEA +  L ++GLLT D R  ER K   PG R 
Sbjct:   31 IGKALETYLKHSQQHVAMMEKHRAEFETGRRHLAKMMSLDIHELDQEAIDRAILYLFPSGLTDPNARPVMRPPDEILPKFQRFTFDEEGKPEGSRFFTLSPKIYGLLSDIGVKTHSVMKFYDEHVGSRSVNRSDL-----EPANLSGSQWVTADKLKKKLSEKFSKELYGQVIIAFEHLASLPGSAIEQKFLMEFREPMT--ASTGSKLFGPAIPEVHVCAVTNRRYAEVTTRCKDTRATVKVTDAGKGKFDIDGLQLHDFR-HLQAREILLAPMIVSQSLGRFDVTATTSCISNTLPEAPNKAPLMRSGGMSALPRAVRHGTALCVAALQPEA-IEPLRLSGLLTLDPRKNERSKVNQPGARA 385          
BLAST of 28S ribosomal protein S9 vs. Ensembl Fly
Match: mRpS9 (gene:FBgn0037529 transcript:FBtr0081766)

HSP 1 Score: 216.083 bits (549), Expect = 5.923e-66
Identity = 123/334 (36.83%), Postives = 199/334 (59.58%), Query Frame = 3
Query:  144 ITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGE--PIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYG-QKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            ++ +++ YL +  E ++ M+ +  +F+ G+R+LA MMG D ETF Q DIDE+I YLFPSGL++ +ARP MK P  ++P +   E D  GRPF++ +YT +P F+ ++ + +     L  LE+   R  N P E   +++   + +   QL    +E +   +Y ++ N MD ++  P A +++ FI     P++D+ K+    +  +D E GR+YI TY   +K + A+V + +PG GKISIN  K +        RE +LFPL+F++ +GKVD+ A V+G G S  A A+R  I+ +L  F+ +  +  + +AGLLT+D R +ERKK G  GA
Sbjct:   55 VSKAMRAYLKRATEHDEFMKTQHLEFQIGKRHLANMMGADAETFTQEDIDEAISYLFPSGLYDQKARPAMKSPEVVFPARKAAEFDETGRPFHSMFYTGKPNFFQLLHDIVEETNKLADLEERMLRRGNKPDENQKLEIAGFQLLPKDQLELLLVESIADIEYSNFTNSMDRLIASPYAYKSKAFIERYMKPLMDQSKQLEVPKPRID-EEGRQYITTYECLRKTARADVTVRLPGTGKISING-KDISYFEDENCREQLLFPLQFSELLGKVDVEANVEGGGPSGQAGAIRWGIAMSLRSFVDQEMIESMRLAGLLTRDYRRRERKKFGQEGA 386          
BLAST of 28S ribosomal protein S9 vs. Ensembl Zebrafish
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-060825-257])

HSP 1 Score: 224.557 bits (571), Expect = 3.366e-69
Identity = 118/308 (38.31%), Postives = 180/308 (58.44%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLEN-----VPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPG 1124
            +FE G+R+LA MMG DPETF Q D+D SI YLFPSGLFE  ARPVMK P +I+P +  ++ D  GRPF+  +YT + ++YS+M +   + + +  +E ++ ++ N        + I L  S+W+  +++ +  +E +  Q Y  ++ + + +L+ P  S  E FI   R P+  + +K+  +  L     G  +    G++K + A V +   G G I+IN    L   P L +RE ++FPL F   +G+ DI   V+G G S  A A+RLAISRAL  F+ E ++ ++  AGLLT D R KERKKPG
Sbjct:   69 EFEIGKRHLANMMGEDPETFTQEDVDRSIAYLFPSGLFEKHARPVMKHPEQIFPKQKAVQWDAEGRPFHFLFYTGKQSYYSLMHD---VYDKMLVVEKHQDKMRNKGLFMADTKQISLSGSRWLLKEEMEEILVENISDQDYLRFIQLAERLLSMPYCSLEENFILKFRKPLEVQSRKQE-IPELQHDARGVAFSVADGRRKSAKARVTLIDSGSGNITINGTNYLHYFPVLQDREQLMFPLHFVGLLGRFDIEGSVEGSGRSSQAGAVRLAISRALLSFVSEGEMEKMRQAGLLTADPRIKERKKPG 372          
BLAST of 28S ribosomal protein S9 vs. Ensembl Xenopus
Match: zeb2 (zinc finger E-box binding homeobox 2 [Source:Xenbase;Acc:XB-GENE-479558])

HSP 1 Score: 219.55 bits (558), Expect = 1.606e-67
Identity = 117/314 (37.26%), Postives = 190/314 (60.51%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGE---PIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            ++  G+R+LA MMG DPETF Q DID +I YLFPSGLF+ +ARP+MK P +I+P +  ++   +GRPF+  +YT +P++YS+M E    L +++  E+ + R + +  E    + L+ S+W+  ++L +  +EK+  Q Y  ++ +++ +L  P  S  E+++   R  +  + KK+     +V+P    E GR +    G++K ++A V ++  G+G + +N +  +E    L +RE ++FP +F D +GK D+   V G G S  A A+RLA SRAL  F+ E ++  +  AGLLT D R KERKKPG  GA
Sbjct:   35 EYNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFDKKARPIMKHPEDIFPKQRAIQWGEDGRPFHFLFYTGKPSYYSLMHELYGKLLSIQKYEE-QMRSKGLYTENTKQMDLIGSRWLIKEELEEMLVEKLSDQDYLHFLQMLERLLILPYCSIEEEYVLKFRKNLEVQSKKQ-----VVNPLQYDEHGRAFSTGEGKRKTALATVVLHESGNGTMVVNGVNYIEYFTVLQDREQLMFPFQFLDRLGKHDLECTVAGGGKSSQAGAIRLATSRALLSFVSENEIEAMRQAGLLTTDPRVKERKKPGQEGA 342          
BLAST of 28S ribosomal protein S9 vs. Ensembl Xenopus
Match: zeb2 (zinc finger E-box binding homeobox 2 [Source:Xenbase;Acc:XB-GENE-479558])

HSP 1 Score: 219.55 bits (558), Expect = 3.938e-67
Identity = 117/314 (37.26%), Postives = 190/314 (60.51%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGE---PIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            ++  G+R+LA MMG DPETF Q DID +I YLFPSGLF+ +ARP+MK P +I+P +  ++   +GRPF+  +YT +P++YS+M E    L +++  E+ + R + +  E    + L+ S+W+  ++L +  +EK+  Q Y  ++ +++ +L  P  S  E+++   R  +  + KK+     +V+P    E GR +    G++K ++A V ++  G+G + +N +  +E    L +RE ++FP +F D +GK D+   V G G S  A A+RLA SRAL  F+ E ++  +  AGLLT D R KERKKPG  GA
Sbjct:   68 EYNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFDKKARPIMKHPEDIFPKQRAIQWGEDGRPFHFLFYTGKPSYYSLMHELYGKLLSIQKYEE-QMRSKGLYTENTKQMDLIGSRWLIKEELEEMLVEKLSDQDYLHFLQMLERLLILPYCSIEEEYVLKFRKNLEVQSKKQ-----VVNPLQYDEHGRAFSTGEGKRKTALATVVLHESGNGTMVVNGVNYIEYFTVLQDREQLMFPFQFLDRLGKHDLECTVAGGGKSSQAGAIRLATSRALLSFVSENEIEAMRQAGLLTTDPRVKERKKPGQEGA 375          
BLAST of 28S ribosomal protein S9 vs. Ensembl Mouse
Match: Mrps9 (mitochondrial ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1916777])

HSP 1 Score: 219.55 bits (558), Expect = 3.088e-67
Identity = 115/311 (36.98%), Postives = 180/311 (57.88%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF + DID +I YLFPSGLFE  ARP+MK P  I+P +   +   +GRPF+  +YT + ++YS+M +   +   +  LE +R  L +   E   L+ S+W+  ++L +  +EK+  + Y  ++ +++ +L  PC    E+F+   R  +  + KK+     L++P    E G  +  + G++K + A+  +Y  G GKI +N +  L   P   +RE ++FP  F D + + D+   V G G S  A A+RLA++RAL  F+ E +V  +  AGLLT D R +ERKKPG  GA
Sbjct:   80 EFNIGKRHLANMMGEDPETFAEEDIDRAIAYLFPSGLFEKRARPMMKHPEHIFPKQRATQWGEDGRPFHFLFYTGKQSYYSLMHD---VYGKVMQLEKHRGPL-SASAESRDLIGSRWLIKEELEEMLVEKLSDEDYAQFIRLLEKLLTLPCGPAEEEFVQRFRRSVTIQSKKQ-----LIEPVQYDEQGMAFSTSEGRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFPFHFLDRLERHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEDEVEWMRQAGLLTPDPRIRERKKPGQEGA 381          
BLAST of 28S ribosomal protein S9 vs. Ensembl Mouse
Match: Mrps9 (mitochondrial ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1916777])

HSP 1 Score: 49.6766 bits (117), Expect = 4.386e-7
Identity = 27/115 (23.48%), Postives = 60/115 (52.17%), Query Frame = 3
Query:  420 NTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP 764
            +  +YT + ++YS+M +   +   +  LE +R  L +   E   L+ S+W+  ++L +  +EK+  + Y  ++ +++ +L  PC    E+F+   R  +  + KK+     L++P
Sbjct:    2 HFLFYTGKQSYYSLMHD---VYGKVMQLEKHRGPL-SASAESRDLIGSRWLIKEELEEMLVEKLSDEDYAQFIRLLEKLLTLPCGPAEEEFVQRFRRSVTIQSKKQ-----LIEP 107          
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|Q58DQ5|RT09_BOVIN (28S ribosomal protein S9, mitochondrial OS=Bos taurus OX=9913 GN=MRPS9 PE=1 SV=3)

HSP 1 Score: 229.95 bits (585), Expect = 2.591e-70
Identity = 121/310 (39.03%), Postives = 183/310 (59.03%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQ---LLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF Q D+D +I YLFPSGLFE  ARP+MK P EI+P +  ++   +GRPF+  +YT + ++YS+M EA   + + +  +D   R + +  E  +   L+ S+W+  ++L +  +EK+  Q Y  ++ +++ +   PC +  E+F+   R  +  + KK + +E L   E G  +    G++K + AE  +Y  G GKI IN +  L   P   +RE ++FP  F D +GK D+   V G G S  A A+RLA+SRAL  F+ E +V  +  AGLLT D R +ERKKPG  GA
Sbjct:   80 EFNIGKRHLANMMGEDPETFTQEDVDRAITYLFPSGLFEKRARPIMKHPEEIFPKQRAVQWGEDGRPFHFLFYTGKQSYYSLMHEAYGKVLHAEERQDQ-LRAKGLFSEKSKSKDLIGSRWLIKEELEEMLVEKLSDQDYAQFIRLLERLSALPCDAAEEEFVGRFRRTVTVQSKK-HLIEPLQYDEQGMAFSTGQGKRKTANAEAVVYGHGSGKIEINGVDYLLYFPVTQDREQLMFPFHFLDRLGKHDVTCTVSGGGRSSQAGAIRLAMSRALCSFITEDEVEWMRQAGLLTTDPRVRERKKPGQEGA 387          
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|P82933|RT09_HUMAN (28S ribosomal protein S9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS9 PE=1 SV=2)

HSP 1 Score: 224.172 bits (570), Expect = 3.862e-68
Identity = 114/313 (36.42%), Postives = 184/313 (58.79%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPI--QLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF Q DID +I YLFPSGLFE  ARPVMK P +I+P +  ++   +GRPF+  +YT + ++YS+M +   +L NL+  + +      +P + +   ++ S+W+  ++L +  +EK+    Y  ++ +++ +L   C +  E+F+   R  +  + KK+     L++P    E G  + ++ G++K + AE  +Y  G G+I +N +      P   +RE ++FP  F D +GK D+   V G G S  A A+RLA+++AL  F+ E +V  +  AGLLT D R +ERKKPG  GA
Sbjct:   80 EFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRARPVMKHPEQIFPRQRAIQWGEDGRPFHYLFYTGKQSYYSLMHDVYGMLLNLEKHQSHLQAKSLLPEKTVTRDVIGSRWLIKEELEEMLVEKLSDLDYMQFIRLLEKLLTSQCGAAEEEFVQRFRRSVTLESKKQ-----LIEPVQYDEQGMAFSKSEGKRKTAKAEAIVYKHGSGRIKVNGIDYQLYFPITQDREQLMFPFHFVDRLGKHDVTCTVSGGGRSAQAGAIRLAMAKALCSFVTEDEVEWMRQAGLLTTDPRVRERKKPGQEGA 387          
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|Q9D7N3|RT09_MOUSE (28S ribosomal protein S9, mitochondrial OS=Mus musculus OX=10090 GN=Mrps9 PE=1 SV=3)

HSP 1 Score: 219.55 bits (558), Expect = 2.160e-66
Identity = 115/311 (36.98%), Postives = 180/311 (57.88%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDP----ETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF + DID +I YLFPSGLFE  ARP+MK P  I+P +   +   +GRPF+  +YT + ++YS+M +   +   +  LE +R  L +   E   L+ S+W+  ++L +  +EK+  + Y  ++ +++ +L  PC    E+F+   R  +  + KK+     L++P    E G  +  + G++K + A+  +Y  G GKI +N +  L   P   +RE ++FP  F D + + D+   V G G S  A A+RLA++RAL  F+ E +V  +  AGLLT D R +ERKKPG  GA
Sbjct:   80 EFNIGKRHLANMMGEDPETFAEEDIDRAIAYLFPSGLFEKRARPMMKHPEHIFPKQRATQWGEDGRPFHFLFYTGKQSYYSLMHD---VYGKVMQLEKHRGPL-SASAESRDLIGSRWLIKEELEEMLVEKLSDEDYAQFIRLLEKLLTLPCGPAEEEFVQRFRRSVTIQSKKQ-----LIEPVQYDEQGMAFSTSEGRRKSATAQAVVYEHGSGKIHVNGVDYLIYFPITQDREQLMFPFHFLDRLERHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEDEVEWMRQAGLLTPDPRIRERKKPGQEGA 381          
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|P34388|RT09_CAEEL (Probable 40S ribosomal protein S9, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mrps-9 PE=3 SV=2)

HSP 1 Score: 137.117 bits (344), Expect = 3.879e-35
Identity = 110/364 (30.22%), Postives = 171/364 (46.98%), Query Frame = 3
Query:  144 ITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMME--------AIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPE------TGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQ-----------------VKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKK---PGLRG 1133
            I  +++ YL   ++   MME  R +FE GRR+LAKMM  D    DQ  ID +I YLFPSGL +P ARPVM+ P EI P       D  G+P  + ++T  P  Y ++ +          +  E++ S   NR  L     EP  L  S+W++  +L     EK  ++ Y   +   + + + P ++  +KF+   R P+       ++L     PE      T R+Y E   + K + A V++   G GK  I+ L+L +    L  RE +L P+  + ++G+ D+ A                  ++  G S +  A+R   +  +A   PEA +  L ++GLLT D R  ER K   PG R 
Sbjct:   31 IGKALETYLKHSQQHVAMMEKHRAEFETGRRHLAKMMSLDIHELDQEAIDRAILYLFPSGLTDPNARPVMRPPDEILPKFQRFTFDEEGKPEGSRFFTLSPKIYGLLSDIGVKTHSVMKFYDEHVGSRSVNRSDL-----EPANLSGSQWVTADKLKKKLSEKFSKELYGQVIIAFEHLASLPGSAIEQKFLMEFREPMT--ASTGSKLFGPAIPEVHVCAVTNRRYAEVTTRCKDTRATVKVTDAGKGKFDIDGLQLHDFR-HLQAREILLAPMIVSQSLGRFDVTATTSCISNTLPEAPNKAPLMRSGGMSALPRAVRHGTALCVAALQPEA-IEPLRLSGLLTLDPRKNERSKVNQPGARA 385          
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|Q1AU64|RS9_RUBXD (30S ribosomal protein S9 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) OX=266117 GN=rpsI PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 9.832e-22
Identity = 53/114 (46.49%), Postives = 76/114 (66.67%), Query Frame = 3
Query:  795 GQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            G++K SVA VR+ +PGDG+I++N   + E  P +T++ A+  PL+  D  G+ D+VA+++G G +  A ALR  I+RALA   PEA    L+ AGLLT+D R  ERKK GL+ A
Sbjct:   10 GRRKTSVARVRV-LPGDGRITVNGRPVEEYFPRVTHQRAVRAPLELLDAAGRYDVVAKIEGGGPTGQAEALRHGIARALAEESPEAR-GELKAAGLLTRDARAVERKKYGLKKA 121          
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Match: A0A0X3PFM1 (28S ribosomal protein S9 (Fragment) OS=Schistocephalus solidus OX=70667 GN=RT09 PE=4 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 1.788e-94
Identity = 161/343 (46.94%), Postives = 224/343 (65.31%), Query Frame = 3
Query:  129 SKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRY--RLENVPGEPIQLL--NSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKG--EGTSCIAMALRLAISRALACFLP-EADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            SK   +T+SIK YL   +  E M+E ER ++E GR+YLA+MMG DP TFDQ+ IDE++RY FPS L    ARP +K P EIYP K  ++ D  GRPF+  YYT +PAFY +M +A  + E+L    D  Y  R  +    P QL+  +S+W+S ++L    +E V+   Y++W+NIM+A++ HP +  AE+FI + RV +     KE   E  +DP+  +K+++T+GQKK + AEVR++ PG GK ++N+ +LLE  P L NRE ++FPL+ T  +G VD+ A++     G+S  A ALRLAISRALACFLP +    RL  AGLLTQDDR  ERKKPG + A
Sbjct:   70 SKCDAMTSSIKFYLQNVQAYENMLEEERTKYERGRKYLARMMGQDPATFDQSHIDEAVRYFFPSALGSMRARPKLKPPEEIYPQKKKIQFDKTGRPFHDLYYTGKPAFYELMHKATCLYEDLNFKLDRGYIERDFSAFKNPKQLILASSEWLSQEKLGQKLLEPVKDNMYENWLNIMEALVKHPLSWHAEEFIMSYRVSVQADTTKEVFPEPQLDPDLNQKFVDTFGQKKHAFAEVRLFHPGTGKFTVNEKRLLEFFPELGNREQLMFPLQLTGMLGTVDVTAKIADTETGSSSKANALRLAISRALACFLPGDLGANRLRAAGLLTQDDRFSERKKPGQKKA 412          
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Match: A0A5J4NAB2 (Small subunit ribosomal protein S9 OS=Paragonimus westermani OX=34504 GN=DEA37_0002182 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 5.814e-92
Identity = 148/314 (47.13%), Postives = 206/314 (65.61%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQ------LLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEAD-VTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +FE GR+YLA++MG DPETF+Q+ IDESI+YLFPS LF P+ARP +K P E++P K  L+CD  GRP +  +YT  P F+ IM EA+Y LE LKS  D  +   +  G P++      L +++W +  QL D   E++   Q++ W+ +M+ I+ HP A  A+ FI   R+       +E   E  VDP T +++I++YGQK+ S AEV +++PG G++++N  +LLE  P L NRE I+FPL+ T T+GKVDI+A+V   GTS  A A+RLAISR LA  LPE +   RL VAGLLT D+R  ERK PG + A
Sbjct:   15 EFECGRKYLAQIMGEDPETFNQDKIDESIKYLFPSALFSPKARPKLKPPEEVFPKKKELQCDSTGRPLHDLFYTRHPNFFGIMHEAVYQLETLKSEHDRVHITRD--GNPLKVAVPLVLASTEWFTKAQLEDAISERITDDQFEQWLLLMERIVAHPLAHLAKSFIDRFRIGQTMAGIEEKYPEPEVDPLTKQRFIKSYGQKRHSFAEVTVFLPGSGQLTVNGKRLLEFFPHLGNREQIMFPLQLTRTLGKVDIIAKVTETGTSSPANAIRLAISRCLASLLPENEGKHRLRVAGLLTPDNRYAERKNPGQKKA 326          
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Match: A0A564Y1W6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2229 PE=4 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 2.329e-91
Identity = 156/352 (44.32%), Postives = 219/352 (62.22%), Query Frame = 3
Query:  105 NSDSTTKISKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPG----EPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGE---GTSCIAMALRLAISRALACFLP-EADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            NS   +  SK + IT SI+  L   +  E M+E ER ++E GR++LA++MG DP TF+Q  +DE+IRYLFPSGL    A P +K P E+YP K  L+ D  GRPF+  +YT +PA++ +M +   + E L  L D  Y   +         I + +S+W++ +QL    +E V    Y++W+ +M+ +LNHP A  AE FI++ RV + +    E   E  VDPET  ++I+T+GQKK + AE+RM  PG GK  +ND +LLE  P L +RE I+FPL++   +G VD+VA++  +   G S  A ALRLAI+RALACFLP +    RL  AGLLTQDDR  ERKKPG + A
Sbjct:   30 NSPLMSGESKSAAITASIEFCLQNYQSYENMLEEERAKYENGRKFLARLMGHDPATFNQEQVDEAIRYLFPSGLQSKNAHPKLKPPEEVYPEKKKLQFDRTGRPFHDLHYTGKPAYFEVMHKVSALFEELNHLFDRGYIDRDFTAFKNPRSIVVASSEWLTKEQLSRKLLEPVSDAMYENWLRVMNTLLNHPLAWHAENFINSYRVSVQETLSNEIYPEPQVDPETNYRFIDTFGQKKHAFAELRMTQPGTGKFIVNDKRLLEFFPHLGDREQIMFPLQYAGMLGMVDVVAKISSDTETGHSSKANALRLAIARALACFLPGDQGFNRLRAAGLLTQDDRFSERKKPGQKKA 381          
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Match: A0A5K3FJH0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.314e-90
Identity = 154/343 (44.90%), Postives = 215/343 (62.68%), Query Frame = 3
Query:  129 SKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPG----EPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKG--EGTSCIAMALRLAISRALACFLP-EADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            SK   I +SI+ YL   +  E M+E ER +++ G+++LA++MG DP +F Q  +DE+IRYLFPSGL    A P +K P E+YP K  L+ D  GRPF+  YYT RPA++ +M +A  +LE+L    D  Y   +        P+ L  S+W++  QL    +E +    Y+ W+ +M+A++NH  A  AE FI + R  +     KE   E  VDPET +++++TYGQKK +  E+RM  PG GK+ +ND +LLE  P L +RE I+FPL++T+ +G VDI+A+V     G S  A A+RLAISRALACFLP +    RL  AGLLTQDDR  ERKKPG + A
Sbjct:   39 SKSDGIASSIEFYLQNFQSYENMLEEERIKYKNGQKFLARLMGQDPSSFGQEQVDEAIRYLFPSGLKSRRAHPKLKPPEEVYPEKKKLQFDKTGRPFHDLYYTGRPAYFDVMHKASCLLEDLNYKFDRGYIDRDFTAFKNQRPLVLAASEWLTKDQLSRKLLESITDAMYEDWLRLMNALVNHQLAWHAENFIQSYRASVQAAATKEVFPEPQVDPETNQRFVDTYGQKKHAFVELRMLHPGVGKVIVNDKRLLECFPHLGDREQIMFPLQYTNMLGAVDIIAKVADTETGHSSKANAMRLAISRALACFLPGDLGCNRLRAAGLLTQDDRFSERKKPGQKKA 381          
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Match: A0A0R3SB84 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1703 PE=4 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 1.320e-89
Identity = 142/315 (45.08%), Postives = 200/315 (63.49%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPG----EPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGE---GTSCIAMALRLAISRALACFLP-EADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            ++E GR++LA++MG DP TF+Q  +DE+IRYLFPSGL    A P +K P E+YP K  L+ D  GRPF+  +YT +PA++ +M +   + E L  L D  Y   +         I + +S+W++ +QL    +E V    Y++W+ +M+ +LNHP A  AE FI++ RV + +    E   E  VDPET  ++I+T+GQKK + AE+RM  PG GK  +ND +LLE  P L +RE I+FPL++   +G VD+VA++  +   G S  A ALRLAI+RALACFLP +    RL  AGLLTQDDR  ERKKPG + A
Sbjct:    8 KYENGRKFLARLMGHDPATFNQEQVDEAIRYLFPSGLQSKNAHPKLKPPEEVYPEKKKLQFDRTGRPFHDLHYTGKPAYFEVMHKVSALFEELNHLFDRGYIDRDFTAFKNPRSIVVASSEWLTKEQLSRKLLEPVSDAMYENWLRVMNTLLNHPLAWHAENFINSYRVSVQETLSNEIYPEPQVDPETNYRFIDTFGQKKHAFAELRMTQPGTGKFIVNDKRLLEFFPHLGDREQIMFPLQYAGMLGMVDVVAKISSDTETGHSSKANALRLAIARALACFLPGDQGFNRLRAAGLLTQDDRFSERKKPGQKKA 322          
BLAST of 28S ribosomal protein S9 vs. Ensembl Cavefish
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:NCBI gene;Acc:103022208])

HSP 1 Score: 228.024 bits (580), Expect = 1.144e-70
Identity = 124/310 (40.00%), Postives = 180/310 (58.06%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLEN---VPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +F  G+R+LA MMG DPETF Q DID SI YLFPSGLFE  ARPVMK P  I+P +S ++   +GRPFN  +YT + A+YS+M E   +   + ++E  + RL N      + I L  S+WM  ++L D  +E +    Y  ++ +M+ ++  P +S  E+F+   R  +  +  K+  + AL   E G  + +  G++K + A + +     G I +N    L+  P L +RE ++FPL F   +G+ D+ A V+G G S  A ALRLAISRAL  F+   ++  +  AGLLT D R KERKKPG  GA
Sbjct:   70 EFSIGKRHLANMMGEDPETFTQEDIDRSIAYLFPSGLFEKRARPVMKHPDIIFPKQSAIQWGEDGRPFNFLFYTGKQAYYSLMHE---VFGKVLAIEKRQDRLRNEDTTDIKQISLTGSRWMLKEELEDLLVETMSDHDYSRFLQLMERLVALPYSSLEEEFVQRFRQQLGVQSSKQE-IPALQHDEKGVAFCQANGRRKTASASITLRDCRSGNIMVNGKSYLQYFPILQDREQLMFPLHFVGMLGRFDVEAHVEGGGRSAQAGALRLAISRALLSFVSSGEMETMRQAGLLTSDPRVKERKKPGQAGA 375          
BLAST of 28S ribosomal protein S9 vs. Ensembl Sea Lamprey
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-060825-257])

HSP 1 Score: 145.206 bits (365), Expect = 3.049e-41
Identity = 83/238 (34.87%), Postives = 137/238 (57.56%), Query Frame = 3
Query:  219 FEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEK-FISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLK 929
            +E GRR+LA MMG D E+F Q  ID++I YLFPSGLFE  ARP+MK P +I+P +  ++   +GRPF+  +YT +P +YS  ++ +Y        E+++ R + V      L +S+W++ ++L     E++    Y  +V + + I + P  +EA +  +S  RV +  + +++   E  VD E GR Y E  G +K + A+V ++  G GKI++N L  ++  P L +RE     +K
Sbjct:   12 YELGRRHLANMMGEDEESFTQEHIDKAIEYLFPSGLFEKRARPIMKHPEQIFPKQKVIQWGEDGRPFHYLFYTGKPNYYS--LQDLYSQLLQVEAEEDKMRSKAVRRA---LPSSRWVTQEELEQSLNEQLSEHDYARFVRLGERIASQPFPTEAAREQLSRFRVALQVQSQQQEIPERRVD-EEGRAYSEANGFRKKARAKVTLWESGSGKITVNGLGHVDYFPQLQDREVGTMTIK 243          
BLAST of 28S ribosomal protein S9 vs. Ensembl Sea Lamprey
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-060825-257])

HSP 1 Score: 138.272 bits (347), Expect = 8.945e-38
Identity = 100/316 (31.65%), Postives = 160/316 (50.63%), Query Frame = 3
Query:  219 FEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYP-LKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALV------DPETGRKYIETYGQKK-WSVAEVRMYMPGDGKISINDLKLLEVVPALTNRE--AILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            +E GRR+LA MMG D E+F Q  ID++I YLFPSGLFE  ARP+MK   +I P +K  ++   +GRPF+  +YT +P +YS  ++ +Y        E+++ R + V      L +S+W++ ++L     E++   ++D  V     +   PC   ++  +  +   I+  +     L   +       P   R+ +  +      S     ++ P   + S   L +    P L+ R    ++FPL+F   +G  D   +V G G+S  A A+R A++ AL  FL    +  +  AGLLT+D R KERKKPG  GA
Sbjct:   12 YELGRRHLANMMGEDEESFTQEHIDKAIEYLFPSGLFEKRARPIMKVLEQIIPAMKIVIQWGEDGRPFHYLFYTGKPNYYS--LQDLYSQLLQVEAEEDKMRSKAVRRA---LPSSRWVTQEELEQSLNEQL--SEHDVRVPTPPPLALSPCIVGSQSLLLALSPCIVGSQSLPLALSPCIVGSQSLPPLRSRRALWVHSPSPLLSRRAFWVHSPSPLR-SRRALWVHSPSPLLSRRALMQLMFPLQFAGRLGAHDAECEVSGVGSSAQAGAVRHALALALTTFLEPHLIEGMRRAGLLTKDQRTKERKKPGQEGA 319          
BLAST of 28S ribosomal protein S9 vs. Ensembl Yeast
Match: MRPS9 (Mitochondrial ribosomal protein of the small subunit [Source:SGD;Acc:S000000350])

HSP 1 Score: 65.4698 bits (158), Expect = 1.581e-12
Identity = 39/106 (36.79%), Postives = 64/106 (60.38%), Query Frame = 3
Query:  795 GQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKER 1112
            G++K S A+V   + G G+I +N  +L +    + +RE+I++PL+  ++VGK +I A   G G +  A ++  AI++AL  F P    +RL  AG+LT+D R  ER
Sbjct:  158 GKRKSSTAKV-FVVRGTGEILVNGRQLNDYFLKMKDRESIMYPLQVIESVGKYNIFATTSGGGPTGQAESIMHAIAKALVVFNPLLK-SRLHKAGVLTRDYRHVER 261          
BLAST of 28S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO26045 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD13])

HSP 1 Score: 62.7734 bits (151), Expect = 3.660e-12
Identity = 47/119 (39.50%), Postives = 60/119 (50.42%), Query Frame = 3
Query:  780 YIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            Y    G++K SVA V +   G GKI +ND    E     TN   +  PL  T+ +   DI   V G G S  A A++  I+RAL  F  +   T L  AG +T+D R  ERKK GLR A
Sbjct:    5 YYYGTGRRKSSVARVXL-AKGSGKIIVNDRDFEEYFSRPTNCMIVRQPLTLTEHLDSFDIKVNVHGGGESGQAGAIKHGITRALIDFNADLKPT-LSKAGFVTRDAREVERKKCGLRKA 121          
BLAST of 28S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO44358 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVY6])

HSP 1 Score: 58.9214 bits (141), Expect = 6.846e-10
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIY 374
            ++E  RR+LA +MG DPE F++ DI  +I YL P+ L+  +ARP++  P++++
Sbjct:    4 RYELCRRWLASIMGEDPENFNEKDIQRAIEYLMPTALYAKDARPLLLHPNKLF 56          
BLAST of 28S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO32285 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVI4])

HSP 1 Score: 58.5362 bits (140), Expect = 1.998e-9
Identity = 22/53 (41.51%), Postives = 38/53 (71.70%), Query Frame = 3
Query:  216 QFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIY 374
            ++E  RR+LA +MG DPE F++ DI  +I YL P+ L+  +ARP++  P++++
Sbjct:  233 RYELCRRWLASIMGEDPENFNEKDIQRAIEYLMPTALYAKDARPLLLHPNKLF 285          

HSP 2 Score: 50.0618 bits (118), Expect = 1.105e-6
Identity = 22/55 (40.00%), Postives = 34/55 (61.82%), Query Frame = 3
Query:  228 GRRY------LAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIY 374
            GRRY      L + MG DPE F+  DI  +I YL P+ L+  +ARP++  P++++
Sbjct:  109 GRRYELVAGGLLQFMGEDPENFNGKDIQRAIEYLMPTALYAKDARPLLLHPNKLF 163          
BLAST of 28S ribosomal protein S9 vs. Ensembl Medaka
Match: mrps9 (mitochondrial ribosomal protein S9 [Source:NCBI gene;Acc:101154927])

HSP 1 Score: 222.631 bits (566), Expect = 4.655e-68
Identity = 126/351 (35.90%), Postives = 199/351 (56.70%), Query Frame = 3
Query:   93 TLCRNSDSTTKISKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYR---LENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
             LCRN    + + + ++     + + A+  +K+        +F  G+R+LA +MG DPE F Q DID SI YLFPSGLFE +ARP+MK P EI+P++  ++   + RPF+  +YT + ++YS+M E    + N++  +D R R   L +  G  I L  S+W++ ++L    +E +    Y+ ++ IM+ +L+ P  +  E+F+   R  ++  + +   + AL   E G  +    G +K S + V +   G G++S+N    L   P L +RE ++FPL+FT T+G+ D+   V G G S  A ALRLA+SRAL  FL  ++   +  AGLLT D R +ERKKPG  GA
Sbjct:   78 VLCRNISQNSALCRKNLAAAGPEKFTAEFIQKQIE------EFNIGKRHLANIMGEDPENFSQEDIDRSIAYLFPSGLFEKKARPLMKHPDEIFPMQRAVQWGEDRRPFHFLFYTGKQSYYSLMHELYGRMMNIEKHQD-RLRSKGLFSKDGHKISLGMSRWLTKEELEALLVENISTHDYNRFIQIMERLLSMPYCNIEEEFVLRFR-HLLQTQSRHQMVSALQKDENGVAFSSAEGCRKTSHSTVVLRDCGSGRLSVNGQDSLLYFPVLQDREQLMFPLQFTGTLGRFDLECTVSGGGRSSQAGALRLAVSRALLSFLSPSEGEMMRQAGLLTPDPRVRERKKPGQEGA 420          
BLAST of 28S ribosomal protein S9 vs. Planmine SMEST
Match: SMESG000018935.1 (SMESG000018935.1)

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 365/367 (99.46%), Postives = 365/367 (99.46%), Query Frame = 3
Query:   36 MMSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            MMSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAKCREKEKMMENERKQFEFGRRYLAKMMG DPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECD NGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA
Sbjct:    1 MMSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAKCREKEKMMENERKQFEFGRRYLAKMMGCDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDSNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 367          
BLAST of 28S ribosomal protein S9 vs. Planmine SMEST
Match: SMESG000018935.1 (SMESG000018935.1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 364/366 (99.45%), Postives = 364/366 (99.45%), Query Frame = 3
Query:   39 MSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAXXXXXXXXXXXXXXQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 1136
            MSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAKCREKEKMMENERKQFEFGRRYLAKMMG DPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECD NGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA
Sbjct:    1 MSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAKCREKEKMMENERKQFEFGRRYLAKMMGCDPETFDQNDIDESIRYLFPSGLFEPEARPVMKDPSEIYPLKSPLECDSNGRPFNTFYYTARPAFYSIMMEAIYILENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSWVNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYIETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFTDTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLLTQDDRCKERKKPGLRGA 366          
The following BLAST results are available for this feature:
BLAST of 28S ribosomal protein S9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPS98.042e-6936.42mitochondrial ribosomal protein S9 [Source:HGNC Sy... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps-93.050e-3630.22Probable 40S ribosomal protein S9, mitochondrial ... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mRpS95.923e-6636.83gene:FBgn0037529 transcript:FBtr0081766[more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps93.366e-6938.31mitochondrial ribosomal protein S9 [Source:ZFIN;Ac... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zeb21.606e-6737.26zinc finger E-box binding homeobox 2 [Source:Xenba... [more]
zeb23.938e-6737.26zinc finger E-box binding homeobox 2 [Source:Xenba... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mrps93.088e-6736.98mitochondrial ribosomal protein S9 [Source:MGI Sym... [more]
Mrps94.386e-723.48mitochondrial ribosomal protein S9 [Source:MGI Sym... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58DQ5|RT09_BOVIN2.591e-7039.0328S ribosomal protein S9, mitochondrial OS=Bos tau... [more]
sp|P82933|RT09_HUMAN3.862e-6836.4228S ribosomal protein S9, mitochondrial OS=Homo sa... [more]
sp|Q9D7N3|RT09_MOUSE2.160e-6636.9828S ribosomal protein S9, mitochondrial OS=Mus mus... [more]
sp|P34388|RT09_CAEEL3.879e-3530.22Probable 40S ribosomal protein S9, mitochondrial O... [more]
sp|Q1AU64|RS9_RUBXD9.832e-2246.4930S ribosomal protein S9 OS=Rubrobacter xylanophil... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PFM11.788e-9446.9428S ribosomal protein S9 (Fragment) OS=Schistoceph... [more]
A0A5J4NAB25.814e-9247.13Small subunit ribosomal protein S9 OS=Paragonimus ... [more]
A0A564Y1W62.329e-9144.32Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A5K3FJH04.314e-9044.90Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3SB841.320e-8945.08Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps91.144e-7040.00mitochondrial ribosomal protein S9 [Source:NCBI ge... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mrps93.049e-4134.87mitochondrial ribosomal protein S9 [Source:ZFIN;Ac... [more]
mrps98.945e-3831.65mitochondrial ribosomal protein S9 [Source:ZFIN;Ac... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
MRPS91.581e-1236.79Mitochondrial ribosomal protein of the small subun... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO260453.660e-1239.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443586.846e-1041.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322851.998e-941.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrps94.655e-6835.90mitochondrial ribosomal protein S9 [Source:NCBI ge... [more]
back to top
BLAST of 28S ribosomal protein S9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000018935.10.000e+099.46SMESG000018935.1[more]
SMESG000018935.10.000e+099.45SMESG000018935.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033211 ID=SMED30033211|Name=28S ribosomal protein S9|organism=Schmidtea mediterranea sexual|type=transcript|length=1229bp
TCTATATAAATCTTATATGATTTAGCATTTGTTCTATGATGAGCGTATTG
AGGCATTTTTATAAGAATCGATCCCTGATTTTTATCGAAAGAACATTATG
CAGAAACTCAGATTCAACAACTAAAATATCAAAAGGATCAATGATTACAA
CTTCGATTAAATTATATTTAGCTAAATGTCGTGAAAAAGAAAAAATGATG
GAAAATGAAAGAAAACAATTTGAATTTGGTCGTCGATATTTAGCTAAAAT
GATGGGTGGTGATCCAGAAACATTTGATCAGAATGACATTGATGAATCTA
TTAGATATTTATTTCCAAGTGGTCTTTTTGAACCAGAAGCGCGGCCAGTT
ATGAAAGATCCCAGTGAAATTTATCCATTGAAAAGTCCTCTGGAATGCGA
TGGTAATGGAAGACCTTTTAATACTTTTTACTACACCGCCAGACCGGCAT
TTTATTCAATTATGATGGAAGCGATATATATTCTGGAGAATTTGAAATCA
TTAGAGGACAATCGCTATAGGCTTGAAAATGTTCCAGGAGAACCTATACA
GCTATTGAATAGTAAATGGATGAGCCATAAACAATTGATTGATCATTGTA
TGGAAAAAGTTCAACGTCAACAATATGACAGCTGGGTTAATATTATGGAT
GCTATTCTAAATCACCCTTGTGCTAGTGAAGCTGAAAAATTTATTTCGAC
TATGAGAGTGCCAATAATAGATAAAAAAAAGAAAGAAAATCGATTGGAAG
CTCTAGTAGACCCTGAAACAGGAAGGAAATATATCGAAACATATGGACAG
AAAAAGTGGTCAGTAGCCGAGGTGCGAATGTACATGCCGGGTGATGGCAA
AATCTCAATCAATGATTTAAAGCTCCTAGAAGTTGTTCCAGCTCTTACGA
ATCGGGAAGCAATTTTATTCCCGTTAAAATTCACCGATACCGTTGGTAAA
GTGGACATAGTGGCACAGGTAAAAGGCGAAGGAACATCTTGCATAGCTAT
GGCACTCAGATTGGCAATTTCGAGAGCTCTGGCTTGCTTTCTACCGGAAG
CGGATGTTACCAGACTGGAAGTTGCGGGATTGTTGACTCAGGATGATCGC
TGTAAAGAGAGAAAGAAGCCCGGTTTAAGAGGAGCAAGAAAACGCCCCAT
TTGGCGAAAGCGATAACGGAAAATCGGGATTGTATTGTAATAAAAATGAG
ATTGTGTTTATTTATAATTTTCAACTTGA
back to top

protein sequence of SMED30033211-orf-1

>SMED30033211-orf-1 ID=SMED30033211-orf-1|Name=SMED30033211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=377bp
MMSVLRHFYKNRSLIFIERTLCRNSDSTTKISKGSMITTSIKLYLAKCRE
KEKMMENERKQFEFGRRYLAKMMGGDPETFDQNDIDESIRYLFPSGLFEP
EARPVMKDPSEIYPLKSPLECDGNGRPFNTFYYTARPAFYSIMMEAIYIL
ENLKSLEDNRYRLENVPGEPIQLLNSKWMSHKQLIDHCMEKVQRQQYDSW
VNIMDAILNHPCASEAEKFISTMRVPIIDKKKKENRLEALVDPETGRKYI
ETYGQKKWSVAEVRMYMPGDGKISINDLKLLEVVPALTNREAILFPLKFT
DTVGKVDIVAQVKGEGTSCIAMALRLAISRALACFLPEADVTRLEVAGLL
TQDDRCKERKKPGLRGARKRPIWRKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000754Ribosomal_S9
IPR014721Ribosomal_S5_D2-typ_fold_subgr
IPR020568Ribosomal_S5_D2-typ_fold
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 46..66
NoneNo IPR availablePANTHERPTHR21569:SF128S RIBOSOMAL PROTEIN S9, MITOCHONDRIALcoord: 49..381
IPR014721Ribosomal protein S5 domain 2-type fold, subgroupGENE3DG3DSA:3.30.230.10coord: 253..381
e-value: 4.7E-36
score: 125.8
IPR000754Ribosomal protein S9PFAMPF00380Ribosomal_S9coord: 259..381
e-value: 9.1E-31
score: 106.9
IPR000754Ribosomal protein S9PANTHERPTHR21569RIBOSOMAL PROTEIN S9coord: 49..381
IPR020568Ribosomal protein S5 domain 2-type foldSUPERFAMILYSSF54211Ribosomal protein S5 domain 2-likecoord: 254..381