GCR027

Overview
NameGCR027
Smed IDSMED30033206
Length (bp)1765
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR027 (SMED30033206) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR027 (SMED30033206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR027 (SMED30033206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR027 (SMED30033206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30033206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30033206SMESG000000740.1 SmedASXL_007491SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30033206SMESG000000740.1 dd_Smed_v6_24518_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR027 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 137.887 bits (346), Expect = 1.102e-34
Identity = 123/473 (26.00%), Postives = 207/473 (43.76%), Query Frame = 2
Query:  161 YNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQR-SFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            YN+    L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L      E      C   N  F++ ++IV+F++P I+  + Y+    +L  +RK       S A     F+  L + L      P    M    +  K+  S  ++RR +     V       +E E       +P   + TR + +  +   L   D     L         P++    ++  K          +  + E         R S K  ++ K  +                   + +KA Q L I+  +F+IC+LPFF+ ++++     C++        T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   34 YNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPL-LFGLNNADQNE------CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRA-----FRAHLRAPLKGNCTHPED--MKLCTVIMKSNGSFPVNRRRV-----VQEAARRAQELEMEMLSSTSP--PERTRYSPIPPSHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPK----------IAKIFEIQTMPNGKTRTSLKTMSRRKLSQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD-CNIPPVLYSAFT---WLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 445          
BLAST of GCR027 vs. Ensembl Human
Match: HTR2A (5-hydroxytryptamine receptor 2A [Source:HGNC Symbol;Acc:HGNC:5293])

HSP 1 Score: 131.339 bits (329), Expect = 3.411e-32
Identity = 85/237 (35.86%), Postives = 137/237 (57.81%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKT--REHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            NW+ +   ++ +L++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++  Y    +  + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+   ++++  W I   I+ P+ +F L+ D    +E S    C   +  F+LI + V+FFIPL IM +TY LT+K L     + EA L    V+ L  + KL+S    F+  P + + SEK
Sbjct:   75 NWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWP-LPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIH-HSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGS----CLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSL-----QKEATL---CVSDLGTRAKLAS----FSFLPQSSLSSEK 293          

HSP 2 Score: 65.0846 bits (157), Expect = 1.896e-10
Identity = 35/122 (28.69%), Postives = 60/122 (49.18%), Query Frame = 2
Query: 1193 PLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            P + LS ++ F+ S   +   Y+          + ++ I+  +KA + LGI+F LFV+ + PFF+  ++    K          +L    W+GY  S  NP+VY  FN  +R  + R ++CQ
Sbjct:  285 PQSSLSSEKLFQRSIHREPGSYTG--------RRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQ 398          
BLAST of GCR027 vs. Ensembl Human
Match: HTR2A (5-hydroxytryptamine receptor 2A [Source:HGNC Symbol;Acc:HGNC:5293])

HSP 1 Score: 131.339 bits (329), Expect = 3.411e-32
Identity = 85/237 (35.86%), Postives = 137/237 (57.81%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKT--REHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            NW+ +   ++ +L++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++  Y    +  + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+   ++++  W I   I+ P+ +F L+ D    +E S    C   +  F+LI + V+FFIPL IM +TY LT+K L     + EA L    V+ L  + KL+S    F+  P + + SEK
Sbjct:   75 NWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWP-LPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIH-HSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGS----CLLADDNFVLIGSFVSFFIPLTIMVITYFLTIKSL-----QKEATL---CVSDLGTRAKLAS----FSFLPQSSLSSEK 293          

HSP 2 Score: 65.0846 bits (157), Expect = 1.896e-10
Identity = 35/122 (28.69%), Postives = 60/122 (49.18%), Query Frame = 2
Query: 1193 PLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            P + LS ++ F+ S   +   Y+          + ++ I+  +KA + LGI+F LFV+ + PFF+  ++    K          +L    W+GY  S  NP+VY  FN  +R  + R ++CQ
Sbjct:  285 PQSSLSSEKLFQRSIHREPGSYTG--------RRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQ 398          
BLAST of GCR027 vs. Ensembl Human
Match: ADRA2B (adrenoceptor alpha 2B [Source:HGNC Symbol;Acc:HGNC:282])

HSP 1 Score: 128.642 bits (322), Expect = 1.880e-31
Identity = 106/466 (22.75%), Postives = 192/466 (41.20%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCG-PQNAYFILIATIVTFFIPLIIMTVTYVLTVKIL-YVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENT------------SMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAY-LVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            + +++GN+LV ++V     LR   N FLVSLA +D L A L++P S    +  Y+       WC ++ +LDV F  S+I+HLC IS+DRY A+   L+ + ++  R +   ++  W+I   I+ P  ++  + D+  +      C   Q A++IL ++I +FF P +IM + Y+    I     R+   A        S   +P    +LA         V S +++NG ++++               +L   +    N    +   +   +  +   E              ++ +  +    P LQ+ Q  + L     + R Q               +L   +  +  Q   + +  T+   ++                         L ++  +FV+C+ PFF +Y L     K C V      +  F  W+GY  S  NP++Y  FN  FR  ++R++
Sbjct:   24 LFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWY--FRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIY--KGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEEEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVL----ATLRGQ--------------VLLGRGVGAIGGQWWRRRAQLTREKRFTF-----------------------VLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVP---HGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRIL 441          
BLAST of GCR027 vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 123.635 bits (309), Expect = 1.450e-29
Identity = 109/463 (23.54%), Postives = 194/463 (41.90%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQ-----NAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETE-NHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            +L+++GN LV I+V+    L+   N FLVSLA +D L A LV+P S    +  Y+       WC I+ +LDV F  S+I+HLC IS+DRY ++   ++ + ++  R +   ++  W+I   I+ P     + ++K       +   P+       ++++ + I +FF P +IM + YV   +I   + +   +    +AVA                   +    +E++ NG     SA               ++E   T+ N    E  P   + T    +E +S     SD+ +      + ++    +  +   Q K  +   +     T +  P A    +R        K   +                 NR ++    L ++  +FV+C+ PFF  Y +      CSV  T   +  F  W GY  S  NP++Y  FN  FR  +++++ C+  R
Sbjct:   60 LLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWY--FGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPL---ISIEKKGGGGGPQPAEPRCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDAVA-------------------APPGGTERRPNGLGPERSAGP----------GGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSS----SDHAERPPGPRRPERGPRGKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEER----VGAAKASRWRGRQ-------------NREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVG--CSVPRT---LFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFKKIL-CRGDR 461          
BLAST of GCR027 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 147.132 bits (370), Expect = 2.426e-37
Identity = 117/476 (24.58%), Postives = 216/476 (45.38%), Query Frame = 2
Query:  161 YNWAYVGLFIIPML---SMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRR---SISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLP-FFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCY 1564
            Y++  V LF++P+L    + GN LVC+++  +  L    NYFL SLA++D L   +VMP+S    +  + + T +   CL++   DVF  +++I+H+  IS+DRY  +  PL+   + R ++L+ +++   W++   ++CP+ + A+    T        C   + Y+I+  + +TF IPL IM VTY  T ++L             N  AS++ +                   +  K NG     +  HR+   + + S  VN   +  K    H           ++ +N     + +  G+   +PS+  + +KQ           Q+ +  + WKS T   ++ N    +  + S + + +   +E+                     KA + L ++F  F IC+ P FF+ +L+ F  +   +    + + +   W+GY  S  NPI+Y  FN  FR  + R+++CQC+
Sbjct:    4 YHFNGVALFLLPVLCLIGLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIVVEV-RHGVWTWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLRT--RNRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH--DTANILRNNQCMIFSRYYIIYGSTMTFLIPLCIMGVTYAKTTQLL-------------NKQASILSQ------------------KAGDKFNGNGLRRTMPHRKLGYARTYSATVNGTIANGKAIGAHGR-------TMSSISNIANGETADRLGTS--RPSINTNGHKQL----------QKASTINKWKSRT-SNLVTNFANKVGRRSSLQTATQDLANEH---------------------KATRVLAVVFACFFICWTPFFFINFLIGFGGENVQI---PDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCF 399          
BLAST of GCR027 vs. Ensembl Celegans
Match: ser-1 (SERotonin/octopamine receptor family; Serotonin receptor [Source:UniProtKB/TrEMBL;Acc:O17470])

HSP 1 Score: 147.132 bits (370), Expect = 3.509e-37
Identity = 117/476 (24.58%), Postives = 216/476 (45.38%), Query Frame = 2
Query:  161 YNWAYVGLFIIPML---SMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRR---SISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLP-FFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCY 1564
            Y++  V LF++P+L    + GN LVC+++  +  L    NYFL SLA++D L   +VMP+S    +  + + T +   CL++   DVF  +++I+H+  IS+DRY  +  PL+   + R ++L+ +++   W++   ++CP+ + A+    T        C   + Y+I+  + +TF IPL IM VTY  T ++L             N  AS++ +                   +  K NG     +  HR+   + + S  VN   +  K    H           ++ +N     + +  G+   +PS+  + +KQ           Q+ +  + WKS T   ++ N    +  + S + + +   +E+                     KA + L ++F  F IC+ P FF+ +L+ F  +   +    + + +   W+GY  S  NPI+Y  FN  FR  + R+++CQC+
Sbjct:   52 YHFNGVALFLLPVLCLIGLIGNFLVCVAIATDRRLHNVTNYFLFSLALADLLVCCIVMPLSIVVEV-RHGVWTWSVSMCLLYVYSDVFLCSASIVHMSVISLDRYLGISQPLRT--RNRSKTLIFIKIAIVWVVTLLVSCPIAVLAMH--DTANILRNNQCMIFSRYYIIYGSTMTFLIPLCIMGVTYAKTTQLL-------------NKQASILSQ------------------KAGDKFNGNGLRRTMPHRKLGYARTYSATVNGTIANGKAIGAHGR-------TMSSISNIANGETADRLGTS--RPSINTNGHKQL----------QKASTINKWKSRT-SNLVTNFANKVGRRSSLQTATQDLANEH---------------------KATRVLAVVFACFFICWTPFFFINFLIGFGGENVQI---PDWVASIFLWLGYVSSTINPIIYTVFNKRFRQAFVRILRCQCF 447          
BLAST of GCR027 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 140.584 bits (353), Expect = 2.341e-35
Identity = 129/496 (26.01%), Postives = 227/496 (45.77%), Query Frame = 2
Query:  173 YVGLFIIPM--LSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCA-WIIPFSIACPLF------LFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTR-------TPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVE-----NTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXIN-----RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLT-FLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQC 1561
            ++ LF++ +  L+++GN LV +SV V   +R   N  L SLA +D L  ++VMP+S   ++ N       H+W      C +W + DV    ++I++LC IS+DRY A+ +PLK + + R R +   L+ A W I F +  P +      LF    + T     FK     +  + + + + +F++PL++M   Y    KI  V   E EA L   +V +     +L+ +  K  R        P ++   +   N    N S    R +  +   N +++  K +  H  F+ T         + +E     N SM+L    N  P+  + + K ++ +   S  +   + +   + NT   V  + L+  + Q + ++       +    Y      +            R RKA++T+GI+ L F+IC++PFF+ YLV+ F       S   ++ + F  W+GYS S+ NPI+Y  +N  FR  ++ L+   C
Sbjct:   73 FIALFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHN-------HRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLK-YPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVY---FKIFRVA-SEREA-LMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSV---RPVEYA---NRVENSLKPS--HERFDSTDCEDSPPNGDSLEAGTTCNISMSLV--TNSPPNGLQKEAKNSMERECHSLADIVNSADTPVRKNTEVGVAPS-LSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 544          
BLAST of GCR027 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 139.043 bits (349), Expect = 3.022e-35
Identity = 127/486 (26.13%), Postives = 221/486 (45.47%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCA-WIIPFSIACPLF------LFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTR-------TPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVE-----NTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXIN-----RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLT-FLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQC 1561
            +L+++GN LV +SV V   +R   N  L SLA +D L  ++VMP+S   ++ N       H+W      C +W + DV    ++I++LC IS+DRY A+ +PLK + + R R +   L+ A W I F +  P +      LF    + T     FK     +  + + + + +F++PL++M   Y    KI  V   E EA L   +V +     +L+ +  K  R        P ++   +   N    N S    R +  +   N +++  K +  H  F+ T         + +E     N SM+L    N  P+  + + K ++ +   S  +   + +   + NT   V  + L+  + Q + ++       +    Y      +            R RKA++T+GI+ L F+IC++PFF+ YLV+ F       S   ++ + F  W+GYS S+ NPI+Y  +N  FR  ++ L+   C
Sbjct:    4 LLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHN-------HRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLK-YPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVY---FKIFRVA-SEREA-LMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSV---RPVEYA---NRVENSLKPS--HERFDSTDCEDSPPNGDSLEAGTTCNISMSLV--TNSPPNGLQKEAKNSMERECHSLADIVNSADTPVRKNTEVGVAPS-LSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 465          
BLAST of GCR027 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 140.198 bits (352), Expect = 3.982e-35
Identity = 129/496 (26.01%), Postives = 227/496 (45.77%), Query Frame = 2
Query:  173 YVGLFIIPM--LSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCA-WIIPFSIACPLF------LFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTR-------TPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVE-----NTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXIN-----RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLT-FLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQC 1561
            ++ LF++ +  L+++GN LV +SV V   +R   N  L SLA +D L  ++VMP+S   ++ N       H+W      C +W + DV    ++I++LC IS+DRY A+ +PLK + + R R +   L+ A W I F +  P +      LF    + T     FK     +  + + + + +F++PL++M   Y    KI  V   E EA L   +V +     +L+ +  K  R        P ++   +   N    N S    R +  +   N +++  K +  H  F+ T         + +E     N SM+L    N  P+  + + K ++ +   S  +   + +   + NT   V  + L+  + Q + ++       +    Y      +            R RKA++T+GI+ L F+IC++PFF+ YLV+ F       S   ++ + F  W+GYS S+ NPI+Y  +N  FR  ++ L+   C
Sbjct:  101 FIALFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHN-------HRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLK-YPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVY---FKIFRVA-SEREA-LMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSV---RPVEYA---NRVENSLKPS--HERFDSTDCEDSPPNGDSLEAGTTCNISMSLV--TNSPPNGLQKEAKNSMERECHSLADIVNSADTPVRKNTEVGVAPS-LSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 572          
BLAST of GCR027 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343171)

HSP 1 Score: 145.591 bits (366), Expect = 2.853e-36
Identity = 133/477 (27.88%), Postives = 216/477 (45.28%), Query Frame = 2
Query:  167 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLS--SSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHN----HFEMTPLLAKTTRNNFVENTSMNLCGSDNLKP------SLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDF----FFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            WA + L + P+L+++GN LV +SV  E  L+   NYF+VSLA++D L A++VMP + + +++  +   +    C  + ++DV  + S+I +L  ISIDRY A+  P+K    K  R + + ++  W I  +I  P+ L  L     RE      C   NA FIL +++ +F+IP IIM   Y    K L  + ++  A            KP LS  +  +       T+ ++E  L+      S+ H   I       +  S   E E+ N      +   ++       F+  T +   G+  +KP       +QE     TL +   +     KT +   K N+  +         +  +  K S K K ++ SA                + RKA +TL I+  +F+ C+LPFF   ++D     F K C    TA  M T   W+GY  S  NP++Y  FNP FR  ++++M
Sbjct:  378 WALI-LILFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVNGAW--ALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVL-GLNNTPNREPDV---CAFYNADFILYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRA----------ARKPHLSELTGGSVIENIAQTRRLAETALD------SSRHASRILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNVAMKPLSFVRYGVQE---AMTLARNDSTLSTTSKTSSRKDKKNSQAS-------RFTIYKVHKASKK-KREKSSA---------------KKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMMTT---WLGYINSFVNPVIYTIFNPEFRKAFKKIM 802          
BLAST of GCR027 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0303603)

HSP 1 Score: 132.494 bits (332), Expect = 5.806e-32
Identity = 80/257 (31.13%), Postives = 134/257 (52.14%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSF---KGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENH 973
            GN LVC+++  E  L+   NYFL+SLA++D + A+LVMP+    ++  Y+   +  + CL W  LDV F  ++I+HLCTIS+DRY +L+ P++    K  R + +++V  W++  +++ PL L       ++ H+S      C   +  + L+ +IV F+IPL +M +TY LTV++L  QR+       + A         L  + A   R    +++      G    SS +H  S       NS D++    +NH
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYF--PLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSLM-----YSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGGGQQTAAATPGWASGWLGQAPALERRCTWRRLLKP----GPGNASSVLHAHS------ANSTDTDLSTLDNH 329          

HSP 2 Score: 62.003 bits (149), Expect = 1.322e-9
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            I   +KA + LG++F  FVI + PFFV  L+      C     +  +   + W+GY+ SM NPI Y  FN +FR  +++++ C+
Sbjct:  811 IRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECE-ERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of GCR027 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0339322)

HSP 1 Score: 132.494 bits (332), Expect = 5.806e-32
Identity = 80/257 (31.13%), Postives = 134/257 (52.14%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSF---KGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENH 973
            GN LVC+++  E  L+   NYFL+SLA++D + A+LVMP+    ++  Y+   +  + CL W  LDV F  ++I+HLCTIS+DRY +L+ P++    K  R + +++V  W++  +++ PL L       ++ H+S      C   +  + L+ +IV F+IPL +M +TY LTV++L  QR+       + A         L  + A   R    +++      G    SS +H  S       NS D++    +NH
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYF--PLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSLM-----YSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGGGQQTAAATPGWASGWLGQAPALERRCTWRRLLKP----GPGNASSVLHAHS------ANSTDTDLSTLDNH 329          

HSP 2 Score: 62.003 bits (149), Expect = 1.322e-9
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            I   +KA + LG++F  FVI + PFFV  L+      C     +  +   + W+GY+ SM NPI Y  FN +FR  +++++ C+
Sbjct:  811 IRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECE-ERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of GCR027 vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0330144)

HSP 1 Score: 132.109 bits (331), Expect = 7.072e-32
Identity = 80/257 (31.13%), Postives = 134/257 (52.14%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSF---KGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENH 973
            GN LVC+++  E  L+   NYFL+SLA++D + A+LVMP+    ++  Y+   +  + CL W  LDV F  ++I+HLCTIS+DRY +L+ P++    K  R + +++V  W++  +++ PL L       ++ H+S      C   +  + L+ +IV F+IPL +M +TY LTV++L  QR+       + A         L  + A   R    +++      G    SS +H  S       NS D++    +NH
Sbjct:   90 GNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKGYF--PLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSLM-----YSKNHASVLVNGTCQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQRQNLGGGQQTAAATPGWASGWLGQAPALERRCTWRRLLKP----GPGNASSVLHAHS------ANSTDTDLSTLDNH 329          

HSP 2 Score: 62.003 bits (149), Expect = 1.332e-9
Identity = 29/84 (34.52%), Postives = 47/84 (55.95%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            I   +KA + LG++F  FVI + PFFV  L+      C     +  +   + W+GY+ SM NPI Y  FN +FR  +++++ C+
Sbjct:  811 IRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECE-ERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of GCR027 vs. Ensembl Fly
Match: 5-HT1B (gene:FBgn0263116 transcript:FBtr0330055)

HSP 1 Score: 110.538 bits (275), Expect = 2.874e-25
Identity = 118/492 (23.98%), Postives = 202/492 (41.06%), Query Frame = 2
Query:  176 VGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIA-CPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTY--VLTVKILYVQRKEAEA---NLYSNAVASLVFKPKLSSS--------LAKFTRTPSTKVMSEKKLN-----------GKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGS-DNLKPSLQEDQYKQTLPQRQVSFREQQ--------KTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            +GL I  ++++ GN  V  ++ +E  L+   NY + SLA++D   A LVMP+ A   I N ++  +  + C IW S DV    ++I+HL  I+ DRY  + N +  +  +  R + + + C W     ++  P F +  + D  +          Q+  + + AT  TF++PL+++   Y  +  +    +QR+  ++    L      S V + K   S        L    RTP     +  +L            G+N N++ ++R S +   +  +L  +      H H   + L A T      ++ +M   G      PS +      T+                   + KN       V   + NP   L+ +R    + + +                         KA QTL I+   FVIC+LPFFV  L     K C + +    +  FL W+GY  S  NP++Y  FNP FR  ++R++
Sbjct:   97 LGLMI--LVTIIGNVFVIAAIILERNLQNVANYLVASLAVADLFVACLVMPLGAVYEISNGWI--LGPELCDIWTSCDVLCCTASILHLVAIAADRYWTVTN-IDYNNLRTPRRVFLMIFCVWFAALIVSLAPQFGWK-DPDYMKRIEEQHCMVSQDVGYQIFATCCTFYVPLLVILFLYWKIYIIARKRIQRRAQKSFNVTLTETDCDSAVRELKKERSKRRAERKRLEAGERTPVDGDGTGGQLQRRTRKRMRICFGRNTNTANVYRTSNANEII--TLSQQVAHATQH-HLIASHLNAITP---LAQSIAMGGVGCLTTTTPSEKALSGAGTVAGAVAGGSGSGSGEEGAGTEGKNAGVGLGGVLASIANPHQKLAKRRQLLEAKRER-------------------------KAAQTLAIITGAFVICWLPFFVMALTMSLCKECEIHTAVASL--FL-WLGYFNSTLNPVIYTIFNPEFRRAFKRIL 548          
BLAST of GCR027 vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 153.295 bits (386), Expect = 2.873e-40
Identity = 137/512 (26.76%), Postives = 227/512 (44.34%), Query Frame = 2
Query:   56 FEIITKTNLRETKFLGAFKMDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRY---RSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTK---VMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
             E+ T     E+ F  A +  N T          +YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  +   RY   R + V +   WI+ F+I+CPL LF L    T + +    C   N  F++ ++IV+F++P II  + YV    +L  +RK              V    +SS++ K T     K   V+ +   N    N + +  + +      N  D +  E  N N           +R    + +  +   S  +  +L+E       P+  V   E+    +   K      +  +P      Q S K  NK K  +                   + +KA Q L I+  +F+IC+LPFF+ ++V+ + ++        ++ T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:    1 MEVFTAYAFNESFFENASRDFNAT----EQGGRHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYN--TRYSSKRRVTVMISVVWILSFAISCPL-LFGLNNTVTHDDAL---CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVNTKR-----TCPVTDMDMSSTIKKCTHPDDVKLCTVIVKSSGNCPVNNKNVIFIKEVVN----NGDDIQMDEITNRN----------PSRQRKQDQSGGSQQNSRLVNSNLRETDISPPSPEAGVK-PERNGNTSSITKGAKAFEIQVSPTG--KTQTSVKTLNKRKISQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHIVNTYCQV------PPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of GCR027 vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 153.295 bits (386), Expect = 2.873e-40
Identity = 137/512 (26.76%), Postives = 227/512 (44.34%), Query Frame = 2
Query:   56 FEIITKTNLRETKFLGAFKMDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRY---RSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTK---VMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
             E+ T     E+ F  A +  N T          +YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  +   RY   R + V +   WI+ F+I+CPL LF L    T + +    C   N  F++ ++IV+F++P II  + YV    +L  +RK              V    +SS++ K T     K   V+ +   N    N + +  + +      N  D +  E  N N           +R    + +  +   S  +  +L+E       P+  V   E+    +   K      +  +P      Q S K  NK K  +                   + +KA Q L I+  +F+IC+LPFF+ ++V+ + ++        ++ T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:    1 MEVFTAYAFNESFFENASRDFNAT----EQGGRHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYN--TRYSSKRRVTVMISVVWILSFAISCPL-LFGLNNTVTHDDAL---CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVNTKR-----TCPVTDMDMSSTIKKCTHPDDVKLCTVIVKSSGNCPVNNKNVIFIKEVVN----NGDDIQMDEITNRN----------PSRQRKQDQSGGSQQNSRLVNSNLRETDISPPSPEAGVK-PERNGNTSSITKGAKAFEIQVSPTG--KTQTSVKTLNKRKISQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHIVNTYCQV------PPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of GCR027 vs. Ensembl Zebrafish
Match: drd3 (dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021119-1])

HSP 1 Score: 137.502 bits (345), Expect = 1.218e-34
Identity = 121/477 (25.37%), Postives = 210/477 (44.03%), Query Frame = 2
Query:  173 YVGLFIIPMLSM-WGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPL---KIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQ----TLPQRQVSFR--EQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            Y  L+ + +L++ +GN LVCI+V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +   W      C ++ +LDV    ++I++LC ISIDRY A+  P+     H  ++  S+++  V  W++ F+++CPL LF      T +  +   C   N  F++ +++V+F++P  +  + YV     L  +RK+      S  V      P +   L         + +S  ++N   E+   + R  +    L N L  +  +T    +  + P++            ++N C       +  E    +       + QV+ R  E +K  N    ++       + +   S  R   M +K K                         KA Q L I+  +F+IC+LPFFV ++++   + C +        T   W+GY  S  NP++Y  FN  FR  + +++ C
Sbjct:   38 YAMLYSLLILAIVFGNVLVCIAVLRERALQTTTNYLVVSLAVADLLVASLVMP---WAV----YLEVVGGAWLFSRLYCNVFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATV--WVLAFAVSCPL-LFGF---NTTDDPAV--CSISNPDFVIYSSVVSFYLPFAVTLLVYVRIYIFLRRRRKKITFRQGSGKVQPASAPPSVEMCLQDDAHK-EKRDLSPIRINVITESKEQVIRPRL----LANCLRRKRPQTAPAENSLLPPVI------------TLNYCSISQASFARTEQDANREEEEGGDEEQVAVRSCEVKKLANGRTHTSLRPPRAAHAMVCPSQARCRSMHSKEK-------------------------KATQMLAIVLGVFLICWLPFFVTHILNTHCRACHIPPEVYSAFT---WLGYVNSALNPVIYTTFNIEFRRAFIKILSC 454          
BLAST of GCR027 vs. Ensembl Zebrafish
Match: drd3 (dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021119-1])

HSP 1 Score: 137.502 bits (345), Expect = 1.292e-34
Identity = 121/477 (25.37%), Postives = 210/477 (44.03%), Query Frame = 2
Query:  173 YVGLFIIPMLSM-WGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPL---KIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQ----TLPQRQVSFR--EQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            Y  L+ + +L++ +GN LVCI+V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +   W      C ++ +LDV    ++I++LC ISIDRY A+  P+     H  ++  S+++  V  W++ F+++CPL LF      T +  +   C   N  F++ +++V+F++P  +  + YV     L  +RK+      S  V      P +   L         + +S  ++N   E+   + R  +    L N L  +  +T    +  + P++            ++N C       +  E    +       + QV+ R  E +K  N    ++       + +   S  R   M +K K                         KA Q L I+  +F+IC+LPFFV ++++   + C +        T   W+GY  S  NP++Y  FN  FR  + +++ C
Sbjct:   50 YAMLYSLLILAIVFGNVLVCIAVLRERALQTTTNYLVVSLAVADLLVASLVMP---WAV----YLEVVGGAWLFSRLYCNVFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATV--WVLAFAVSCPL-LFGF---NTTDDPAV--CSISNPDFVIYSSVVSFYLPFAVTLLVYVRIYIFLRRRRKKITFRQGSGKVQPASAPPSVEMCLQDDAHK-EKRDLSPIRINVITESKEQVIRPRL----LANCLRRKRPQTAPAENSLLPPVI------------TLNYCSISQASFARTEQDANREEEEGGDEEQVAVRSCEVKKLANGRTHTSLRPPRAAHAMVCPSQARCRSMHSKEK-------------------------KATQMLAIVLGVFLICWLPFFVTHILNTHCRACHIPPEVYSAFT---WLGYVNSALNPVIYTTFNIEFRRAFIKILSC 466          
BLAST of GCR027 vs. Ensembl Zebrafish
Match: drd3 (dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021119-1])

HSP 1 Score: 137.502 bits (345), Expect = 1.420e-34
Identity = 121/477 (25.37%), Postives = 210/477 (44.03%), Query Frame = 2
Query:  173 YVGLFIIPMLSM-WGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPL---KIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQ----TLPQRQVSFR--EQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            Y  L+ + +L++ +GN LVCI+V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +   W      C ++ +LDV    ++I++LC ISIDRY A+  P+     H  ++  S+++  V  W++ F+++CPL LF      T +  +   C   N  F++ +++V+F++P  +  + YV     L  +RK+      S  V      P +   L         + +S  ++N   E+   + R  +    L N L  +  +T    +  + P++            ++N C       +  E    +       + QV+ R  E +K  N    ++       + +   S  R   M +K K                         KA Q L I+  +F+IC+LPFFV ++++   + C +        T   W+GY  S  NP++Y  FN  FR  + +++ C
Sbjct:   56 YAMLYSLLILAIVFGNVLVCIAVLRERALQTTTNYLVVSLAVADLLVASLVMP---WAV----YLEVVGGAWLFSRLYCNVFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATV--WVLAFAVSCPL-LFGFN---TTDDPAV--CSISNPDFVIYSSVVSFYLPFAVTLLVYVRIYIFLRRRRKKITFRQGSGKVQPASAPPSVEMCLQDDAHK-EKRDLSPIRINVITESKEQVIRPRL----LANCLRRKRPQTAPAENSLLPPVI------------TLNYCSISQASFARTEQDANREEEEGGDEEQVAVRSCEVKKLANGRTHTSLRPPRAAHAMVCPSQARCRSMHSKEK-------------------------KATQMLAIVLGVFLICWLPFFVTHILNTHCRACHIPPEVYSAFT---WLGYVNSALNPVIYTTFNIEFRRAFIKILSC 472          
BLAST of GCR027 vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 147.902 bits (372), Expect = 3.399e-38
Identity = 126/478 (26.36%), Postives = 215/478 (44.98%), Query Frame = 2
Query:  158 RYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSS-----LAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
             YN+  + L ++  + ++GN LVCI+V  E  L+   NY +VSLA++D L A LVMP   W +    Y+E +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L       +++ K C   N  F++ ++IV+F++P I+  + YV    +L  +RK       S+ V     K K +        A F ++  +    +KK+  +  N    H   +    +     S     E   H   +P       +      + N C + NL PS  +  YK           E+        K   V  +   P      + S K  +K K  ++                  + +KA Q L I+  +F+IC+LPFF+ ++++     C++    + + +   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   27 HYNYYAMLLTLLIFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YMEVVG-EWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL------NNTASKVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSHGVEVNAHKDKCTHPEDVKLCAVFVKSNGSFPTDKKKVVSEAGN----HPEDMDVEMM-----SSTSPPEKTKHKSASP-----NHHQLAVPATSNQCNNANL-PSPVDSPYKA----------EKNGHPKDSTKPAKVFEIQTMPNG--KTRTSIKTMSKRKLSQH------------------KEKKATQMLAIVLGVFIICWLPFFIIHILNMHCN-CNI---PQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 440          
BLAST of GCR027 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 136.732 bits (343), Expect = 3.724e-34
Identity = 83/240 (34.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:  149 FHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            F    NW  +    + ++++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++++Y    ++ + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+  + +++  W I   I+ P+ +F L+ D ++     + C   +  FI+I + V FFIPLIIM +TY LT+K L     + EA L  N + +        S LA F+  P + + SEK
Sbjct:   54 FSLEKNWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEWP-LHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIH-HSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQ-DDSKVFDQ-ENCSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSL-----QKEATLCINNLGA-------KSKLALFSFLPQSSISSEK 277          

HSP 2 Score: 64.6994 bits (156), Expect = 2.198e-10
Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            I+  +KA + LGI+F LFVI + PFF+  ++  F K         ++L    W+GY  S  NP+VY  FN  +R  + R ++C+ YR
Sbjct:  298 ISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCR-YR 383          
BLAST of GCR027 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 137.117 bits (344), Expect = 3.949e-34
Identity = 83/240 (34.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:  149 FHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            F    NW  +    + ++++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++++Y    ++ + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+  + +++  W I   I+ P+ +F L+ D ++     + C   +  FI+I + V FFIPLIIM +TY LT+K L     + EA L  N + +        S LA F+  P + + SEK
Sbjct:   83 FSLEKNWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEWP-LHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIH-HSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQ-DDSKVFDQ-ENCSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSL-----QKEATLCINNLGA-------KSKLALFSFLPQSSISSEK 306          

HSP 2 Score: 64.3142 bits (155), Expect = 2.599e-10
Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            I+  +KA + LGI+F LFVI + PFF+  ++  F K         ++L    W+GY  S  NP+VY  FN  +R  + R ++C+ YR
Sbjct:  327 ISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCR-YR 412          
BLAST of GCR027 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 136.732 bits (343), Expect = 4.044e-34
Identity = 83/240 (34.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:  149 FHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            F    NW  +    + ++++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++++Y    ++ + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+  + +++  W I   I+ P+ +F L+ D ++     + C   +  FI+I + V FFIPLIIM +TY LT+K L     + EA L  N + +        S LA F+  P + + SEK
Sbjct:   61 FSLEKNWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEWP-LHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIH-HSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQ-DDSKVFDQ-ENCSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSL-----QKEATLCINNLGA-------KSKLALFSFLPQSSISSEK 284          

HSP 2 Score: 64.6994 bits (156), Expect = 2.181e-10
Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            I+  +KA + LGI+F LFVI + PFF+  ++  F K         ++L    W+GY  S  NP+VY  FN  +R  + R ++C+ YR
Sbjct:  305 ISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCR-YR 390          
BLAST of GCR027 vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 135.961 bits (341), Expect = 5.830e-34
Identity = 83/240 (34.58%), Postives = 137/240 (57.08%), Query Frame = 2
Query:  149 FHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK 865
            F    NW  +    + ++++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++++Y    ++ + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+  + +++  W I   I+ P+ +F L+ D ++     + C   +  FI+I + V FFIPLIIM +TY LT+K L     + EA L  N + +        S LA F+  P + + SEK
Sbjct:   63 FSLEKNWPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEWP-LHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIH-HSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQ-DDSKVFDQ-ENCSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSL-----QKEATLCINNLGA-------KSKLALFSFLPQSSISSEK 286          

HSP 2 Score: 64.6994 bits (156), Expect = 2.331e-10
Identity = 32/87 (36.78%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            I+  +KA + LGI+F LFVI + PFF+  ++  F K         ++L    W+GY  S  NP+VY  FN  +R  + R ++C+ YR
Sbjct:  307 ISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCR-YR 392          
BLAST of GCR027 vs. Ensembl Mouse
Match: Drd2 (dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94924])

HSP 1 Score: 137.887 bits (346), Expect = 7.233e-35
Identity = 120/473 (25.37%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  161 YNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSE-FKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L      E      C   N  F++ ++IV+F++P I+  + Y+    +L  +RK       S A     F+  L + L      P    M    +  K+  S  ++RR +  +     L+ E    T        +P+     +    + +   L  + +     +++ + + +  R   F E Q   N   ++                  S K  ++ K  +                   + +KA Q L I+  +F+IC+LPFF+ ++++     C++        T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   34 YNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPL-LFGLNNTDQNE------CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRA-----FRANLKTPLKGNCTHPED--MKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRT------------------SLKTMSRRKLSQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD-CNIPPVLYSAFT---WLGYVNSAVNPIIYTTFNIEFRKAFMKILHC 444          
BLAST of GCR027 vs. Ensembl Mouse
Match: Htr2a (5-hydroxytryptamine (serotonin) receptor 2A [Source:MGI Symbol;Acc:MGI:109521])

HSP 1 Score: 131.339 bits (329), Expect = 2.409e-32
Identity = 90/258 (34.88%), Postives = 145/258 (56.20%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKT--REHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEK--KLNGKNENSSAMHRRSIST 922
            NW+ +   ++ +L++ GN LV ++V +E  L+   NYFL+SLA++D L   LVMP+S   ++  Y    +  + C +W  LDV F+ ++I+HLC IS+DRY A++NP+  H +   R+   ++++  W I   I+ P+ +F L+ D    +E S    C   +  F+LI + V FFIPL IM +TY LT+K L     + EA L    V+ L  + KLSS    F+  P + + SEK  + +   E  S   RR++ +
Sbjct:   75 NWSALLTTVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWP-LPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNPIH-HSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGS----CLLADDNFVLIGSFVAFFIPLTIMVITYFLTIKSL-----QKEATL---CVSDLSTRAKLSS----FSFLPQSSLSSEKLFQRSIHREPGSYAGRRTMQS 314          

HSP 2 Score: 65.0846 bits (157), Expect = 1.193e-10
Identity = 35/122 (28.69%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 1193 PLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            P + LS ++ F+ S   +   Y+          + ++ I+  +KA + LGI+F LFV+ + PFF+  ++    K     +    +L    W+GY  S  NP+VY  FN  +R  + R ++CQ
Sbjct:  285 PQSSLSSEKLFQRSIHREPGSYAG--------RRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNENVIGALLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQ 398          
BLAST of GCR027 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 127.872 bits (320), Expect = 3.000e-31
Identity = 70/197 (35.53%), Postives = 121/197 (61.42%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKE 751
            NW  + + +I ++++ GN LV ++V +E  L    NYFL+SLA++D L  +LVMP+S   ++ +Y +  +    C +W SLDV F+ ++I+HLC IS+DRY A++NP++ H +   R+  ++++   W I   ++ P+ +  L  D+++   +   C   +  F+LI + V FFIPL IM +TY LT+   YV R++
Sbjct:   55 NWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDY-VWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIE-HSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLR-DESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTI---YVLRRQ 245          

HSP 2 Score: 65.855 bits (159), Expect = 7.325e-11
Identity = 29/84 (34.52%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            IN  +KA + LGI+F +F+I + PFF+  ++             EK+L    W+GY  S  NP+VY  FN I+R  + + ++C 
Sbjct:  304 INNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCD 387          
BLAST of GCR027 vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 127.872 bits (320), Expect = 3.000e-31
Identity = 70/197 (35.53%), Postives = 121/197 (61.42%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKE 751
            NW  + + +I ++++ GN LV ++V +E  L    NYFL+SLA++D L  +LVMP+S   ++ +Y +  +    C +W SLDV F+ ++I+HLC IS+DRY A++NP++ H +   R+  ++++   W I   ++ P+ +  L  D+++   +   C   +  F+LI + V FFIPL IM +TY LT+   YV R++
Sbjct:   55 NWPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDY-VWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIE-HSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLR-DESKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTI---YVLRRQ 245          

HSP 2 Score: 65.855 bits (159), Expect = 7.325e-11
Identity = 29/84 (34.52%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            IN  +KA + LGI+F +F+I + PFF+  ++             EK+L    W+GY  S  NP+VY  FN I+R  + + ++C 
Sbjct:  304 INNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCD 387          
BLAST of GCR027 vs. Ensembl Mouse
Match: Adra2b (adrenergic receptor, alpha 2b [Source:MGI Symbol;Acc:MGI:87935])

HSP 1 Score: 125.176 bits (313), Expect = 2.065e-30
Identity = 109/466 (23.39%), Postives = 190/466 (40.77%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCG-PQNAYFILIATIVTFFIPLIIMTVTYVLTVKI--------LYVQRKEAEA-----NLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSV-SSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            + +++GN+LV ++V     LR   N FLVSLA +D L A L++P S    +  Y+       WC ++ +LDV F  S+I+HLC IS+DRY A+   L+ + ++  R +   ++  W+I   I+ P  ++  + D+  E      C   Q A++IL ++I +FF P +IM + Y+    I        L  +R   E      +  +  V +    P L S L+             +K  G+            + S L  S+  + K T      +              E  ++    +    P LQ+ Q  + L     + R Q               +L   + + S Q   + +                        ++R ++    L ++  +FV+C+ PFF +Y +     IC         +  F  W+GY  S  NP++Y  FN  FR  ++R++
Sbjct:   24 LFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWY--FWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIY--KGDQRPEPHGLPQCELNQEAWYILASSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPHPAAGGVPASAKVPTLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAEKGA--EEDEEEVEECEPQTLPASPASVFNPPLQQPQTSRVL----ATLRGQ--------------VLLSKNVGVASGQWWRRRTQ-----------------------LSREKRFTFVLAVVIGVFVVCWFPFFFSYSLG---AICPQHCKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFRRIL 439          
BLAST of GCR027 vs. UniProt/SwissProt
Match: sp|P24628|DRD2A_XENLA (D(2) dopamine receptor A OS=Xenopus laevis OX=8355 GN=drd2-a PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 1.020e-36
Identity = 130/482 (26.97%), Postives = 215/482 (44.61%), Query Frame = 2
Query:  161 YNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSS-----LAKFTRTPSTKVMSEKKL-----NGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            YN+  + L ++  + ++GN LVCI+V  E  L+   NY +VSLA++D L A LVMP   W +    Y+E +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L       ++  K C   N  F++ ++IV+F++P I+  + YV    +L  +RK       S  VA    K K +        + F ++  +    +KK+      GK+     M   S STS             E   H   +P       N      + N C + +L  S  E  YK           E+        K   V  +   P      + S K  +K K  ++                  + +KA Q L I+  +F+IC+LPFF+ ++++     C++    + + +   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   28 YNYYAMLLTLLVFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WAV----YMEVVG-EWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL------NNTGSKVCIIDNPAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSRGVAVDAHKDKCTHPEDVKLCSVFVKSNGSFPADKKKVILVQEAGKHPEDMEMEMMS-STS-----------PPEKTKHKSASP-----DHNQLAVPATSNQCKNASLT-SPVESPYKA----------EKNGHPKDSTKPAKVFEIQSMPNG--KTRTSIKTMSKKKLSQH------------------KEKKATQMLAIVLGVFIICWLPFFIIHILNMHCN-CNI---PQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 442          
BLAST of GCR027 vs. UniProt/SwissProt
Match: sp|Q17232|OAR_BOMMO (Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.212e-34
Identity = 122/472 (25.85%), Postives = 211/472 (44.70%), Query Frame = 2
Query:  182 LFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLF------ALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQC 1561
            L +I + ++ GN LV +SV+    LR   N+F+VSLA++D   AILV+P++           +I  QW      C +W + D+    S+I++LC I++DRY A+ +P+    ++    ++  +   WI+   I+ P  L         E D     +S  G       F++ ++  +F+IPL+IMTV Y    +I    +K       +  +++      +SS   K+    S     +   +  N N      R ++            +  + H   ++TP      R    ++ S N      L          + L  R  S  E    + H           E+ +  ++     K+  + K ++ +A Y  +   EKQ   + R R+A +TLGI+  +FV+C+LPFFV YLV  F   C +S+   K + F+ W+GY  S  NP++Y  FN  FR  +++L+  +C
Sbjct:   61 LTMIIISTVVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNV--------AYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWILSLVISSPPLLGWNDWPEVFEPDTPCRLTSQPG-------FVIFSSSGSFYIPLVIMTVVY---FEIYLATKKRLRDRAKATKIST------ISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVA------------ENEKKHRTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVTDIGENLENRNTS-SESNSKETH-----------EDNMIEITEAAPVKIQKRPKQNQTNAVY--QFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCVSCCLSN---KFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLLFIKC 479          
BLAST of GCR027 vs. UniProt/SwissProt
Match: sp|P61168|DRD2_MOUSE (D(2) dopamine receptor OS=Mus musculus OX=10090 GN=Drd2 PE=1 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 5.059e-34
Identity = 120/473 (25.37%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  161 YNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSE-FKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L      E      C   N  F++ ++IV+F++P I+  + Y+    +L  +RK       S A     F+  L + L      P    M    +  K+  S  ++RR +  +     L+ E    T        +P+     +    + +   L  + +     +++ + + +  R   F E Q   N   ++                  S K  ++ K  +                   + +KA Q L I+  +F+IC+LPFF+ ++++     C++        T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   34 YNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPL-LFGLNNTDQNE------CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRA-----FRANLKTPLKGNCTHPED--MKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRT------------------SLKTMSRRKLSQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD-CNIPPVLYSAFT---WLGYVNSAVNPIIYTTFNIEFRKAFMKILHC 444          
BLAST of GCR027 vs. UniProt/SwissProt
Match: sp|P61169|DRD2_RAT (D(2) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd2 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 6.024e-34
Identity = 120/473 (25.37%), Postives = 210/473 (44.40%), Query Frame = 2
Query:  161 YNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSE-FKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L      E      C   N  F++ ++IV+F++P I+  + Y+    +L  +RK       S A     F+  L + L      P    M    +  K+  S  ++RR +  +     L+ E    T        +P+     +    + +   L  + +     +++ + + +  R   F E Q   N   ++                  S K  ++ K  +                   + +KA Q L I+  +F+IC+LPFF+ ++++     C++        T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   34 YNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPL-LFGLNNTDQNE------CIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRA-----FRANLKTPLKGNCTHPED--MKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRT------------------SLKTMSRRKLSQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHILNIHCD-CNIPPVLYSAFT---WLGYVNSAVNPIIYTTFNIEFRKAFMKILHC 444          
BLAST of GCR027 vs. UniProt/SwissProt
Match: sp|Q25188|OAR_HELVI (Octopamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.419e-33
Identity = 124/474 (26.16%), Postives = 211/474 (44.51%), Query Frame = 2
Query:  182 LFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLF------ALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLP-----QRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKT-KTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            L +I + ++ GN LV +SV+    LR   N+F+VSLA++D   AILV+P++           +I  QW      C +W + D+    S+I++LC I++DRY A+ +P+    ++    +++ +   W++   I+ P  L         E D     +S  G       F++ ++  +F+IPL+IMTV Y                           F+  L++      R  +TK+ +      K  N    H +           DS   E  ++ H  +T L++   +       +              + Q K  +P            E  + +N   +SN+  T  E+ L  ++     K  +K  K ++ SA Y  +   EKQ   + R R+A +TLGI+  +FV+C+LPFFV YLV  F   C +S+   K + F+ W+GY  S  NP++Y  FN  FR  +++L+
Sbjct:   59 LTLIIISTIVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNV--------AYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLSLIISSPPLLGWNDWPDVFEPDTPCRLTSQPG-------FVIFSSSGSFYIPLVIMTVVY---------------------------FEIYLATKKRLRDRAKATKISTISSGQNKYNNKDDHHDQ-----------DSVSSEANHNEHQGVTRLVSDNEKKKRTRKLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGENLENRNTSSESNSKET-HEDDLIEVNETVPVKTHHKKPKPNQQSAVY--QFIEEKQRISLTRERRAARTLGIIMGVFVVCWLPFFVIYLVIPFCASCCLSN---KFINFITWLGYCNSALNPLIYTIFNMDFRRAFKKLL 473          
BLAST of GCR027 vs. TrEMBL
Match: A0A193KU74 (GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr027 PE=2 SV=1)

HSP 1 Score: 1002.28 bits (2590), Expect = 0.000e+0
Identity = 495/496 (99.80%), Postives = 495/496 (99.80%), Query Frame = 2
Query:  113 MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 1600
            MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKP LQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR
Sbjct:    1 MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPPLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 496          
BLAST of GCR027 vs. TrEMBL
Match: A0A193KUM1 (GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr037 PE=2 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 3.824e-105
Identity = 199/475 (41.89%), Postives = 276/475 (58.11%), Query Frame = 2
Query:  167 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA-----NLYSNAVASLVFKPKL-SSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 1570
            WA++ L +IP+++++GN LV +SV++E  L+ RFNYFLVSLA+SDFLCAILVMP+S  KM+         HQ CL WYSLDVFFTA+TIIHLCTISIDRY AL NPL+ H  KR  SL +++  +W+IPF IACPLFL +L+++   +E SSFKGCGP NA FI+ A IVTF +PL+IM ++Y+LTVK +  Q K  ++     +  S    S ++K  + S+SL       ++KV  +   +   E  S +   SIST       D   +   + N+F  TP       +   EN   +     + +        + ++P R+ + R  + +  +  +      VL N        R    S +  T + S  Y            I +SRKAVQ LGI+F LFV CY+PFFV YL DFF   C   S    M+++ EW+GYS SM NP+VYH FNP FR T+ RL++C+CY+V
Sbjct:   29 WAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SIST-------DFSRRSLMSCNNFPTTP-------SKIQENIDGDKETYFDFRGKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLN-------SRLSVNSRRIATSDLSLRY------------IQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 465          
BLAST of GCR027 vs. TrEMBL
Match: A0A1S8WK07 (7 transmembrane receptor (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09436 PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 8.137e-81
Identity = 177/506 (34.98%), Postives = 260/506 (51.38%), Query Frame = 2
Query:  173 YVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKR-----YRSLVVQLVCAWIIPFSIACPLFLFALELDKTREH---------------SSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA-NLYSN-----AVASLV-------FKP-KLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMN-LCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHA 1585
            Y+ L +IP+ ++WGN  VC++V++E  LR RFN FLVSLA+SD LCAILVMP+SAW MI        N   CL+ YS+D+FFTA+TIIHLC+IS+DRY AL+ P    G+ R     ++SLV ++  +W +PFSIA PLF+FAL+ ++  E                 S+KGCGP +  F+L A  VTF +PLIIMT TYVLTVK+L     + +A  LY+      + +S++       F+P +++ S   + R    +    K       + S    +++ T  L + L    +  EN       P+  +        + S N +CG D   PS + +  +  +   +  F       +H      + +  E  L L S  R   +S+   T                  +I+  ++AV+ + +LF LFV CY PFF+ Y +      C   S AE  +  LEW+GY  SM NP+VYH FN  FR T++R+ +C C      HA
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIAT---RPQNRILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPF---GRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWERGDEEFIVTMTPESANITTSKSYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLYATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPP--RRIPIGVENPSTQDEASLSGNRVCGKD---PSDKSNDQQSYVKASETLFLTSTAKNDHDISGLELSSNHE--LGLPSQGRRTDISSAQTTTAID--------------RIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQC--RSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCACRTPHEHHA 485          
BLAST of GCR027 vs. TrEMBL
Match: A0A074ZZH1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02329 PE=3 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 8.733e-81
Identity = 179/506 (35.38%), Postives = 262/506 (51.78%), Query Frame = 2
Query:  173 YVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKR-----YRSLVVQLVCAWIIPFSIACPLFLFALELDKTREH---------------SSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA-NLYSN-----AVASLV-------FKP-KLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMN-LCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHA 1585
            Y+ L +IP+ ++WGN  VC++V++E  LR RFN FLVSLA+SD LCAILVMP+SAW MI        N   CL+ YS+D+FFTA+TIIHLC+IS+DRY AL+ P    G+ R     ++SLV ++  +W +PFSIA PLF+FAL+ ++  E                 S+KGCGP +  F+L A  VTF +PLIIMT TYVLTVK+L     + +A  LY+      + +S++       F+P +++ S   + R    +    K       + S    +++ T  L + L    +  EN       P+  +        + S N +CG D   PS + +  +  +   +  F       +H              L L S+      S   +TD  SA      +T   + +I+  ++AV+ + +LF LFV CY PFF+ Y +      C   S AE  +  LEW+GY  SM NP+VYH FN  FR T++R+ +C C      HA
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIAT---RPQNRILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPF---GRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWERGDEEFIVTMTPESANITTSKSYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLYATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPP--RRIPIGVENPSTQDEASLSGNRVCGKD---PSDKSNDQQSYVKASETLFLTSTAKNDHDISG----------LELSSNHELGLPSQGRRTDISSA------QTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQC--RSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCACRTPHEHHA 485          
BLAST of GCR027 vs. TrEMBL
Match: A0A4S2M3D3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002997 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 1.705e-78
Identity = 176/506 (34.78%), Postives = 260/506 (51.38%), Query Frame = 2
Query:  173 YVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKR-----YRSLVVQLVCAWIIPFSIACPLFLFALELDKTREH---------------SSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA-NLYSN-----AVASLV-------FKP-KLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMN-LCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHA 1585
            Y+ L +IP+ ++WGN  VC++V++E  LR RFN FLVSLA+SD LCAILVMP+SAW MI        N   CL+ YS+D+FFTA+TIIHLC+IS+DRY AL+ P    G+ R     ++SLV+++  +W +PFSIA PLF+FAL+ ++  E                 S+KGCGP +  F+L A  VTF +PLIIMT TYVLTVK+L     + +A  LY+      + +S++       F+P + + S   + R    +    K       +      +++ T  L + L    +  E        P+  +        + S N + G D   PS + +  +  +   +  F       +H              L L S+      S   +TD  SA      +T   + +I+  ++AV+ + +LF LFV CY PFF+ Y +      C   S AE  +  LEW+GY  SM NP+VYH FN  FR T++R+++C C      HA
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYMERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIAT---RPQNRILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPF---GRNRALPKIFQSLVLRIFMSWFVPFSIAGPLFVFALKWERGDEEFNVTMTPEAANITISKSYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLYATRPRPVSTSSVLWLRRDNSFRPTETNRSTKAWFRQTDQQTTIPKTAKYMPPSDCGCDEKTVKTCSLSDPLSYHNRPAEKPR--TRIPIGVENPSTQDEASLSGNRVSGKD---PSDRSNDQQSYIKASETLFLTSTAKTDHDISG----------LELSSNHELGLPSQGRRTDISSA------QTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQC--RSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRILQCACRTPHEHHA 485          
BLAST of GCR027 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 150.984 bits (380), Expect = 1.076e-39
Identity = 135/489 (27.61%), Postives = 216/489 (44.17%), Query Frame = 2
Query:  116 DNGTFPIFNMSFHSRYNWAYVGLFIIPML--SMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            DNGT    +    +++ + Y  + +  ++   ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L    TR+ S    C   N  F++ ++I++F++P II  + YV    +L  +RK           A    +P L   L K    P T V       G   ++S   +  ++    VN L ++     +  H E  P                     D+ K    +D   QT P+   SF E Q   N   K+ T  T               K  +K K  ++                  + +KA Q L I+  +F+IC+LPFF+ +++      C V     +M     W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   15 DNGTEAFNSTGCEAKHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPL-LFGLNNTATRDDSV---CEIANPAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRVNTKRNCQK-ADAEPQPPLKQLLIKEVVQPGTGVEM-----GLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPLHEEWQP--------------------HDDEKNGHAKD--AQT-PKETKSF-ETQALPNG--KTRTTVT---------------KTMSKRKMSQH------------------KEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCYVPL---EMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 423          
BLAST of GCR027 vs. Ensembl Cavefish
Match: drd2a (D(2)-like dopamine receptor [Source:NCBI gene;Acc:103036974])

HSP 1 Score: 151.369 bits (381), Expect = 1.198e-39
Identity = 128/476 (26.89%), Postives = 222/476 (46.64%), Query Frame = 2
Query:  158 RYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEAN-LYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDS-EFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSH-QRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            +YN+  + L ++  + ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   WI+ F+I+CPL LF L   ++R+ +    C   N  F++ ++IV+F++P II  + YV    +L  +RK       + ++ A      +  ++L K T     K+ +   +   N N    ++  I    +VN+ D  +  E  N       PL  +T          + L  + +      E +   T+P+  +       T +    +  V    E  ++     Q S K  NK K  +                   + +KA Q L I+  +F+IC+LPFF+ ++V+ ++ +        ++ T   W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   31 QYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWRFSTIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVTVMISVVWILSFAISCPL-LFGLNNTESRDDAL---CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVSTKRTFPSSTA------ERGTTLKKCTHPDDVKLCT--VIVKSNGNFPVNNKNVIFIKEVVNNADDVQADEVTNPE-----PLNQRTLEQTGASQHGLLLVSTHS------ETEVLPTVPEAPIKPSRNGNTGD----APRVTKAFETQVSPSGKTQSSVKSFNKRKFSQ------------------QKEKKATQMLAIVLGVFIICWLPFFITHIVNTYYNV------PAELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 447          
BLAST of GCR027 vs. Ensembl Cavefish
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:103024755])

HSP 1 Score: 144.821 bits (364), Expect = 3.509e-37
Identity = 127/475 (26.74%), Postives = 220/475 (46.32%), Query Frame = 2
Query:  173 YVGLFIIPMLSM-WGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPL---KIHGQKRYRSLVVQLVCAWIIPFSIACPL-FLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRS---FKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            Y  L+ + +L++ +GN LVC++V  E  L+   NY +VSLA+SD L A LVMP   W +    YLE +   W      C I+ +LDV    ++I++LC ISIDRY A+  P+     H  ++  S+++  V  WI+ F+++CPL F F    D          C   N  F++ +++V+F++P ++  + YV     L  +RK+      S  V     +P   + L + TR    + +S  ++N  NE++  + R  + + C                      L  K  R   VEN+ +      N   S+ +  + +T  +      E ++      +S   C V E     +S+ R+    + + +  T    A Y             +R +KA Q L I+  +F+IC+LPFFV ++++   + C +     ++ +   W+GY  S  NP++Y  FN  FR  + +++ C
Sbjct:   57 YAMLYSLLILAIVFGNVLVCMAVLREKSLQTTTNYLVVSLAVSDLLVASLVMP---WAV----YLEVVGGAWLFSRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATV--WILAFAVSCPLLFGFNTTDDPL-------VCSISNPDFVIYSSVVSFYLPFVVTLLVYVRIYVFLRKRRKKITFRQTSGEVQQGSAQPSAETCLQEETRK-VRRDLSPIRINVVNESTEKVVRPRLLSGC----------------------LRRKRPRTVPVENSLLPPMDLQNYC-SISQASFARTEQEPNREEEEGREEDQVTVRS---CEVKE-----ISNGRTHTTLRPAPRVTTRASQARYRSIH---------SREKKATQMLAIVLGVFLICWLPFFVTHILNTHCRSCYI---PPELYSAFTWLGYVNSALNPVIYTTFNIEFRRAFIKILTC 471          
BLAST of GCR027 vs. Ensembl Cavefish
Match: htr2ab (5-hydroxytryptamine (serotonin) receptor 2A, genome duplicate b [Source:ZFIN;Acc:ZDB-GENE-120215-60])

HSP 1 Score: 124.79 bits (312), Expect = 2.998e-30
Identity = 74/200 (37.00%), Postives = 115/200 (57.50%), Query Frame = 2
Query:  164 NWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLV-VQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQ 742
            NW  + + +  ++++ GN LV ++V +E  L+   NYFL+SLA++D L  +LVMP+S   ++ NY       +W      C IW  LDV F+ ++I+HLC IS+DRY A++NP++ H +   R+   V++  AW I   I+ P+ +  L       H+    C  +   F+LI + V FF+PLIIM VTY LT+  L  Q
Sbjct:   81 NWVALLILLAIVITVTGNILVIMAVSLERKLQNATNYFLMSLAITDMLLGLLVMPVSMVTILYNY-------RWPFPFVLCPIWIYLDVLFSTASIMHLCAISLDRYIAIRNPIQ-HSRSNSRARARVKIAAAWTISVGISMPVPVIGLYDHSKVFHNG--SCQLKEDNFVLIGSFVAFFVPLIIMVVTYFLTISALQSQ 270          

HSP 2 Score: 60.8474 bits (146), Expect = 1.872e-9
Identity = 31/90 (34.44%), Postives = 49/90 (54.44%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLE---WMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            I+  +KA + LG++F LFVI + PFFV    +    +C  +     M+  L    W+GY  S  NP++Y  FN  +R  + R ++C+ YR
Sbjct:  327 ISNEQKASKVLGVVFFLFVIMWCPFFVT---NVLLVVCDSACDPSLMIGLLNVFVWVGYLSSAVNPLIYTLFNKTYRAAFARYLRCR-YR 412          
BLAST of GCR027 vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 119.783 bits (299), Expect = 5.768e-29
Identity = 112/455 (24.62%), Postives = 182/455 (40.00%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPIS-AWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPST---KVMSEKKLNG---KNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQ--QKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            GN L  I+V+    L+   N FLVSLA +D L A LVMP S A +++  +Y   +   WC I+ +LDV F  ++I HLC IS+DRY ++   ++ + ++  R +   ++  W+I   I+ P      E +   +  S +    ++ ++I+ + I +FF+P IIM + Y+   +I   +                             TRTP     K   EKK NG   +  N  A +         VN++D E  E+ + +H    P  +K  R       S                   Q  P   ++ RE   + TK+  WK                                                 NR ++    L ++  +F+IC+ PFF  Y +    + C V+ T   +  F  W GY  S  NPI+Y  FN  FR  +++++
Sbjct:   29 GNLLAVIAVFTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGPV---WCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPLTIMKEDEPINDPPSCQI--NKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSR-----------------------------TRTPPGDRRKRDDEKKENGHCHERLNGDAANGNDKDDKGDVNAVDME--ESSSSDHKVTNPCASKKKRAKGKTKLS-------------------QIKPGDDINKRENANRGTKSSRWKGRQ----------------------------------------------NREKRFTFVLAVVIGVFMICWFPFFFTYTLRALCESCCVNET---LFKFFFWFGYCNSSLNPIIYTIFNNDFRRAFKKIL 379          
BLAST of GCR027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 8.119e-30
Identity = 69/179 (38.55%), Postives = 109/179 (60.89%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKG-CGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQ 742
            GN LV ++VW+E  L+   NYFL+SLA++D L  + VMPIS   ++ N     +  + C +W  LDV F+ ++I+HLC IS+DRY A+K P++ H +   RS  ++++   W I   IA P+ +  L+    ++H    G C      FI+  ++V+FF+PL+IM V YVLT+++L  Q
Sbjct:   21 GNLLVILAVWLEKKLQTATNYFLMSLAVADLLVGLTVMPISVINILYNMRWP-LPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQ-HSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQ---DQQHVFVNGACILNIQNFIIYGSVVSFFLPLLIMVVIYVLTIRLLRGQ 194          

HSP 2 Score: 67.781 bits (164), Expect = 1.964e-12
Identity = 37/99 (37.37%), Postives = 57/99 (57.58%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFF--KICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQ 1597
            ++  R+A + LGI+F LF++ + PFFV  +        +CSV + A+ M  F+ W+GY  S  NP+VY  FN  +R  ++R + C   R   RH SSS+
Sbjct:  275 LSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFV-WVGYVSSGVNPLVYTLFNQTYRQAFRRYVACDFRRA--RHRSSSK 370          
BLAST of GCR027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.227 bits (269), Expect = 1.122e-25
Identity = 65/187 (34.76%), Postives = 110/187 (58.82%), Query Frame = 2
Query:  203 SMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRS-LVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA 760
            ++ GN LV ++V +E  L+   NYFL+SLA++D L  ILVMPIS   ++  +    +    C +W  LDV F+ ++I+HLC IS+DRY A+K P++ H +   R+  +++++  W+I   I+ P+ +  L+ D    ++    C    + FI+  ++ +FF+PLIIM  +YV T ++L  Q    E 
Sbjct:   38 TIAGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKWP-LPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIE-HSRFNSRTKALLKILAVWVISVGISMPVPVLGLQ-DLAYVYTD-GSCQMNISDFIIYGSLSSFFLPLIIMVASYVSTTRVLRQQALLCEG 220          

HSP 2 Score: 55.0694 bits (131), Expect = 2.567e-8
Identity = 28/87 (32.18%), Postives = 43/87 (49.43%), Query Frame = 2
Query: 1307 INRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSS----TAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            I   ++A + LGI+FLLFV  + PFF+    +    +C   +        +L    W+GY  S  NP+VY  FN  +R  + R + C
Sbjct:  309 ITNEQRASKVLGIVFLLFVGMWCPFFIT---NVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFARYIAC 392          
BLAST of GCR027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 9.945e-22
Identity = 56/173 (32.37%), Postives = 102/173 (58.96%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISA-WKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTY 712
            + +++GNS V  ++ +E  L+   NY + SLA++D L +ILV+P++A ++++D +   T+    C I+ +LDV    S+I+HLC I++DRY A+ NP+    ++  R  V+ +   W++ FSI+ P  L     +   + ++ K    Q+  + + +T   F+IPLI+M V Y
Sbjct:   48 LCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRW---TLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPNACKIS--QDHGYTIYSTFGAFYIPLILMLVLY 215          
BLAST of GCR027 vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 95.9005 bits (237), Expect = 2.453e-21
Identity = 67/216 (31.02%), Postives = 107/216 (49.54%), Query Frame = 2
Query:  101 GAFKMDNGTFPIFNMSFHSRYNWAY-----VGL----FIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCG-PQNAYFILIATIVTFFIPLIIMTVTYV 715
            GA    NGT          +  W Y     +GL     I+   +++GN LV I+V     L+   N FLVSLA +D L A LV+P S +  +  Y+       WC I+ +LDV F  S+I+HLC IS+DRY ++   ++ + ++  R +   +V  W I  +I+ P  +   + ++  +E      C    N ++IL + I +FF P +IM + Y 
Sbjct:   30 GATNSSNGT--------DEKLGWEYSVLAGLGLSSLVLILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWY--FGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQKNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYA 235          

HSP 2 Score: 56.9954 bits (136), Expect = 6.151e-9
Identity = 29/84 (34.52%), Postives = 44/84 (52.38%), Query Frame = 2
Query: 1313 RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTA--EKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQ 1558
            R R+    L ++  +FVIC+ PFF  Y +     +CS  S A  E +  F  W GY  S  NP++Y  FN  FR  +++++  Q
Sbjct:  377 RERRFTFVLSVMIGVFVICWFPFFFTYSLS---ALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKILCMQ 457          
BLAST of GCR027 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 8.401e-20
Identity = 61/207 (29.47%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  185 FIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGP----------------QNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAE 757
            FII +++++GNSLV I+V+    L+   N FLVSLA +D L A LVMP S    +  Y++      WC ++ +LDV F  S+I+HLC IS+DRY ++   ++ + ++  R +   +V  W+I   I+ P  +              +G G                 +  +++L +   +FF P +IM + Y    +I  V +  A 
Sbjct:   42 FII-LVTIFGNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWV--FGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRPPANIHRHRHQGSGRNASSSPSSVLPTCKLNEETWYVLSSCTASFFTPCLIMLLVY---ARIYQVAKGRAR 242          

HSP 2 Score: 51.6026 bits (122), Expect = 3.434e-7
Identity = 26/80 (32.50%), Postives = 41/80 (51.25%), Query Frame = 2
Query: 1313 RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVS-STAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            R ++    L ++  +FV C+ PFF +Y +    KIC  S    E +  F  W GY  S  NP++Y  FN  FR  ++ ++
Sbjct:  387 REKRFTFVLAVVMGVFVACWFPFFFSYSLT---KICEASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNIL 463          
BLAST of GCR027 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 87.8113 bits (216), Expect = 1.281e-18
Identity = 54/201 (26.87%), Postives = 106/201 (52.74%), Query Frame = 2
Query:  182 LFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMI-DNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKI-----LYVQRKEAEANL 766
            + I+ +L++ GN LVC SV+    LR   NY +VSLA+SD L   L +P    +++ +  +   +  + C  W  +D+  + +++++L  IS DR  A+K PL+   +   +  ++ ++  WI   S A   FL  +E +     +++  CG +   +I +  +  FF PL+I+ + Y + +++     L VQ+++ +  L
Sbjct:   30 IVIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCA---FLSFVEWEGESTIAAYPQCGIRARVYITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIAL 227          
BLAST of GCR027 vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 82.0333 bits (201), Expect = 5.403e-17
Identity = 55/193 (28.50%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  188 IIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTRE----HSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEA 754
            +I  L ++GN LVC++++    LR   NY + SLA+SD L A L MP   +  + +     +    C  W  +D   + ++I +L  I+IDRY  L  P     + R     + ++  W+  F IA      +L L +       ++SF  C   + Y+   A  ++FF+PL+++ + Y +  K   V RK+A
Sbjct:   28 VILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTL-HLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA------SLSLTEPWSPDGFNASFPACAKMDKYYYAFAITMSFFLPLVVLIIAYSMVFK---VARKQA 210          
BLAST of GCR027 vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 81.6481 bits (200), Expect = 8.448e-17
Identity = 55/193 (28.50%), Postives = 94/193 (48.70%), Query Frame = 2
Query:  188 IIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTRE----HSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEA 754
            +I  L ++GN LVC++++    LR   NY + SLA+SD L A L MP   +  + +     +    C  W  +D   + ++I +L  I+IDRY  L  P     + R     + ++  W+  F IA      +L L +       ++SF  C   + Y+   A  ++FF+PL+++ + Y +  K   V RK+A
Sbjct:   39 VILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTL-HLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA------SLSLTEPWSPDGFNASFPACAKMDKYYYAFAITMSFFLPLVVLIIAYSMVFK---VARKQA 221          
BLAST of GCR027 vs. Ensembl Nematostella
Match: EDO49367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG65])

HSP 1 Score: 74.7146 bits (182), Expect = 9.015e-15
Identity = 48/170 (28.24%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  212 GNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLT 721
            GNSLVC+++ ++  LR   N+F+ SLA++D L  ++ +P   ++++            C +W   D+   A++I +L  IS+DRY  +  P + H +  ++  ++ +V  WI   +I   L +      K   H   + C   N  F  +A IV F +PL+I+ + YV+ 
Sbjct:   13 GNSLVCLAICLDHRLRNSTNWFIASLAVADLLYGLIGLP---FRIVQTSGTRVFTLNECFLWIWADMVCAAASIANLAVISVDRYLKITKPFQYHIRMTHKRALLAVVAVWIYS-AILASLSIMPWPGAKG-VHLFEQSCTNLNQVFYTVANIVAFILPLLILVLNYVMV 177          
BLAST of GCR027 vs. Ensembl Nematostella
Match: EDO44740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ8])

HSP 1 Score: 74.7146 bits (182), Expect = 1.262e-14
Identity = 64/246 (26.02%), Postives = 110/246 (44.72%), Query Frame = 2
Query:  188 IIPMLSMWGNSLVCISVWVEVGLRKRF-NYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIAC-PLFLFALELDKTREHSSFKGCG-PQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSI 916
            +I + ++ GN LV  +      LR    NY++VSLA SD L A LV+P    + I +  + T     C +W +L +     +II+LC +++DR+  L  PL+       R  +V +VC W      AC P+  +    D+  ++  F  C  P    ++++  I  F +P+I M V + L  KI    ++  +               KL  S++    T S  +   +  NG+   S    +++I
Sbjct:    5 LIIIFALLGNILVVYAFCNYHRLRANVTNYYIVSLAFSDILTAGLVVPFELDQTIRDG-IWTHGRITCQLWTTLYLLVVPGSIINLCAVTLDRFIVLHMPLRYTTIITPRKAIVAIVCLWTYALVTACLPVLGWK---DQNYDYILFNACYFPLLQEYVMLINITNFLLPMIFMAVFWSLIFKIAKKHQRRVK---------------KLERSMSMVETTMSLSINGNEAQNGRPSMSEGGKKKTI 231          
BLAST of GCR027 vs. Ensembl Medaka
Match: drd2a (dopamine receptor D2 [Source:NCBI gene;Acc:101164579])

HSP 1 Score: 152.14 bits (383), Expect = 9.638e-40
Identity = 137/509 (26.92%), Postives = 229/509 (44.99%), Query Frame = 2
Query:  116 DNGTFPIFNMSFHSRYNWAYVGLFIIPML--SMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQ-KRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEF-KETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQED--------QYKQTLPQRQ---------VSFREQQKTKNHYWKSNTVCTVLENPLALLSH--QRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            DNGT+   N     ++ + Y  + +  ++   ++GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +  +W      C I+ +LDV    ++I++LC ISIDRY A+  P+  + +    R + V +   W++ F+I+CPL LF L    TR+ S    C   N  F++ ++IV+F++P II  + YV    +L  +RK                KPK    + +   T     + +K  + ++     M  +S + S  VN     F K+  N                  +E   +N  GS   +  L +          ++Q +P +              E QK +    K+     VL +P  +++   Q     + KT+T          K   K+     + +KA Q L I+  +F+IC+LPFF+ ++++     C V +   +M     W+GY  S  NPI+Y  FN  FR  + +++ C
Sbjct:   15 DNGTWSFNNTEPLPKHTYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMP---WVV----YLEVVG-EWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSRRRVTVMISVVWVMSFAISCPL-LFGLNNTATRDESL---CVIANPAFVVYSSIVSFYVPFIITLLVYVQIYVVLRKRRKRVNT------------KPK--QRICQAADTDGATSLKDKCTHPEDVRLCTMIVKS-NGSFPVNKKKVIFIKDVANDGE--------------DLELDELNNSGSSQKQKQLTQSVLGDTPATSHQQLMPSKANASPTSTPPTPPEEGQKAE----KNEDTTDVLTDPAPIVAKAFQTQALPNGKTQTS--------VKTMSKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHILNTHCTKCKVPA---EMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 467          
BLAST of GCR027 vs. Ensembl Medaka
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:101163209])

HSP 1 Score: 139.043 bits (349), Expect = 3.374e-35
Identity = 125/478 (26.15%), Postives = 216/478 (45.19%), Query Frame = 2
Query:  173 YVGLFIIPMLSM-WGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQW------CLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVC-AWIIPFSIACPL-FLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKV-MSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTV---CTVLENPLALLSHQRSF----KMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKC 1555
            Y  L+ + +L++ +GN LVC++V  E  L+   NY +VSLA++D L A LVMP   W +    YLE +   W      C I+ +LDV    ++I++LC ISIDRY A+  P+  +     R  V  ++   W++ F+++CPL F F    D          C   N  F++ +++V+F++P I+  + Y+     L ++RK          V      P + + L +   TP  K  +S  ++  ++  SS   + S+ + C    L  +  +T    +  + P+       N+  + S   CG                L Q QV   EQ  + ++  +   +   C V E     LS+ R+      +S+      + + +              R +KA Q L I+  +F+IC+LPFFV ++++   + C +        T   W+GY  S  NP++Y  FN  FR  + +++ C
Sbjct:   39 YAMLYSLLILAIVFGNVLVCLAVLRERSLQTTTNYLVVSLAVADLLVASLVMP---WAV----YLEVVGGAWLFNRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHCSRKRVFAMIATVWVLAFAVSCPLLFGFNTTDDPMV-------CSISNPDFVIYSSVVSFYLPFIVTLLVYIRIYVFLRMRRKRIAFGQARGKVQPGSTHPSVETCLQE--ETPKAKQDLSPIRIKVQSVESSGTSKPSLLSGC----LWRKRPKTGPAQNSGLPPV----DMQNYC-SISHASCGRTEFD-----------LEQGQV---EQDASDSNQLELPPIRMNCEVKE-----LSNGRTHTSLRPISHSQNNPRFRSMHA-------------REKKATQMLAIVLGVFLICWLPFFVTHILNTHCRTCQIPPALYGAFT---WLGYVNSALNPVIYTTFNIEFRRAFIKILSC 456          
BLAST of GCR027 vs. Ensembl Medaka
Match: ENSORLT00000042787.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:101155866])

HSP 1 Score: 137.117 bits (344), Expect = 1.504e-34
Identity = 112/458 (24.45%), Postives = 203/458 (44.32%), Query Frame = 2
Query:  197 MLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPIS-AWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQN-AYFILIATIVTFFIPLIIMTVTYVLTVKI----LYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVS-STAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLM 1549
            +L++ GN LV I+V +   LR   N FLVSLA +D L A++V+P S A++++  +   +I   WC I  +LDV F  ++I+HLC I++DRY ++  P+     +  R +   +V  W+I   ++ P  L+    DK +       C P +  ++IL +TI +FF P +IM + Y+   +I    ++    E   + Y  A      K              S    S+K +  +   +  +   ++ T C   +  ++ K  E+    E  PL +    N            + +L  +  ED    +  +     +  ++        +    V ++P     ++ + K S+ TK        T++    +    INR ++    L ++  +FV+C+ PFF +Y +     +C       + +  F  W GY  S  NPI+Y  FN  FR  ++R++
Sbjct:   39 ILTIVGNILVIIAVLMSRSLRGPQNLFLVSLAAADILVALIVVPFSMAYELLGCWVFSSI---WCEIHKALDVLFCTASIVHLCAIALDRYLSISRPVSYGTTRSRRRIKSAIVMVWLIAAVVSFPPLLYLDTKDKVKGK-----CEPDDKPWYILYSTIGSFFAPCVIMILVYIRIYQIAKRHMHCPPGEKRRSFYGAATDDTEMK--------------SLPEESQKDVGQRAPAAPELSLTTVHTDC---AQWNDKKPAESPT--EGPPLFSTAVPN-----------AARDLPKAEGEDAVHTSSSESDTELQSIEEGDRAGGGGSPKAQV-QSPTC--RYKNTIKTSSGTKLLPEDTAKTQETPISRHKAMINREKRFTLVLAVVMGVFVVCWFPFFFSYSLK---AVCPEKYQVPDPLFRFFFWSGYCNSCLNPIIYTIFNRDFRTAFKRIL 452          
BLAST of GCR027 vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 135.576 bits (340), Expect = 3.487e-34
Identity = 125/497 (25.15%), Postives = 217/497 (43.66%), Query Frame = 2
Query:   89 TKFLGAFKMDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPIS-AWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQN-AYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETEN-HNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVS-STAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYR 1567
            T+ LG F     T      S  +    A +  F+I + ++ GN LV I+V     L+   N FLVSLA +D L A LVMP S A +++  +Y   +   WC I+ +LDV F  S+I+HLC IS+DRY ++   ++ + ++  R +   ++  W++   I+ P     + +D+  + SS   C   +  ++IL ++I +FF P +IM + Y+   ++   + +                KPK           P     +E   NG ++ SS +H                  E EN H H   TP     T     +   +    S          + K   PQRQ S R ++  K+ + K +   +               ++SNK+     S    ++    ++     R ++    L ++  +FV+C+ PFF +Y +   + +C  S    + +  F  W+GY  S  NP +Y  FN  FRH +Q+++ C+ ++
Sbjct:   12 TQRLGNFTPSGNTTLDGGYSLAAVAGIAALVSFLI-LFTVVGNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKV---WCGIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSPPL---VSIDRNNDISSQPQCELNDETWYILSSSIASFFAPCLIMILVYIRIYQVAKTRTRSMSEK-----------KPK-----------PDGVTQTE---NGLSKVSSPLH-----------------GEAENGHCHCPPTPSQRTVTTGPQTQEVDVEESSS---------SEGKGHNPQRQDSQRARKARKSSFSKHSAHIS---------------RVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTFVLAVVMGVFVMCWFPFFFSYSL---YGVCRDSCRIPDPLFKFFFWIGYCNSSLNPAIYTIFNRDFRHAFQKIL-CKAWK 431          
BLAST of GCR027 vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 133.265 bits (334), Expect = 1.422e-33
Identity = 116/470 (24.68%), Postives = 192/470 (40.85%), Query Frame = 2
Query:  176 VGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPIS-AWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKN--ENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFI 1576
            VG+ I   L ++GN LV I+V+    LR   N FLVSLA +D L A LVMP S A +++  +Y   +   WC I+ +LDV F  ++I HLC IS+DRY ++   ++ + ++  R +   +V  W+I   I+ P  L  +E +   E    K       ++++ + I +FF+P IIM + Y   V+I  + +K   A         L      ++   +         +  +KLNG+   E    + R +      VN  D E   + +H       +  K+ +                 K  L + +     PQR+      Q  K   WK                                                 NR ++    L ++  +FV+C+ PFF  Y++     +CS       +  F  W GY  S  NPI+Y  FN  FR  +++++ C+  R ++
Sbjct:   23 VGVMI--SLIVFGNVLVVIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGFWYFGKV---WCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFPP-LITMEKENGSESPVCK--INDEKWYVISSCIGSFFLPCIIMVLVY---VRIYQIAKKRTRAPPGDRQQKGLSGPGAAAAGQRENGVGEPDDGLCHEKLNGEQDVELKEGVERGADEAKVEVNGGDMEESSSSDHKADHPCSIPKKSAKG----------------KTRLSQVKPGDADPQRRA-----QSAKASRWKGRQ----------------------------------------------NREKRFTFVLAVVIGVFVVCWFPFFFTYMLK---TLCSSCYVPTALFNFFFWFGYCNSALNPIIYTIFNHDFRRAFKKIL-CRERRKYL 410          
BLAST of GCR027 vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 496/496 (100.00%), Postives = 496/496 (100.00%), Query Frame = 2
Query:  113 MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 1600
            MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR
Sbjct:    1 MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 496          
BLAST of GCR027 vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 982.245 bits (2538), Expect = 0.000e+0
Identity = 486/486 (100.00%), Postives = 486/486 (100.00%), Query Frame = 2
Query:  143 MSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 1600
            MSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR
Sbjct:    1 MSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR 486          
BLAST of GCR027 vs. Planmine SMEST
Match: SMESG000065390.1 (SMESG000065390.1)

HSP 1 Score: 334.724 bits (857), Expect = 1.063e-108
Identity = 199/475 (41.89%), Postives = 276/475 (58.11%), Query Frame = 2
Query:  167 WAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK-TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEA-----NLYSNAVASLVFKPKL-SSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 1570
            WA++ L +IP+++++GN LV +SV++E  L+ RFNYFLVSLA+SDFLCAILVMP+S  KM+         HQ CL WYSLDVFFTA+TIIHLCTISIDRY AL NPL+ H  KR  SL +++  +W+IPF IACPLFL +L+++   +E SSFKGCGP NA FI+ A IVTF +PL+IM ++Y+LTVK +  Q K  ++     +  S    S ++K  + S+SL       ++KV  +   +   E  S +   SIST       D   +   + N+F  TP       +   EN   +     + +        + ++P R+ + R  + +  +  +      VL N        R    S +  T + S  Y            I +SRKAVQ LGI+F LFV CY+PFFV YL DFF   C   S    M+++ EW+GYS SM NP+VYH FNP FR T+ RL++C+CY+V
Sbjct:   29 WAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKIETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNLDSFSTNGHRKSRFSQSEIYKKSMPSTSLTTSILNVNSKVCDDLNHSLNQEKLSLL---SIST-------DFSRRSLMSCNNFPTTP-------SKIQENIDGDKETYFDFRSKFSRLSRQMSIPFRKNTLRLHRNSSVNSERLRLCANVLLN-------SRLSVNSRRIATSDLSLRY------------IQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSC--KSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 465          
BLAST of GCR027 vs. Planmine SMEST
Match: SMESG000032679.1 (SMESG000032679.1)

HSP 1 Score: 326.635 bits (836), Expect = 3.551e-105
Identity = 192/496 (38.71%), Postives = 287/496 (57.86%), Query Frame = 2
Query:  158 RYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK--------------------TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAM----HRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMS-NKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 1570
            RY W ++GL IIP+ ++WGN+LVC+SV++E  L+ RFN+FLVSLA+SD LCA+LVMP+SAW M+ N    ++    CL WYSLDVFFT++TIIHLC+IS+DRY  L NPLK H  +   SL +++  AW+IPF IACPLF+FAL LD                     +++  S+KGCGP N YFI+I+T++TF +PL IM VTY+LTV  +  Q  +A  NLY N  ++       S  L +   T  ++ ++E   +  N+ S +M     +    +S  +NS DS  K       F++      + +N F  + ++         P+    +     P++ ++ ++Q    +  ++S        N   +   +   ++S  K  ++ +      +   ++ L  +N  +KAVQ LGILF LF++CYLPFFV YL+DFF   C   +    +++  EW+GYS SM NPIVYH FNP FR+T+ RLM+C+CY+V
Sbjct:   29 RYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSST------KSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGS----FKI------SHKNEFTIHLNV---------PTTDMRRSYDFSPKQNLAIKKQSSLTDKNFQS------FNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 491          
BLAST of GCR027 vs. Planmine SMEST
Match: SMESG000032682.1 (SMESG000032682.1)

HSP 1 Score: 322.013 bits (824), Expect = 2.528e-101
Identity = 195/513 (38.01%), Postives = 289/513 (56.34%), Query Frame = 2
Query:  158 RYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK--------------------TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAM----HRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMS----------NKTKTDEYSAFYXXXXXXXXXXXXINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSS 1594
            RY W ++GL IIP+ ++WGN+LVC+SV++E  L+ RFN+FLVSLA+SD LCA+LVMP+SAW M+ N    ++    CL WYSLDVFFT++TIIHLC+IS+DRY  L NPLK H  +   SL +++  AW+IPF IACPLF+FAL LD                     +++  S+KGCGP N YFI+I+T++TF +PL IM VTY+LTV  +  Q  +A  NLY N  +S   +P     L +   T  ++ ++E   +  N+ S +M     +    +S  +NS DS  K       F++      + +N F  + ++         P+    +     P++ ++ ++Q    +  ++               S   SFKMS           K  ++ +      +   ++ L  +N  +KAVQ LGILF LF++CYLPFFV YL+DFF   C   +    +++  EW+GYS SM NPIVYH FNP FR+T+ RLM+C+   + +R+  +S
Sbjct:   29 RYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNK-SSTKSRP-----LTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGS----FKI------SHKNEFTIHLNV---------PTTDMRRSYDFSPKQNLAIKKQSSLTDKNFQ---------------SFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKQIHLCLRNGQAS 499          
The following BLAST results are available for this feature:
BLAST of GCR027 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD21.102e-3426.00dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
HTR2A3.411e-3235.865-hydroxytryptamine receptor 2A [Source:HGNC Symbo... [more]
HTR2A3.411e-3235.865-hydroxytryptamine receptor 2A [Source:HGNC Symbo... [more]
ADRA2B1.880e-3122.75adrenoceptor alpha 2B [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA2A1.450e-2923.54adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR027 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-12.426e-3724.58SERotonin/octopamine receptor family; Serotonin re... [more]
ser-13.509e-3724.58SERotonin/octopamine receptor family; Serotonin re... [more]
tyra-32.341e-3526.01TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-33.022e-3526.13TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-33.982e-3526.01TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of GCR027 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop2R2.853e-3627.88gene:FBgn0053517 transcript:FBtr0343171[more]
5-HT2B5.806e-3231.13gene:FBgn0261929 transcript:FBtr0303603[more]
5-HT2B5.806e-3231.13gene:FBgn0261929 transcript:FBtr0339322[more]
5-HT2B7.072e-3231.13gene:FBgn0261929 transcript:FBtr0330144[more]
5-HT1B2.874e-2523.98gene:FBgn0263116 transcript:FBtr0330055[more]
back to top
BLAST of GCR027 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a2.873e-4026.76dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
drd2a2.873e-4026.76dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
drd31.218e-3425.37dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021... [more]
drd31.292e-3425.37dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021... [more]
drd31.420e-3425.37dopamine receptor D3 [Source:ZFIN;Acc:ZDB-GENE-021... [more]
back to top
BLAST of GCR027 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD23.399e-3826.36dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
slc25a293.724e-3434.58solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a293.949e-3434.58solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a294.044e-3434.58solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.830e-3434.58solute carrier family 25 (mitochondrial carnitine/... [more]
back to top
BLAST of GCR027 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drd27.233e-3525.37dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94... [more]
Htr2a2.409e-3234.885-hydroxytryptamine (serotonin) receptor 2A [Sourc... [more]
Htr2c3.000e-3135.535-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Htr2c3.000e-3135.535-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
Adra2b2.065e-3023.39adrenergic receptor, alpha 2b [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR027 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24628|DRD2A_XENLA1.020e-3626.97D(2) dopamine receptor A OS=Xenopus laevis OX=8355... [more]
sp|Q17232|OAR_BOMMO4.212e-3425.85Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV... [more]
sp|P61168|DRD2_MOUSE5.059e-3425.37D(2) dopamine receptor OS=Mus musculus OX=10090 GN... [more]
sp|P61169|DRD2_RAT6.024e-3425.37D(2) dopamine receptor OS=Rattus norvegicus OX=101... [more]
sp|Q25188|OAR_HELVI1.419e-3326.16Octopamine receptor OS=Heliothis virescens OX=7102... [more]
back to top
BLAST of GCR027 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KU740.000e+099.80GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A193KUM13.824e-10541.89GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A1S8WK078.137e-8134.987 transmembrane receptor (Fragment) OS=Opisthorchi... [more]
A0A074ZZH18.733e-8135.38G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A4S2M3D31.705e-7834.78G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR027 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2b1.076e-3927.61D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2a1.198e-3926.89D(2)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
drd33.509e-3726.74dopamine receptor D3 [Source:NCBI gene;Acc:1030247... [more]
htr2ab2.998e-3037.005-hydroxytryptamine (serotonin) receptor 2A, genom... [more]
adra2a5.768e-2924.62adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
back to top
BLAST of GCR027 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004593.18.119e-3038.55pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
ENSPMAT00000006953.11.122e-2534.76pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
ENSPMAT00000009127.19.945e-2232.37pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
adra2c2.453e-2131.02adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
ENSPMAT00000008360.18.401e-2029.47pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
back to top
BLAST of GCR027 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR027 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473591.281e-1826.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286035.403e-1728.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409998.448e-1728.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493679.015e-1528.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447401.262e-1426.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR027 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a9.638e-4026.92dopamine receptor D2 [Source:NCBI gene;Acc:1011645... [more]
drd33.374e-3526.15dopamine receptor D3 [Source:NCBI gene;Acc:1011632... [more]
ENSORLT00000042787.11.504e-3424.45alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
ADRA2C3.487e-3425.15adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
adra2a1.422e-3324.68adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
back to top
BLAST of GCR027 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000740.10.000e+0100.00SMESG000000740.1[more]
SMESG000000740.10.000e+0100.00SMESG000000740.1[more]
SMESG000065390.11.063e-10841.89SMESG000065390.1[more]
SMESG000032679.13.551e-10538.71SMESG000032679.1[more]
SMESG000032682.12.528e-10138.01SMESG000032682.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30033206 ID=SMED30033206|Name=GCR027|organism=Schmidtea mediterranea sexual|type=transcript|length=1765bp
GGAAAAGTTAAAAGAAATATAAAATATTTTTTTCCAATTTGTATTCAGCA
TATCCTTCGAAATTATAACAAAAACGAATTTAAGAGAAACGAAATTTCTG
GGAGCATTTAAAATGGATAATGGGACTTTTCCTATTTTTAACATGAGTTT
CCATTCTCGATACAATTGGGCTTATGTCGGTCTGTTTATTATTCCAATGT
TGAGTATGTGGGGTAACAGTTTGGTATGTATTTCTGTTTGGGTTGAGGTT
GGTCTCAGAAAAAGATTCAATTATTTTCTTGTTTCATTAGCTATGAGTGA
TTTTCTTTGTGCTATTCTCGTCATGCCAATTTCCGCTTGGAAAATGATTG
ATAATTATTATCTAGAAACTATTAACCATCAATGGTGTTTGATTTGGTAC
AGTTTGGATGTGTTTTTTACAGCCTCTACAATCATTCACTTGTGTACAAT
CTCAATTGACAGATACAATGCACTGAAAAACCCTTTAAAGATTCATGGCC
AAAAACGTTATAGATCATTAGTTGTCCAATTGGTATGCGCTTGGATAATA
CCTTTCAGTATTGCTTGTCCTTTGTTTTTGTTTGCTTTGGAACTGGACAA
GACTAGAGAGCATTCTTCATTCAAAGGATGTGGTCCACAAAACGCTTATT
TCATATTAATTGCTACAATTGTGACATTTTTCATTCCATTAATAATAATG
ACAGTTACGTATGTGTTAACAGTGAAAATTCTCTACGTCCAACGGAAAGA
AGCTGAGGCTAATCTTTATTCGAATGCTGTAGCTTCTCTTGTTTTCAAAC
CAAAGCTTTCAAGTTCTTTGGCCAAGTTTACCAGAACACCATCGACAAAG
GTTATGAGCGAAAAGAAATTAAACGGAAAAAATGAAAACTCGTCAGCAAT
GCATAGGAGATCAATTTCAACAAGTTGTTTAGTAAATTCTTTAGACTCAG
AATTCAAAGAAACAGAAAACCATAATCACTTTGAAATGACTCCTTTGTTA
GCAAAAACGACGAGAAATAATTTTGTTGAAAATACATCAATGAATCTCTG
TGGTTCAGACAATTTGAAACCATCTTTACAAGAAGACCAATACAAACAGA
CCTTACCTCAGAGGCAAGTTTCTTTTAGAGAACAGCAAAAAACTAAAAAT
CATTATTGGAAGTCAAACACAGTTTGTACTGTGCTGGAAAATCCTCTTGC
TTTATTATCACATCAAAGATCTTTCAAAATGTCAAACAAAACCAAAACTG
ATGAATATTCAGCTTTCTATACGAAAAAGAAAGAAACGGAAAAACAGCTG
AAACAAATTAATCGGTCAAGAAAAGCCGTACAAACGTTGGGGATTTTATT
TCTACTCTTTGTCATTTGTTATCTGCCATTCTTTGTCGCTTATCTTGTTG
ATTTTTTTTTCAAGATATGCTCAGTTTCCTCAACAGCGGAAAAAATGCTT
ACTTTCCTCGAATGGATGGGTTATTCAGGTTCGATGTTCAATCCGATTGT
TTATCACTTTTTTAATCCCATCTTTCGACATACCTATCAAAGATTAATGA
AATGCCAATGTTATAGGGTCTTCATACGCCACGCTAGCAGCAGTCAAAGA
TAAATTAAAATATTTTGTGACAAAGGGTTTTCATGGTCTACGAATTATCA
AATATACATAAAATATGTAAATCATAATTATAAATTGTCTTCATTTTGCT
TATATTGTTTCACATATAGATGTCGAGATTAGTAACAAATTTTAGATTGA
AATATATTTTTTTTG
back to top

protein sequence of SMED30033206-orf-1

>SMED30033206-orf-1 ID=SMED30033206-orf-1|Name=SMED30033206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=497bp
MDNGTFPIFNMSFHSRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRK
RFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDV
FFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSI
ACPLFLFALELDKTREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTY
VLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSE
KKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTT
RNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWK
SNTVCTVLENPLALLSHQRSFKMSNKTKTDEYSAFYTKKKETEKQLKQIN
RSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLE
WMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRVFIRHASSSQR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 389..409
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 28..211
e-value: 1.6E-47
score: 164.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 212..287
e-value: 1.6E-47
score: 164.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 348..484
e-value: 2.3E-22
score: 81.5
NoneNo IPR availablePANTHERPTHR24247:SF2285-HYDROXYTRYPTAMINE (SEROTONIN) RECEPTOR 2A, ISOFORM Bcoord: 12..486
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 12..486
NoneNo IPR availableCDDcd153347tmA_5-HT1Fcoord: 394..476
e-value: 7.52607E-15
score: 72.2888
NoneNo IPR availableCDDcd150527tmA_5-HT2coord: 18..212
e-value: 1.23185E-52
score: 176.735
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..494
NoneNo IPR availableTMHMMTMhelixcoord: 411..433
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
NoneNo IPR availableTMHMMTMhelixcoord: 180..202
NoneNo IPR availableTMHMMTMhelixcoord: 136..158
NoneNo IPR availableTMHMMTMhelixcoord: 448..470
NoneNo IPR availableTMHMMTMhelixcoord: 54..76
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 405..429
score: 28.22
coord: 135..156
score: 17.52
coord: 181..204
score: 27.24
coord: 19..43
score: 21.51
coord: 99..121
score: 30.31
coord: 446..472
score: 30.68
coord: 52..73
score: 34.14
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 34..464
e-value: 2.1E-53
score: 181.4
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 105..121
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 34..464
score: 36.821